Metagenome Family F067870

Overview

Basic Information

• Family ID: F067870
• Family Type: Metagenome
• Number of Sequences: 125
• Average Sequence Length: 43 residues
• Representative Sequence: MNQQHASFDPDQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR
• Number of Associated Samples: 101
• Number of Associated Scaffolds: 125

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 31.45 %
• % of genes near scaffold ends (potentially truncated): 30.40 %
• % of genes from short scaffolds (< 2000 bps): 89.60 %
• Associated GOLD sequencing projects: 84
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.48

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (96.800 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere (12.800 % of family members)
• Environment Ontology (ENVO): Unclassified (64.800 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (72.800 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Transmembrane (alpha-helical)
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 46.48%
  β-sheet: 0.00%
  Coil/Unstructured: 53.52%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 125 Family Scaffolds
PF04442	CtaG_Cox11	44.80
PF00115	COX1	28.80
PF00510	COX3	6.40
PF02628	COX15-CtaA	1.60
PF14850	Pro_dh-DNA_bdg	0.80
PF02104	SURF1	0.80
PF02790	COX2_TM	0.80
PF00476	DNA_pol_A	0.80
PF11137	DUF2909	0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 125 Family Scaffolds
COG3175	Cytochrome c oxidase assembly protein Cox11	Posttranslational modification, protein turnover, chaperones [O]	44.80
COG1845	Heme/copper-type cytochrome/quinol oxidase, subunit 3	Energy production and conversion [C]	6.40
COG1612	Heme A synthase	Coenzyme transport and metabolism [H]	1.60
COG0749	DNA polymerase I, 3'-5' exonuclease and polymerase domains	Replication, recombination and repair [L]	0.80
COG1622	Heme/copper-type cytochrome/quinol oxidase, subunit 2	Energy production and conversion [C]	0.80
COG3346	Cytochrome oxidase assembly protein ShyY1	Posttranslational modification, protein turnover, chaperones [O]	0.80

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	97.60 %
Unclassified	root	N/A	2.40 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	97.60 %
Unclassified	root	N/A	2.40 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	96.80 %
Unclassified	root	N/A	2.40 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	0.80 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	88.80 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	5.60 %
Unclassified	root	N/A	2.40 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.80 %

Level 5

Name	Rank	Taxonomy	Distribution
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	84.80 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	4.80 %
Unclassified	root	N/A	2.40 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.80 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	0.80 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.80 %

Level 6

Name	Rank	Taxonomy	Distribution
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	53.60 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	4.80 %
Unclassified	root	N/A	2.40 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.80 %
Thermomicrobia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia	0.80 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.80 %

Level 7

Name	Rank	Taxonomy	Distribution
Rhodanobacteraceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae	24.00 %
Xanthomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	8.00 %
Nostocales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales	4.80 %
Unclassified	root	N/A	2.40 %
Thermomicrobiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales	0.80 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.80 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.80 %

Level 8

Name	Rank	Taxonomy	Distribution
Rudaea	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea	24.00 %
Tolypothrichaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae	4.80 %
Unclassified	root	N/A	2.40 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples	0.80 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %
Burkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia	0.80 %

Level 9

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix	4.80 %
Unclassified	root	N/A	2.40 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.80 %
pseudomallei group	species group	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Level 10

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix campylonemoides	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides	4.80 %
Unclassified	root	N/A	2.40 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.80 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.80 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Level 11

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	4.80 %
Unclassified	root	N/A	2.40 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.80 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.80 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Level 12

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	4.80 %
Unclassified	root	N/A	2.40 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.80 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.80 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Level 13

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	4.80 %
Unclassified	root	N/A	2.40 %
eudicotyledons	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons	0.80 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.80 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Level 14

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	4.80 %
Unclassified	root	N/A	2.40 %
Gunneridae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae	0.80 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.80 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Level 15

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	4.80 %
Unclassified	root	N/A	2.40 %
Pentapetalae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae	0.80 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.80 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Level 16

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	4.80 %
Unclassified	root	N/A	2.40 %
asterids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids	0.80 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.80 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Level 17

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	4.80 %
Unclassified	root	N/A	2.40 %
campanulids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids	0.80 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.80 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Level 18

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	4.80 %
Unclassified	root	N/A	2.40 %
Asterales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales	0.80 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.80 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Level 19

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	4.80 %
Unclassified	root	N/A	2.40 %
Asteraceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae	0.80 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.80 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Level 20

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	4.80 %
Unclassified	root	N/A	2.40 %
Asteroideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae	0.80 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.80 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Level 21

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	4.80 %
Unclassified	root	N/A	2.40 %
Anthemideae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae	0.80 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.80 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Level 22

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	4.80 %
Unclassified	root	N/A	2.40 %
Anthemidinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae	0.80 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.80 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Level 23

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	4.80 %
Unclassified	root	N/A	2.40 %
Tanacetum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum	0.80 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.80 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Level 24

Name	Rank	Taxonomy	Distribution
Rudaea cellulosilytica	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	24.00 %
Tolypothrix campylonemoides VB511288	strain	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	4.80 %
Unclassified	root	N/A	2.40 %
Tanacetum cinerariifolium	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	0.80 %
Burkholderia pseudomallei	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	0.80 %
uncultured Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	0.80 %
Pseudoxanthomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	0.80 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2199352025|deepsgr__Contig_155828	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	565
3300001213|JGIcombinedJ13530_107529956	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	564
3300004643|Ga0062591_101228962	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	732
3300005169|Ga0066810_10113157	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	614
3300005327|Ga0070658_11241111	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	648
3300005327|Ga0070658_11589116	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	567
3300005328|Ga0070676_10330374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1042
3300005330|Ga0070690_100365806	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1051
3300005331|Ga0070670_101504236	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	618
3300005331|Ga0070670_101993472	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	535
3300005332|Ga0066388_100602800	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1721
3300005333|Ga0070677_10322245	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	792
3300005334|Ga0068869_100065110	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	2682
3300005334|Ga0068869_100491874	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1023
3300005335|Ga0070666_10182700	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1471
3300005336|Ga0070680_101305267	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	628
3300005337|Ga0070682_100210784	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1377
3300005338|Ga0068868_102064663	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	542
3300005340|Ga0070689_100445021	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1101
3300005347|Ga0070668_100546361	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1008
3300005355|Ga0070671_100189178	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1745
3300005356|Ga0070674_100809735	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	809
3300005434|Ga0070709_10230956	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1324
3300005434|Ga0070709_10330826	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1121
3300005436|Ga0070713_101657321	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	621
3300005439|Ga0070711_101353359	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	619
3300005456|Ga0070678_100292790	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1381
3300005456|Ga0070678_101460505	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	639
3300005457|Ga0070662_100662151	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	881
3300005530|Ga0070679_100800705	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	886
3300005543|Ga0070672_100348330	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1262
3300005543|Ga0070672_102080270	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	512
3300005564|Ga0070664_102392259	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	501
3300005578|Ga0068854_101196905	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Pseudoxanthomonas	681
3300005616|Ga0068852_102592730	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	527
3300005617|Ga0068859_102682229	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	548
3300005617|Ga0068859_102825481	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	533
3300005618|Ga0068864_100775878	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	941
3300005718|Ga0068866_10052662	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	2077
3300005719|Ga0068861_101621741	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	638
3300005836|Ga0074470_11354100	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	1362
3300005843|Ga0068860_100021545	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	6240
3300005844|Ga0068862_100332726	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1405
3300005844|Ga0068862_102567919	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	521
3300005900|Ga0075272_1080568	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	616
3300006237|Ga0097621_100082562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	2676
3300006237|Ga0097621_101092559	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	748
3300006624|Ga0101567_11506410	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	548
3300006904|Ga0075424_101883681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	632
3300009093|Ga0105240_10052467	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	5125
3300009098|Ga0105245_11059566	All Organisms → cellular organisms → Bacteria → Proteobacteria	856
3300009174|Ga0105241_10038202	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	3619
3300009174|Ga0105241_10707483	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	920
3300009176|Ga0105242_10161297	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1963
3300009545|Ga0105237_12299306	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	549
3300009545|Ga0105237_12515391	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	525
3300010366|Ga0126379_13500669	Not Available	526
3300010375|Ga0105239_12600147	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	590
3300010376|Ga0126381_102568915	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	729
3300010397|Ga0134124_11905144	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	630
3300010398|Ga0126383_12073586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	656
3300010401|Ga0134121_12845339	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	530
3300012903|Ga0157289_10140538	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	735
3300012971|Ga0126369_11683031	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	724
3300012984|Ga0164309_10612850	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	852
3300012987|Ga0164307_10209244	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1334
3300013100|Ga0157373_11019647	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	618
3300015265|Ga0182005_1224318	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	573
3300015374|Ga0132255_102531278	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	784
3300017792|Ga0163161_11504572	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	591
3300019361|Ga0173482_10008623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2544
3300019886|Ga0193727_1000257	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	19242
3300019996|Ga0193693_1034578	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	868
3300019996|Ga0193693_1047609	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	697
3300020000|Ga0193692_1058658	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	864
3300020062|Ga0193724_1121416	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	516
3300021415|Ga0193694_1010157	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1264
3300021445|Ga0182009_10041466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1905
3300022886|Ga0247746_1220166	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	502
3300025893|Ga0207682_10277359	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	784
3300025899|Ga0207642_10564661	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	704
3300025899|Ga0207642_10578755	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	696
3300025903|Ga0207680_10770889	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium	689
3300025906|Ga0207699_10232524	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1263
3300025907|Ga0207645_10037945	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	3091
3300025907|Ga0207645_11029463	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	557
3300025909|Ga0207705_10829192	All Organisms → cellular organisms → Bacteria → Proteobacteria	717
3300025909|Ga0207705_11504890	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	509
3300025911|Ga0207654_11384479	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei	513
3300025916|Ga0207663_10083706	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	2096
3300025916|Ga0207663_10352802	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1114
3300025921|Ga0207652_10615842	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	973
3300025924|Ga0207694_11780288	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	518
3300025932|Ga0207690_11853998	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	503
3300025934|Ga0207686_10487081	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	955
3300025937|Ga0207669_11276062	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	623
3300025949|Ga0207667_10271046	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium	1735
3300025949|Ga0207667_11328441	All Organisms → cellular organisms → Bacteria → Proteobacteria	695
3300025961|Ga0207712_10637272	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	925
3300025981|Ga0207640_11630518	All Organisms → cellular organisms → Bacteria	581
3300025986|Ga0207658_11279940	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	670
3300026023|Ga0207677_11342579	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	657
3300026035|Ga0207703_10508674	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1131
3300026035|Ga0207703_12213564	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	526
3300026078|Ga0207702_11817350	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae	601
3300026088|Ga0207641_10400282	All Organisms → cellular organisms → Bacteria	1318
3300026088|Ga0207641_10498751	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1182
3300026089|Ga0207648_10163016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	1969
3300026118|Ga0207675_100108114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rudaea → Rudaea cellulosilytica	2623
3300026118|Ga0207675_100650597	All Organisms → cellular organisms → Bacteria → Proteobacteria	1060
3300026121|Ga0207683_11633228	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Tolypothrichaceae → Tolypothrix → Tolypothrix campylonemoides → Tolypothrix campylonemoides VB511288	594
3300026142|Ga0207698_11373045	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	721
3300028379|Ga0268266_10362495	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1364
3300028380|Ga0268265_10348037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1352
3300028380|Ga0268265_12273338	Not Available	549
3300028768|Ga0307280_10038594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1457
3300031057|Ga0170834_102085236	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	632
3300031231|Ga0170824_118373305	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1072
3300031682|Ga0318560_10170504	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	1157
3300031939|Ga0308174_10011398	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	5149
3300031939|Ga0308174_10825958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	779
3300031996|Ga0308176_10283676	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1605
3300032261|Ga0306920_101066021	All Organisms → cellular organisms → Bacteria	1174
3300032261|Ga0306920_101146424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1126

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	61.60%
Environmental	Environmental	38.40%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	61.60%
Terrestrial	Environmental → Terrestrial	36.80%
Aquatic	Environmental → Aquatic	1.60%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	36.80%
Rhizosphere	Host-Associated → Plants → Rhizosphere	31.20%
Rhizoplane	Host-Associated → Plants → Rhizoplane	28.80%
Roots	Host-Associated → Plants → Roots	1.60%
Marine	Environmental → Aquatic → Marine	0.80%
Sediment	Environmental → Aquatic → Sediment	0.80%

Type

Habitat	Taxonomy	Distribution
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	25.60%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	24.80%
Soil	Host-Associated → Plants → Rhizosphere → Soil	19.20%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	12.00%
Loam	Environmental → Terrestrial → Soil → Loam	11.20%
Soil	Host-Associated → Plants → Rhizoplane → Soil	2.40%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.60%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.80%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.80%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.80%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.80%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	25.60%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	19.20%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	16.80%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	12.00%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	10.40%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	4.00%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	2.40%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	2.40%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	1.60%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.60%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.80%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.80%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.80%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	0.80%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.80%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	12.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	9.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	7.20%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	6.40%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	6.40%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	6.40%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	5.60%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	5.60%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	5.60%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.20%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	3.20%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.40%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	2.40%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	2.40%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	2.40%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.60%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil	1.60%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.60%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	1.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.60%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.80%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.80%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	0.80%
Rice Paddy Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil	0.80%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.80%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.80%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.80%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.80%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.80%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.80%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.80%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2199352025	Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL	Environmental
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental
3300005169	Soil and rhizosphere microbial communities from Laval, Canada - mgHPA	Environmental
3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Host-Associated
3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Host-Associated
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated
3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Environmental
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental
3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Host-Associated
3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Environmental
3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Host-Associated
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental
3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Environmental
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated
3300005900	Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404	Environmental
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated
3300006624	Soil microbial communities from the Leymus chinensis steppe, China - after adding 1.75 g N m- 2, yr-1	Environmental
3300006904	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3	Host-Associated
3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Host-Associated
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated
3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Host-Associated
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300012903	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1	Environmental
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental
3300012984	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG	Environmental
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated
3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Host-Associated
3300015374	Col-0 rhizosphere combined assembly	Host-Associated
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated
3300019361	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)	Environmental
3300019886	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2	Environmental
3300019996	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a2	Environmental
3300020000	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1	Environmental
3300020062	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1	Environmental
3300021415	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1	Environmental
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental
3300022886	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5	Environmental
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated
3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)	Environmental
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated
3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)	Host-Associated
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental
3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)	Environmental
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated
3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)	Host-Associated
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated
3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)	Host-Associated
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated
3300028768	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119	Environmental
3300031057	Oak Coassembly Site 11 - Champenoux / Amance forest	Environmental
3300031231	Coassembly Site 11 (all samples) - Champenoux / Amance forest	Environmental
3300031682	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22	Environmental
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental
3300032261	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
deepsgr_02572600	2199352025	Soil	MGATLVAMNSQHIKFDPDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLH
JGIcombinedJ13530_1075299561	3300001213	Wetland	MFRKAVNRQPANFDYDQRRAGIRRTVWIVGGIAFAIFVLFFLQQGIW
Ga0062591_1012289622	3300004643	Soil	MQAMHTEQTPFQTDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLH*
Ga0066810_101131572	3300005169	Soil	MSRKAVNQHQASFDPDQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR*
Ga0070658_112411112	3300005327	Corn Rhizosphere	VNQKTTTTNFDTDQRRAGIRRTAWVVGAFALAMFVLFFVKQAIWH*
Ga0070658_115891161	3300005327	Corn Rhizosphere	MNQQHASFDLDSRRAGIRRTVWIVGALAVAILVLFVVKQVLWP*
Ga0070676_103303741	3300005328	Miscanthus Rhizosphere	VNQKTTTTNFDTDQRRAGIRRTAWVVGAFALAMFVLFFVKQAIW
Ga0070690_1003658062	3300005330	Switchgrass Rhizosphere	MNQQHASFDPDQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR*
Ga0070670_1015042361	3300005331	Switchgrass Rhizosphere	MKGHSANFDYEQRRAGIRRTAWIVGGIAVAMFVLFFVKQGLWP*
Ga0070670_1019934722	3300005331	Switchgrass Rhizosphere	TTNFDTDQRRAGIRRTAWVVGAFALAMFVLFFVKQAIWH*
Ga0066388_1006028002	3300005332	Tropical Forest Soil	MTNPHSNSDFDQRRAGIRRTVWIVGGIALAIFVLFFLKQGIWH*
Ga0070677_103222451	3300005333	Miscanthus Rhizosphere	MQAMHTEKTPFQTDQRRAGIRRTAWMVGGLALAIFVLFFLQQGIWR*
Ga0068869_1000651105	3300005334	Miscanthus Rhizosphere	VNQKTTTTNFDTDQRRAGIRRTAWVVGGFALAMFVLFFVKQAIWH*
Ga0068869_1004918742	3300005334	Miscanthus Rhizosphere	MSNQHASFDPDQRRAGIRRTAWIVGGIAVAIFLLFFVEQGVLR*
Ga0070666_101827002	3300005335	Switchgrass Rhizosphere	MKAQHANFDYEQRRAGIRRTAWIVGGIAVAMFVLFFVKQGLWP*
Ga0070680_1013052672	3300005336	Corn Rhizosphere	EQTPFQTDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLH*
Ga0070682_1002107842	3300005337	Corn Rhizosphere	MNQPHANFNPEQRRAGIRRTAWIVGGIAFAIFVLFFLEQG
Ga0068868_1020646631	3300005338	Miscanthus Rhizosphere	MNQQHANFDPEQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR*
Ga0070689_1004450212	3300005340	Switchgrass Rhizosphere	MNSQHMNVDPDQRRAGIRRTAWIVGAIAVAIFVLFFVEQG
Ga0070668_1005463612	3300005347	Switchgrass Rhizosphere	MQAMHTEQTPFQTDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLR*
Ga0070671_1001891783	3300005355	Switchgrass Rhizosphere	KAQHANFDYEQRRAGIRRTAWIVGGIAVAMFVLFFVKQGLWP*
Ga0070674_1008097352	3300005356	Miscanthus Rhizosphere	MNSQHIKFDPEQRRAGIRRTAWMVGGLALAIFVLFFLQQGIWR*
Ga0070709_102309562	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MRERHANFDSDQRRAGIRRTAWIVGGMALAMFVLFFIKQGIWH*
Ga0070709_103308261	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MNQQHANFDSEQRRAGIRRTVWIVGGLALAMFVLFFLKQGIWH*
Ga0070713_1016573211	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	MSNQHASFDPDQRRAGIRRTAWIVGGIAFAIFVLFFLEQG
Ga0070711_1013533592	3300005439	Corn, Switchgrass And Miscanthus Rhizosphere	MNQQHANFDYDQRRAGIRRTAWIVGGIAFAIFVLFFLEQGV
Ga0070678_1002927902	3300005456	Miscanthus Rhizosphere	MSNQHASFDPDQRRAGIRRTAWIVGGIAVAIFVLFFVEQGVLR*
Ga0070678_1014605052	3300005456	Miscanthus Rhizosphere	LAMNSQHMNFDPDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLH*
Ga0070662_1006621512	3300005457	Corn Rhizosphere	MNSQHIKFDPEQRRAGIRRTAWIVGGIAVAMFVLFFVKQGLWP*
Ga0070679_1008007052	3300005530	Corn Rhizosphere	MNQPHANFNPEQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR*
Ga0070672_1003483301	3300005543	Miscanthus Rhizosphere	PSALSPQPLMQAMHTEQTPFQTDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLH*
Ga0070672_1020802702	3300005543	Miscanthus Rhizosphere	VNQKTTTTNFDTDQRRAGIRRTAWVVGAFALAMFVLF
Ga0070664_1023922591	3300005564	Corn Rhizosphere	LEQTMNQQHASFDLDSRRAGIRRTVWIVGALAVAILVLFVVKQVLWP*
Ga0068854_1011969052	3300005578	Corn Rhizosphere	MNQQHANFDSEQRRAGIRRTVWIVGALAVAILVLFVVKQVLWP*
Ga0068852_1025927302	3300005616	Corn Rhizosphere	MTNQPANFDSEQRRAGIRRTVWFVGALALAIFVLFFLKMAVWH*
Ga0068859_1026822292	3300005617	Switchgrass Rhizosphere	FDPDQRRAGIRRTAWIVGGIAVAMFVLFFVKQGLWP*
Ga0068859_1028254812	3300005617	Switchgrass Rhizosphere	MHTEQTPFQTDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVL
Ga0068864_1007758781	3300005618	Switchgrass Rhizosphere	FDPDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLR*
Ga0068866_100526622	3300005718	Miscanthus Rhizosphere	MHTEQTPFQTDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLH*
Ga0068861_1016217412	3300005719	Switchgrass Rhizosphere	MQAMHTEQTPFQTDQRRAGIRRTAWIVGAIAFAIFVLFFVEQGVLH*
Ga0074470_113541002	3300005836	Sediment (Intertidal)	MSKQYASFDVDQRRAGVRRTAWIVGVVAVAILVLFFLKQGVWS*
Ga0068860_1000215457	3300005843	Switchgrass Rhizosphere	MNSQQMNQQSANFDNEQRRAGIRRTALIVGGIALAIFVLFFVKQGFWP*
Ga0068862_1003327262	3300005844	Switchgrass Rhizosphere	VNQKTTTTNFDTDQRRAGIRRTVLVVGAFALAMFVLFFVKQAIWH*
Ga0068862_1025679192	3300005844	Switchgrass Rhizosphere	MNQQHANFDNDQRRAGIRRTAWIVGGIAIAMFVLFFVKQGIWH*
Ga0075272_10805681	3300005900	Rice Paddy Soil	MREQHTSFDYEQRRAGIRRTAWIVAGVAVAILVLF
Ga0097621_1000825624	3300006237	Miscanthus Rhizosphere	MQAMHTEQTSFQSDQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR*
Ga0097621_1010925592	3300006237	Miscanthus Rhizosphere	MSAHRNIENMTNSQHANFDPDQRRAGIRRTAWIVGGIAFAIFVLFFVEQGVLR*
Ga0101567_115064102	3300006624	Soil	MNLHNANLDHESRRAGIRRTVWIVGALALAILVLFFLKQGIWH*
Ga0075424_1018836812	3300006904	Populus Rhizosphere	MGQTLLAMNSQNMNFDPDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLH*
Ga0105240_100524671	3300009093	Corn Rhizosphere	LTLKKLMNQQHANFDYDQRRAGIRRTVWIVGGLALAMFVLFFLKQGIWH*
Ga0105245_110595661	3300009098	Miscanthus Rhizosphere	MNQQHANFDNDQRRAGIRRTAWIVGGIAIAMFVLFFVKQ
Ga0105241_100382022	3300009174	Corn Rhizosphere	LTLKKLMNQQHANFDSEQRRAGIRRTVWIVGGLALAMFVLFFLKQGIWH*
Ga0105241_107074831	3300009174	Corn Rhizosphere	MNQPHANFNPEQRRAGIRRTAWIVGGIAFAIFVLFFLE
Ga0105242_101612973	3300009176	Miscanthus Rhizosphere	MNSQHMNFDPDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLH*
Ga0105237_122993062	3300009545	Corn Rhizosphere	LTPKKLMNQQHANFDYDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLR*
Ga0105237_125153912	3300009545	Corn Rhizosphere	MRAMNQQHANFDTDQRRAGIRRTVWVVGAIAFAILVAFFVKQAVWH*
Ga0126379_135006692	3300010366	Tropical Forest Soil	MKTDSANFDNDQRRAGIRRTAWIVGGIALAIFVLFFLKQGIWH*
Ga0105239_126001472	3300010375	Corn Rhizosphere	MNQPHANFNPEQRRAGIRRTAWIVGGIAFGMFVLFIVKQGLWP*
Ga0126381_1025689152	3300010376	Tropical Forest Soil	MSGQNGKFDFDQRRAAGIRRTVWIVSAIALTILVLFFVKQGIWH*
Ga0134124_119051441	3300010397	Terrestrial Soil	FDPDQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR*
Ga0126383_120735862	3300010398	Tropical Forest Soil	MKTDPANYDLDQRRAGIRRTVWIVAGIALAILVLFFVKQGIWH*
Ga0134121_128453391	3300010401	Terrestrial Soil	MSNQHTNFDFDQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR*
Ga0157289_101405382	3300012903	Soil	MHTEQTPFQTDQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR*
Ga0126369_116830311	3300012971	Tropical Forest Soil	MSQQHANLDNDQRRAGIRRTVWIVAGIALAILVLFFVKQGIWH*
Ga0164309_106128501	3300012984	Soil	MSNQHASFDPDQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR*
Ga0164307_102092441	3300012987	Soil	MSNQHASFDPDQRRAGIRRTAWIVGGIAVAIFVLFFVEQGVLH*
Ga0157373_110196472	3300013100	Corn Rhizosphere	MKAQHANFDYEQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR*
Ga0182005_12243182	3300015265	Rhizosphere	MSQQHASFDPDQRRAGIRRTAWIVGGIALAIFVLFFLEQGVLR*
Ga0132255_1025312782	3300015374	Arabidopsis Rhizosphere	MNSQHMNVDPDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLH*
Ga0163161_115045721	3300017792	Switchgrass Rhizosphere	MHTEQTPFQTDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLH
Ga0173482_100086233	3300019361	Soil	MQAMHTEQTPFQTDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLH
Ga0193727_100025713	3300019886	Soil	MNQQHSSFGNDQRRAGIRRTAWIVGAVALAMFVLFFVKQGIWH
Ga0193693_10345782	3300019996	Soil	MRQQNANFDFDQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR
Ga0193693_10476092	3300019996	Soil	MSRKAVSQQHASFDPDQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR
Ga0193692_10586581	3300020000	Soil	VSQQHASFDPDQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR
Ga0193724_11214161	3300020062	Soil	MFRKAVSQQHASFDPDQRRAGVRRTAWIVGGVAFAIFVLFFLEQGVLR
Ga0193694_10101572	3300021415	Soil	MSSKAVSQQHASFDPDQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR
Ga0182009_100414662	3300021445	Soil	MSQQHASFDPDQRRAGIRRTAWIVGGIALAIFVLFFLEQGVLR
Ga0247746_12201662	3300022886	Soil	MQAMHTEQTPFQTDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVVH
Ga0207682_102773592	3300025893	Miscanthus Rhizosphere	MQAMHTEKTPFQTDQRRAGIRRTAWMVGGLALAIFVLFFLQQGIWR
Ga0207642_105646611	3300025899	Miscanthus Rhizosphere	NFYPDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLH
Ga0207642_105787552	3300025899	Miscanthus Rhizosphere	VNQKTTTTNFDTDQRRAGIRRTAWVVGAFALAMFVLFFVKQGIWH
Ga0207680_107708892	3300025903	Switchgrass Rhizosphere	MKGHSANFDYEQRRAGIRRTAWIVGGIAVAMFVLFFVKQGLWP
Ga0207699_102325242	3300025906	Corn, Switchgrass And Miscanthus Rhizosphere	MNQQHANFDSEQRRAGIRRTVWIVGGLALAMFVLFFLKQGIWH
Ga0207645_100379452	3300025907	Miscanthus Rhizosphere	VNQKTTTTNFDTDQRRAGIRRTAWVVGAFALAMFVLFFVKQAIWH
Ga0207645_110294632	3300025907	Miscanthus Rhizosphere	PFQTDQRRAGIRRTAWMVGGLALAIFVLFFLQQGIWR
Ga0207705_108291921	3300025909	Corn Rhizosphere	MKAQHANFDYEQRRAGIRRTAWIVGGIAVAMFVLFFVKQGLWP
Ga0207705_115048901	3300025909	Corn Rhizosphere	HASFDPDQRRAGIRRTAWIVGGIAVAIFVLFFVEQGVLR
Ga0207654_113844791	3300025911	Corn Rhizosphere	MNQQHANFDPEQRRAGIRRTAWIVGGIAFAIFVLFFLD
Ga0207663_100837061	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	RHANFDSDQRRAGIRRTAWIVGGMALAMFVLFFIKQGIWH
Ga0207663_103528022	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MNQQHANFDSEQRRAGIRRTAWIVGGIAIAMFVLFFVKQGIWH
Ga0207652_106158422	3300025921	Corn Rhizosphere	MNQPHANFNPEQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR
Ga0207694_117802882	3300025924	Corn Rhizosphere	MSNQHASFDPDQRRAGIRRTAWIVGGIAVAIFVLFFVEQGVLR
Ga0207690_118539982	3300025932	Corn Rhizosphere	DKPFLAMNSQHMNFDPDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLH
Ga0207686_104870812	3300025934	Miscanthus Rhizosphere	MQAMHTEQTSFQSDQRRAGIRRTAWIVGGIAFAIFVLFFLEQGV
Ga0207669_112760621	3300025937	Miscanthus Rhizosphere	DPEQRRAGIRRTAWMVGGLALAIFVLFFLQQGIWR
Ga0207667_102710462	3300025949	Corn Rhizosphere	MQAMHTEQTPFQTDQRRAGIRRTAWIVGAIAVAIFVLFFVEQGVLR
Ga0207667_113284411	3300025949	Corn Rhizosphere	MKAQHANFDYEQRRAGIRRTAWIVGGIAVAMFVLFFVK
Ga0207712_106372722	3300025961	Switchgrass Rhizosphere	MNQPHATFDYGQRRAGIRRTVWIVGGLALAMFVLFFLKQGIWH
Ga0207640_116305182	3300025981	Corn Rhizosphere	MNQQHANFDSEQRRAGIRRTAWIVGGIAVAMFVLFFVKQGLWP
Ga0207658_112799402	3300025986	Switchgrass Rhizosphere	FGRLEGRSNSMKGHSANFDYEQRRAGIRRTAWIVGGIAVAMFVLFFVKQGLWP
Ga0207677_113425792	3300026023	Miscanthus Rhizosphere	ANFVTGQRRAGIRRTAWVVGAFALAMFVLFFVKQAIWH
Ga0207703_105086741	3300026035	Switchgrass Rhizosphere	ANSTMSNQHASFDPDQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR
Ga0207703_122135642	3300026035	Switchgrass Rhizosphere	FDPDQRRAGIRRTAWTVGGIAFAIFVLFFLEQGVLR
Ga0207702_118173502	3300026078	Corn Rhizosphere	MNQQHANFDPEQRRAGIRRTAWIVGGIAFAIFVLFFLEQGVLR
Ga0207641_104002822	3300026088	Switchgrass Rhizosphere	MKGHSANFDYEQRRAGIRRTAWIVGGIAVAMFVLFFVKQGL
Ga0207641_104987511	3300026088	Switchgrass Rhizosphere	GRLEGRSNSMKGHSANFDYEQRRAGIRRTAWIVGGIAVAMFVLFFVKQGLWP
Ga0207648_101630162	3300026089	Miscanthus Rhizosphere	MNSQHIKFDPEQRRAGIRRTAWMVGGLALAIFVLFFLQQGIWR
Ga0207675_1001081141	3300026118	Switchgrass Rhizosphere	MNSQQMNQQSANFDNEQRRAGIRRTALIVGGIALAIFVLFFVKQGFWP
Ga0207675_1006505972	3300026118	Switchgrass Rhizosphere	MHTEQTPFQTDQRRAGIRRTPWIVGAIAFAIFVLFFVEQGVLH
Ga0207675_1006670773	3300026118	Switchgrass Rhizosphere	DTDQRRAGIRRTAWVVGGFALAMFVLFFVKQAIWH
Ga0207683_116332282	3300026121	Miscanthus Rhizosphere	MNSQHIKFDPQQRRAGIRRTAWMVGGLALAIFVLFFLQQGIWR
Ga0207698_113730452	3300026142	Corn Rhizosphere	MNQPHANFNPEQRRAGIRRTAWIVGGIAVAMFVLFFVKQGLWP
Ga0268266_103624952	3300028379	Switchgrass Rhizosphere	VNQKTTTTNFDTDQRRAGIRRTAWVVGGFALAMFVLFFVKQAIWH
Ga0268265_103480372	3300028380	Switchgrass Rhizosphere	VNQKTTTTNFDTDQRRAGIRRTVLVVGAFALAMFVLFFVKQAIWH
Ga0268265_122733382	3300028380	Switchgrass Rhizosphere	MNQQHANFDNDQRRAGIRRTAWIVGGIAIAMFVLFFVKQGIWH
Ga0307280_100385943	3300028768	Soil	MSQQHANFDYEQRRAGIRRTAWIVGGIAVAMFMLFFVKQGLWP
Ga0170834_1020852362	3300031057	Forest Soil	LSDQHANFDNDQRRAGIRRTAWVVAGISLAIFVLFFVKQGIWH
Ga0170824_1183733052	3300031231	Forest Soil	VNQQHANFDNDQRRAGIRRTVLIGGAIALAIFVLFFVKQGIWH
Ga0318560_101705042	3300031682	Soil	MNQQHANFDTDQRRAGVRRTVWIVGGIALAIFVLFFLKQGIWH
Ga0308174_100113988	3300031939	Soil	MTNQPANFDTDQRRAGIRRTVWLVGALALGIFVLFFLKMAVWH
Ga0308174_108259582	3300031939	Soil	MTNQPANFDSDQRRAGIRRTVWLVGALALAIFVLFFLKQAVWH
Ga0308176_102836762	3300031996	Soil	MNQQPANFDSDQRRAGIRRTVWLVGALALAIFVLFFLKMAVWH
Ga0306920_1010660212	3300032261	Soil	MNQQHANFDTDQRRAGVRRTVWIVGGIALAIFVLFFLKQGIW
Ga0306920_1011464242	3300032261	Soil	MTNSRTSFDENHRRAGVRRTVWIVAGIAAAVYVLFFLKQAFWH