NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F067854

Metagenome / Metatranscriptome Family F067854

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F067854
Family Type Metagenome / Metatranscriptome
Number of Sequences 125
Average Sequence Length 50 residues
Representative Sequence MVSSQAESLRKAIENLINAKLHDALARPGGLGRLVAHRTTGVASFDIRNAE
Number of Associated Samples 99
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 94.31 %
% of genes near scaffold ends (potentially truncated) 96.80 %
% of genes from short scaffolds (< 2000 bps) 98.40 %
Associated GOLD sequencing projects 96
AlphaFold2 3D model prediction Yes
3D model pTM-score0.67

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (69.600 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(16.800 % of family members)
Environment Ontology (ENVO) Unclassified
(22.400 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(38.400 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 50.63%    β-sheet: 0.00%    Coil/Unstructured: 49.37%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.67
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF00072Response_reg 0.80
PF12697Abhydrolase_6 0.80
PF13089PP_kinase_N 0.80
PF07238PilZ 0.80
PF13380CoA_binding_2 0.80



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms69.60 %
UnclassifiedrootN/A30.40 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000750|JGI12272J11983_1192885All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium511Open in IMG/M
3300000828|JGI12467J12023_1035841All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium549Open in IMG/M
3300001538|A10PFW1_11466319All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium536Open in IMG/M
3300004092|Ga0062389_103508946Not Available588Open in IMG/M
3300004798|Ga0058859_11748878All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium505Open in IMG/M
3300005331|Ga0070670_102194095All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium509Open in IMG/M
3300005436|Ga0070713_102008614All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium561Open in IMG/M
3300005439|Ga0070711_101099192All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium685Open in IMG/M
3300005539|Ga0068853_102015748All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium560Open in IMG/M
3300005539|Ga0068853_102303080All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium522Open in IMG/M
3300005840|Ga0068870_10906650Not Available623Open in IMG/M
3300005844|Ga0068862_100802475All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium919Open in IMG/M
3300006237|Ga0097621_101283339All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium691Open in IMG/M
3300006800|Ga0066660_11575520All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium519Open in IMG/M
3300006954|Ga0079219_10403525Not Available908Open in IMG/M
3300007004|Ga0079218_11726121Not Available696Open in IMG/M
3300009012|Ga0066710_104243442All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium536Open in IMG/M
3300009083|Ga0105047_10456753Not Available1232Open in IMG/M
3300009157|Ga0105092_10972781Not Available504Open in IMG/M
3300009174|Ga0105241_10699569All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium925Open in IMG/M
3300009174|Ga0105241_11352863All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium680Open in IMG/M
3300009553|Ga0105249_13060456Not Available537Open in IMG/M
3300010122|Ga0127488_1053831All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium564Open in IMG/M
3300010143|Ga0126322_1195833All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium503Open in IMG/M
3300010362|Ga0126377_12915824Not Available552Open in IMG/M
3300010379|Ga0136449_103528828Not Available595Open in IMG/M
3300010858|Ga0126345_1086967All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium545Open in IMG/M
3300010865|Ga0126346_1013207All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium533Open in IMG/M
3300010866|Ga0126344_1009379All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium637Open in IMG/M
3300010896|Ga0138111_1153362All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium561Open in IMG/M
3300011120|Ga0150983_11482609All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium551Open in IMG/M
3300012212|Ga0150985_103389940All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium629Open in IMG/M
3300012212|Ga0150985_105146871All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium579Open in IMG/M
3300012212|Ga0150985_111848368All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium567Open in IMG/M
3300012212|Ga0150985_116998794All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium676Open in IMG/M
3300012224|Ga0134028_1106652All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium507Open in IMG/M
3300012382|Ga0134038_1183402All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium569Open in IMG/M
3300012390|Ga0134054_1244949Not Available556Open in IMG/M
3300012390|Ga0134054_1313404All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium702Open in IMG/M
3300012398|Ga0134051_1270481All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium537Open in IMG/M
3300012410|Ga0134060_1050878All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium512Open in IMG/M
3300012469|Ga0150984_103025248All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium513Open in IMG/M
3300012469|Ga0150984_105512552All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium665Open in IMG/M
3300012469|Ga0150984_107153746All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium555Open in IMG/M
3300012469|Ga0150984_107507718All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium561Open in IMG/M
3300012469|Ga0150984_115299799Not Available603Open in IMG/M
3300012678|Ga0136615_10338450All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium659Open in IMG/M
3300012684|Ga0136614_10919534Not Available605Open in IMG/M
3300012909|Ga0157290_10231246Not Available646Open in IMG/M
3300012961|Ga0164302_11220989All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium602Open in IMG/M
3300013104|Ga0157370_11046283All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium738Open in IMG/M
3300013306|Ga0163162_12537424All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium589Open in IMG/M
3300013307|Ga0157372_12198484Not Available634Open in IMG/M
3300014168|Ga0181534_10854438All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium541Open in IMG/M
3300014655|Ga0181516_10612974Not Available562Open in IMG/M
3300014968|Ga0157379_12296073All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium537Open in IMG/M
3300015372|Ga0132256_102686750All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium597Open in IMG/M
3300017787|Ga0183260_10475982All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium818Open in IMG/M
3300017946|Ga0187879_10485197Not Available685Open in IMG/M
3300018034|Ga0187863_10123002Not Available1450Open in IMG/M
3300018468|Ga0066662_10830348Not Available900Open in IMG/M
3300018468|Ga0066662_10880840All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia877Open in IMG/M
3300018469|Ga0190270_11413740All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium742Open in IMG/M
3300018920|Ga0190273_11616892All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium580Open in IMG/M
3300019258|Ga0181504_1487569All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium541Open in IMG/M
3300019260|Ga0181506_1373566All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium581Open in IMG/M
3300019268|Ga0181514_1220500Not Available507Open in IMG/M
3300019356|Ga0173481_10697222All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium548Open in IMG/M
3300020081|Ga0206354_10371085Not Available511Open in IMG/M
3300020081|Ga0206354_11625019All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium516Open in IMG/M
3300022499|Ga0242641_1042441All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium531Open in IMG/M
3300022505|Ga0242647_1034721All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium556Open in IMG/M
3300022529|Ga0242668_1140965All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium523Open in IMG/M
3300022708|Ga0242670_1068513All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium537Open in IMG/M
3300022708|Ga0242670_1074509All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium523Open in IMG/M
3300022708|Ga0242670_1084434All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium502Open in IMG/M
3300022713|Ga0242677_1063645All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium567Open in IMG/M
3300022716|Ga0242673_1103943All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium552Open in IMG/M
3300022722|Ga0242657_1176563Not Available578Open in IMG/M
3300025906|Ga0207699_11423317Not Available513Open in IMG/M
3300025928|Ga0207700_10620568All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium963Open in IMG/M
3300026041|Ga0207639_11611920Not Available609Open in IMG/M
3300027807|Ga0209208_10192712All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium1146Open in IMG/M
3300028590|Ga0247823_11124619All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium589Open in IMG/M
3300028783|Ga0302279_10361824All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium618Open in IMG/M
3300029701|Ga0222748_1054937Not Available692Open in IMG/M
3300030503|Ga0311370_11790182Not Available625Open in IMG/M
3300030580|Ga0311355_10938123Not Available783Open in IMG/M
3300030741|Ga0265459_13828491Not Available528Open in IMG/M
3300030829|Ga0308203_1069022All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium565Open in IMG/M
3300030905|Ga0308200_1049802All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium780Open in IMG/M
3300030905|Ga0308200_1147922All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium541Open in IMG/M
3300030968|Ga0075376_11284964All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium508Open in IMG/M
3300030986|Ga0308154_108464Not Available649Open in IMG/M
3300030988|Ga0308183_1143605All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium582Open in IMG/M
3300030988|Ga0308183_1161625All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium559Open in IMG/M
3300030988|Ga0308183_1187916All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium531Open in IMG/M
3300030993|Ga0308190_1192451Not Available509Open in IMG/M
3300030997|Ga0073997_12195569All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium501Open in IMG/M
3300031057|Ga0170834_103005585Not Available525Open in IMG/M
3300031057|Ga0170834_111559825Not Available611Open in IMG/M
3300031058|Ga0308189_10319751All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium614Open in IMG/M
3300031058|Ga0308189_10360491All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium588Open in IMG/M
3300031058|Ga0308189_10380681All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium577Open in IMG/M
3300031089|Ga0102748_11802157All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium504Open in IMG/M
3300031092|Ga0308204_10364645All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium500Open in IMG/M
3300031093|Ga0308197_10416049All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium530Open in IMG/M
3300031099|Ga0308181_1152126All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium542Open in IMG/M
3300031231|Ga0170824_104769666Not Available581Open in IMG/M
3300031231|Ga0170824_109878072All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium586Open in IMG/M
3300031231|Ga0170824_119144350Not Available589Open in IMG/M
3300031231|Ga0170824_119539707All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium528Open in IMG/M
3300031234|Ga0302325_12509864All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium615Open in IMG/M
3300031474|Ga0170818_102826505Not Available576Open in IMG/M
3300031495|Ga0314817_122114All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium566Open in IMG/M
3300031866|Ga0316049_123702Not Available509Open in IMG/M
3300032074|Ga0308173_12303709All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium508Open in IMG/M
3300032515|Ga0348332_11459003Not Available561Open in IMG/M
3300032515|Ga0348332_14260961All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium524Open in IMG/M
3300034221|Ga0334937_085888All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium868Open in IMG/M
3300034644|Ga0370548_050501All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium741Open in IMG/M
3300034661|Ga0314782_143174All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium580Open in IMG/M
3300034663|Ga0314784_118105All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → Phycisphaerales → unclassified Phycisphaerales → Phycisphaerales bacterium571Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.20%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil6.40%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil6.40%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland4.00%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.20%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.20%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere3.20%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil3.20%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand2.40%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.40%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.40%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.40%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog1.60%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.60%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.60%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.60%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil1.60%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter1.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.60%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.60%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.80%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.80%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.80%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.80%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.80%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.80%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.80%
BiocrustEnvironmental → Terrestrial → Soil → Soil Crust → Unclassified → Biocrust0.80%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.80%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.80%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.80%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated0.80%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000750Soil microbial communities from Moab, Utah, sample - Soil Crust Dry out, 3 days (biological replicate A) D5A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300000828Soil microbial communities from Moab, Utah, sample - Soil Crust Dry out, 3 days (biological replicate C) D5C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004798Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009083Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly)EnvironmentalOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010122Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010143Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010858Boreal forest soil eukaryotic communities from Alaska, USA - C3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010865Boreal forest soil eukaryotic communities from Alaska, USA - C3-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010896Grasslands soil microbial communities from Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012224Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012382Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_4_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012390Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012398Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012410Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012678Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ288 (22.06)EnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012909Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014655Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017787Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2)EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019258Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019260Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019268Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022499Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022505Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022529Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022713Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022716Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022722Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027807Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fd - Sphagnum fallax MG (SPAdes)Host-AssociatedOpen in IMG/M
3300028590Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30EnvironmentalOpen in IMG/M
3300028783Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3EnvironmentalOpen in IMG/M
3300029701Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300030741Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assemblyEnvironmentalOpen in IMG/M
3300030829Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030968Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB6 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030986Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_143 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030993Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030997Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031058Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_184 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031089Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 2B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031495Metatranscriptome of soil surface biofilm microbial communities from soil inoculated with nitrogen-fixing consortium DG1, State College, Pennsylvania, United States - MICR_N_R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031866Metatranscriptome of soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032515FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data)EnvironmentalOpen in IMG/M
3300034221Biocrust microbial communities from Mojave Desert, California, United States - 33SMCEnvironmentalOpen in IMG/M
3300034644Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_123 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034661Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R3 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300034663Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12272J11983_119288513300000750SoilMVPGQAETLRKAIENLINAKLHDALAKPGGLGRLVAHRVTGVASYDIRNAERQLEAALT
JGI12467J12023_103584113300000828SoilVVSEQAESLRKAIENLINAKLHDALGKPGGLGRLVAHRVTGVASYD
A10PFW1_1146631923300001538PermafrostMANQAHSLRKAIENLINAKLHDAVAKPGGLDRLIAHRVTG
Ga0062389_10350894613300004092Bog Forest SoilMFVSQAETLRKAIEKLIDAKLHDVLSRPGGLDRLMAHRRTGVASYDIRMAEQNL
Ga0058859_1174887813300004798Host-AssociatedMASQAETLRKAIENLINAKLHDALARPGGLGRLIAHRTTGVASPDIRNAER
Ga0070670_10219409523300005331Switchgrass RhizosphereMVASQAETLRKAIENLVDAKLHDALSRPGGLERLTAHRLTGVASFDIRNAE
Ga0070713_10200861413300005436Corn, Switchgrass And Miscanthus RhizosphereMANDHAQSLRKAIENLINVKLHDALGRPGGLDRLIAHRATGVAS
Ga0070711_10109919213300005439Corn, Switchgrass And Miscanthus RhizosphereMANQAQSLRKAIENLINAKLHDALAKPGGLDRLIAHRVTGVASWEIRNAEKQLD
Ga0068853_10201574813300005539Corn RhizosphereMANQAQSLRKAIENLINAKLHDALAKPGGLDRLIDHRVTGVASWEIRNAEKQ
Ga0068853_10230308013300005539Corn RhizosphereMNVTQAEMLRKAIENLIDAKMMDAIARPGGIDRLLAHRRTGVASFDIRNAE
Ga0068870_1090665013300005840Miscanthus RhizosphereMASEQAEALRKAIEGLINAKLRDLVRPGGVDRLIANRMTGVAAYE
Ga0068862_10080247523300005844Switchgrass RhizosphereMNVQVAENLRKAIESLINAKLHDALAKPGGLERLVAHRVTGVASWDVRNAERRLDE
Ga0097621_10128333913300006237Miscanthus RhizosphereMANQAQSLRKAIENLINAKLHDALAKPGGLDRLIAHRVTGV
Ga0066660_1157552023300006800SoilMVAPQAETLRKAIENLINAKLHDALARPGGLGRLVAHRSTGVASFDIRNAERK
Ga0079219_1040352523300006954Agricultural SoilVVGNHAETLRRAIEALINAKLHDALSPGGLDRLAAHRRTGVASYDIRMAE
Ga0079218_1172612113300007004Agricultural SoilMMSDQAQGLRKAIEGLIDAKLHDALARPGGLDRLTAHRVTGVAS
Ga0066710_10424344213300009012Grasslands SoilMNVQTAENLRKAIESLINAKLHDALAKPGGLERLVAHRVTGVASWDVRNAE
Ga0105047_1045675313300009083FreshwaterMASTQAELLRRAIENLVDAKLHDALAKPGGLDRLLSHRRTGVASWDIR
Ga0105092_1097278113300009157Freshwater SedimentVESNQATALREAIENLINAKLQDVLSKPNGLQRLLANRQSGVASPDIRDAEK
Ga0105241_1069956923300009174Corn RhizosphereVLPTQAQSLRKAIENLINAKLHDALAKPGGVDRLIAHRMTGVASWEIRNAEKQLDQALS
Ga0105241_1135286313300009174Corn RhizosphereMVATDQAETLRKAIENLINAKLHDALARPGGLSRLIAHRSTGVA
Ga0105249_1306045613300009553Switchgrass RhizosphereVQKEFAMMNVTQAEMLRKAIENLIDAKMLDAIARPGGIDRLLAHRRTGVATFDI
Ga0127488_105383113300010122Grasslands SoilMVTDQAETLRKAIENLINAKLHDALARPGGLSRLIAHRSTGVASPDIRNAE
Ga0126322_119583313300010143SoilMANQAQSLRKAIENLINAKLHDALAKPGGLDRLIAHRVTGVASWEIRNA
Ga0126377_1291582423300010362Tropical Forest SoilMTENASERLRIAIEELINAKLHDAIGRRDGLARLIAHRTNGVASPQIRD
Ga0136449_10352882823300010379Peatlands SoilMSLQSETLRKAIENLIDAKLVDAMARPDGLNRLLAHRRTNVASPDIRNAERR
Ga0126345_108696723300010858Boreal Forest SoilMVSSQAESLRKAIENLINAKLHDALARPGGLGRLVAHRTTGVASFDIRNAE
Ga0126345_114362413300010858Boreal Forest SoilMIGSQAESLRKAIENLIDAKLLDAMAKPGGLDRLLAHR
Ga0126346_101320713300010865Boreal Forest SoilMVSSQAESLRKAIENLINAKLHDALGRPGGLGRLVAHR
Ga0126344_100937923300010866Boreal Forest SoilVVGNPAETLRRAIESLINAKLHDALSPGGLDRLAAHRRTGVASYDIRMAERRLEE
Ga0138111_115336213300010896Grasslands SoilMVAEQAESLRKAIENLINAKLHDALGKPGGLGRLVAHRVTGVASYDIRNA
Ga0150983_1148260923300011120Forest SoilMVSSQAESLRKAIENLINAKLHDALARPGGLGRLVAHRTTGVASFDIR
Ga0150985_10338994013300012212Avena Fatua RhizosphereMVANQAETLRKAIENLINAKLHDALARPGGLGRLVAHRSTGVASIDIRNA
Ga0150985_10514687113300012212Avena Fatua RhizosphereMVVEQAESLRKAIENLINAKLHDALGKPGGLGRLVAHRVTGVASYDIR
Ga0150985_11184836813300012212Avena Fatua RhizosphereMVASQAETLRKAIENLIDAKLHDAISRPGGLERLTAHRLTGVASFDIRNAERKLQQT
Ga0150985_11699879423300012212Avena Fatua RhizosphereMVASHAEALRKAIENLINAKLHDALARPGGLGRLIAQRTTGVASADIRNAER
Ga0134028_110665213300012224Grasslands SoilMANQAHSLRKAIENLINAKLHDALAKPGGLDRLIAHRVTGVASWEIRNAEKQ
Ga0134038_118340213300012382Grasslands SoilMVATDQAETLRKAIENLINAKLHDALARPGGLGRLIAHRTTGV
Ga0134054_124494913300012390Grasslands SoilVAAAAKQGEVAMLSESSPAESLRKAIENLINVKLHDALAKPGGLDRLIAHRSMGVASFAVRQ
Ga0134054_131340413300012390Grasslands SoilMVATDQAETLRKAIENLINAKLHDALARPGGLSRLIAHRSTGVASPDIRNA
Ga0134051_127048113300012398Grasslands SoilMGIRMVATQAETLRKAIENLIDAKLHDALSRPGGLERLTAHRLTGVASFDIR
Ga0134060_105087813300012410Grasslands SoilMANQAQSLRKAIENLINAKLHDALAKPGGLDRLIAHRVTGVASWEIRNAEKQL
Ga0150984_10302524813300012469Avena Fatua RhizosphereMVSPHAESLRKAIENLINAKLHDALAKPGGLDRLIAHRATGVASFAVRQAERQLDETI
Ga0150984_10551255213300012469Avena Fatua RhizosphereMLTNPTQAESLRKAIEGLIDAKLHDALARPGGLDRLIAHRRTGVASYDIR
Ga0150984_10715374613300012469Avena Fatua RhizosphereMAMVATQAETLRKAIENLIDAKLHDALSRPGGLERLTAHRLTGVASFDIRNAERKL
Ga0150984_10750771813300012469Avena Fatua RhizosphereMMTVTQAEQLRKAIENLVDAKLLDCIAKPGGIDRLLAHRRTGVASFDIRNAERKLQ
Ga0150984_11529979913300012469Avena Fatua RhizosphereMLSASSPGGSNPAESLRKAIENLINVKLYDALAKPGGLDRLVAHRSMGVASFAVRQAERQ
Ga0136615_1033845013300012678Polar Desert SandMVSTQAETLRKAIEGLIDAKLHDALSRPGGLDRLVAHRTTGVASYDI
Ga0136614_1091953413300012684Polar Desert SandMASEQAESLRKAIEGLINAKLRDLVRPGGVDRLVANRMTGVAAYEIRDAAKKLD
Ga0157290_1023124613300012909SoilMASEQAEALRKAIEGLINAKLRDLVRPGGVDRLIANRMTGVAAYEIRDAAK
Ga0164302_1122098913300012961SoilMANQAHSLRKAIENLINAKLHDALAKPGGVDRLIAHRVTGVASWE
Ga0157370_1104628313300013104Corn RhizosphereMVATDQAETLRKAIENLINAKLHDALARPGGLSRLIAHRSTGVASPDIRNAERQLE
Ga0163162_1253742413300013306Switchgrass RhizosphereMESASSPAESLRKAIENLINVKLHDALAKPGGLDRLIAHRSMGVASFAVRQAERQLEE
Ga0157372_1219848413300013307Corn RhizosphereMLVNQAESLRKAIESLIDAKLFDALARPGGLDRLAAYRST
Ga0181534_1085443813300014168BogMVRQAESLRKAIENLIDAKLQDLLSRPGGLDRLLAHRRTGVASFDIRNAERRL
Ga0181516_1061297413300014655BogMMERAETLRKAIENLVDAKLVDALARPDGLSRLLAHRRTGVATPDIRN
Ga0157379_1229607313300014968Switchgrass RhizosphereMESASSPAESLRKAIENLINVKLHDALAKPGGLDRLVAHRSMGVASFAVRQAERQL
Ga0132256_10268675013300015372Arabidopsis RhizosphereMANQAHSLRKAIENLINAKLHDALAKPGGVDRLIAHRVTGVASWEIRN
Ga0183260_1047598213300017787Polar Desert SandMARHAETLRKAIENLIDAKLHDALAKPGGMDRLAAHRQTGVVS
Ga0187879_1048519723300017946PeatlandMHQSEMLRKAIENLIDAKLVDAIARPDGLSRLLAHRRTGVASPDIRNAERR
Ga0187863_1012300223300018034PeatlandMHHSETLRKAIENLVDAKLVDAMARPDGLNRLLAHRRTGVAAPDIRNA
Ga0066662_1083034813300018468Grasslands SoilMVGNHAESLRKAIEGLIDAKLHDAMARPGGLDRLLAHRRTGVASYDIRM
Ga0066662_1088084023300018468Grasslands SoilMVQQALSLRKAIENLINAKLHDALSRPGGLDRLVAHRATGVASWEIR
Ga0190270_1141374023300018469SoilMASEQAESLRKAIENLINVKLRDLVRPGGVDRLVANRMTGVAAYEIRDAGKKLEKVL
Ga0190273_1161689213300018920SoilMADQAESLRKAIENLINAKLHDALAKPGGLGRLVAHRVTGVASYDIRNAERQLDQ
Ga0181504_148756913300019258PeatlandMASVASTSANASGQVESLRKAIENLINAKLHDALARPGGLDRLVAHRTTGVASFDVRNAERQLEK
Ga0181506_137356613300019260PeatlandMVSSQAESLRKAIENLINAKLHDALARPGGLGRLVAHRTTGVASFDIRNAERQLDQ
Ga0181514_122050013300019268PeatlandMMERAETLRKAIENLVDAKLVDALARPDGLSRLLAHRRTGVATPDI
Ga0173481_1069722213300019356SoilMASEQAESLRKAIENLINVKLRDLVRPGGVDRLVANRMTGVA
Ga0206354_1037108513300020081Corn, Switchgrass And Miscanthus RhizosphereVVGNHAETLRRAIESLINAKLHDALTPGGLDRLAAHRRTGVASYDIRMA
Ga0206354_1162501913300020081Corn, Switchgrass And Miscanthus RhizosphereMGIGKMVATQAETLRKAIENLIDAKLHDAISRPGGLERLTAHRLTGVASFDIRNAE
Ga0242641_104244113300022499SoilMIGSQAESLRKAIENLIDAKLHDAMARPGGLDRLLAHRLTDVASYDIRMA
Ga0242647_103472113300022505SoilMVSSQAESLRKAIENLINAKLHDALARPGGLGRLVAHRTTGVASFDIRNAERQ
Ga0242668_114096513300022529SoilVLPTQAQSLRKAIENLINAKLHDALAKPGGVDRLIAHRLTGVASWEIRNAEK
Ga0242670_106851313300022708SoilMVSSQAESLRKAIENLINAKLHDALARPGGLGRLVAHRTTGVA
Ga0242670_107450913300022708SoilMEVSVLPTQAQSLRKAIENLVNAKLHDALAKPGGVDRLIAHRLTGVASWEIRNAEKQL
Ga0242670_108443423300022708SoilMVGNHAETLRRAIESLINAKLHDAITPGGLDRLAAHRRTGVASYDIRMAERRLEQ
Ga0242677_106364513300022713SoilMVSSQAESLRKAIENLINAKLHDALSRPGGLGRLVAHRTTGVASFDI
Ga0242673_110394313300022716SoilMVSSQAESLRKAIENLINAKLHDALARPGGLGRLVAHRTTGVASF
Ga0242657_117656313300022722SoilVVGNQAETLRRAIESLINAKLHDALTPGGIDRLAAHRRTGVASYDI
Ga0207699_1142331713300025906Corn, Switchgrass And Miscanthus RhizosphereVVESPSETLRRAIESLINAKLHDALSPGGLDRLAAHRRTGV
Ga0207700_1062056813300025928Corn, Switchgrass And Miscanthus RhizosphereMLANQAQTLRKAIENLINAKLHDALARPGGLDRLIAHRVSGVASWEIRNAEKQLD
Ga0207639_1161192023300026041Corn RhizosphereMNVTQAEMLRKAIENLIDAKMMDAIARPGGIDRLLAHRRTGVASFDIRNAERKLQET
Ga0209208_1019271213300027807Host-AssociatedMIGSQAESLRKAIENLIDAKLHDAMSRPGGLDRLLAHRRTGVASYDIRQAER
Ga0247823_1112461913300028590SoilMLNVSQAEQLRKAIENLVDAKLLDCIAKPGGIDRLLAHRRTGVASFDIRNAERKLQ
Ga0302279_1036182413300028783BogMTVNQAEALRKAIENLIDAKLHDALSRPGGLDRLLAHRRSGVASFDIRKAEQ
Ga0222748_105493723300029701SoilMVGNHAETLRRAIESLINAKLHDALTPGGIDRLAAHRRTGVAS
Ga0311370_1179018213300030503PalsaMLHSETLRKAIENLIDAKLVDAMARPDGLNRLLAHRRTGVAAPDIRNAERRL
Ga0311355_1093812323300030580PalsaMLQSETLRKAIENLIDAKLVDAMARPDGLNRLLAHRRTGVAAPDIRNAERRL
Ga0265459_1382849123300030741SoilMLAQAEMLRRAIENMIDAKIVDALARPDGLNRLLAHRRTGVAAPDIRNAE
Ga0308203_106902223300030829SoilMVAEQAESLRKAIENLINAKLHDALAKPGGLGRLVAHRVTGVASYDIRNAE
Ga0308200_104980213300030905SoilMVATDQAETLRKAIENLINAKLHDALARPGGLSRLIAHRSTGVASPDIRNAERQLDDA
Ga0308200_114792213300030905SoilMVAEQAESLRKAIENLINAKLHDALAKPGGLGRLVAHRVTGVA
Ga0075376_1128496413300030968SoilVVGNHAETLRRAIETLINAKLHDALSPGGIDRLAAHRRTGVASYDIRMAERRLEQ
Ga0308154_10846423300030986SoilMVASQAETLRKAIENLIDAKLNDALRPGGLDRLRAHRVTGVGSIDIRNAER
Ga0308183_114360523300030988SoilMVPGQAETLRKAIENLINAKLHDALAKPGGLGRLVAHRVTGVASYDIRNAERQLEAAL
Ga0308183_116162513300030988SoilMVAEQAESLRKAIENLINAKLHDALAKPGGLGRLVAHRVTGVASY
Ga0308183_118791613300030988SoilMGIGKMVATQAETLRKAIENLIDAKLHDAISRPGGLERLTAHRLTGVASFDIRNAER
Ga0308190_119245113300030993SoilMGIGMVASQAETLRKAIENLIDAKLHDAIARPGGLERLAAHRLTGVASF
Ga0073997_1219556913300030997SoilMIGSQAESLRKAIENLIDAKLHDAMARPGGLDRLLAHRRTGVASYDRNKNNRK
Ga0170834_10300558513300031057Forest SoilMLQSETLRKAIENLIDAKLVDAMARPDGLNRLLAHRRTGVAAPDIRNAERRLEE
Ga0170834_11155982513300031057Forest SoilVIGNHAETLRRAIESLINAKLHDALTPGGVDRLAAHRRTGVASY
Ga0308189_1031975113300031058SoilMGIGMVASQAETLRKAIENLIDAKLHDAIARPGGLERLTAHRLTGVASFDIRNAERKL
Ga0308189_1036049113300031058SoilMVVSQAETLRKAIENLIDAKLHDAIARPGGLERLTAHRVTGVASFDIRNAERKLQQT
Ga0308189_1038068113300031058SoilMVAEQAESLRKAIENLINAKLHDALAKPGGLGRLVAHRVTGVASYDIRNAERQL
Ga0102748_1180215713300031089SoilMVSSQAETLRKAIENLINAKLHDALARPGGLNRLIAHRTTGVASYDIRNAE
Ga0308204_1036464513300031092SoilMVTNQAESLRKAIENLINAKLHDALARPGGLSRLIAHRTTGVASPDIRNAER
Ga0308197_1041604913300031093SoilMGIGMVASQAETLRKAIENLIDAKLHDAIARPGGLERLTAHRLTGVAS
Ga0308181_115212613300031099SoilMGIGKMVATQAETLRKAIENLIDAKLHDAISRPGGLERLTAHRLTGVASFDIRNAERKLQ
Ga0170824_10476966613300031231Forest SoilVVGNQAETLRRSIESLINAKLHDALTPGGIDRLAAHRRTGVASY
Ga0170824_10987807223300031231Forest SoilMAEQAESLRKAIENLINAKLHDALGKPGGLGRLVAHRVTGVASYD
Ga0170824_11914435013300031231Forest SoilVVGNPAETLRRAIESLINAKLHDALSPGGLDRLAAHRRTGV
Ga0170824_11953970713300031231Forest SoilMPTQAQSLRKAIENLINAKLHDALAKPGGVDRLIAHRMTGVASWEIRNAEKQLDAALS
Ga0302325_1250986423300031234PalsaMVSSQAESLRKAIENLINAKLHEALARPGGLGRLV
Ga0170818_10282650513300031474Forest SoilVVGNPAETLRRAIESLINAKLHDALSPGGLDRLAAH
Ga0170818_10971585113300031474Forest SoilMNVSQAELLRKAIENLIDAKMMDAIARPGGIDRLLAHRRTGVATF
Ga0314817_12211423300031495SoilMVASQAETLRKAIENLIDAKLHDALSRPGGLERLTAHRLTGVASFDI
Ga0316049_12370223300031866SoilMAIQAETLRKVIENLVDAKLVDAMARPDGLNRLLAHRRTGVASPDIRNAERK
Ga0308173_1230370913300032074SoilMQVQAQTLRKAIENLINAKLHDALARPGGLDRLIAHRATGVASWEIRNAE
Ga0348332_1145900313300032515Plant LitterMLAQAEMLRKAIENMIDAKVVDALARPDGLNRLLAHRRTGVAAPDIRNAERRLEEVL
Ga0348332_1426096113300032515Plant LitterMVGNHAETLRRAIESLINAKLHDAIMPGGLDRLAAHRRTGVASYDIRMAERRLEQA
Ga0334937_085888_695_8683300034221BiocrustMVANQAETLRKAIENLINAKLHDALARPGGLGRLIAHRTTGVASADIRNAERQLDEAL
Ga0370548_050501_598_7413300034644SoilMTAEQCETLRKAIEGLIDAKLHDALSRPGGLERLTAHRLTGVASFDIR
Ga0314782_143174_3_1643300034661SoilMFAESLRKAIENLIDAKLNDALRPGGIDRLRAHRVTGVASIDIRNAERRLDEAL
Ga0314784_118105_2_1483300034663SoilMVAEQAESLRKAIENLINAKLHDALAKPGGLGRLVAHRVTGVASYDIRN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.