NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F067798

Metagenome / Metatranscriptome Family F067798

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F067798
Family Type Metagenome / Metatranscriptome
Number of Sequences 125
Average Sequence Length 71 residues
Representative Sequence ITTDQLQNLIDDWSASKPIDAFYKRVFGMTYAEKKAQEEMEYFIYENGEKKEVRKSKEKTQSIH
Number of Associated Samples 110
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.00 %
% of genes from short scaffolds (< 2000 bps) 92.80 %
Associated GOLD sequencing projects 104
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (83.200 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(18.400 % of family members)
Environment Ontology (ENVO) Unclassified
(74.400 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(92.800 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.78%    β-sheet: 13.04%    Coil/Unstructured: 52.17%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF05017TMP 5.60
PF00462Glutaredoxin 2.40
PF11753DUF3310 0.80
PF00581Rhodanese 0.80
PF01832Glucosaminidase 0.80



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.80 %
UnclassifiedrootN/A7.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000117|DelMOWin2010_c10068436Not Available1445Open in IMG/M
3300000117|DelMOWin2010_c10092261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941138Open in IMG/M
3300000117|DelMOWin2010_c10131123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194858Open in IMG/M
3300001450|JGI24006J15134_10092753All Organisms → Viruses → Predicted Viral1101Open in IMG/M
3300004097|Ga0055584_100449101Not Available1338Open in IMG/M
3300004448|Ga0065861_1052598All Organisms → Viruses → Predicted Viral4195Open in IMG/M
3300004831|Ga0069134_166468All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194674Open in IMG/M
3300005057|Ga0068511_1020429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194960Open in IMG/M
3300005057|Ga0068511_1081444All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194563Open in IMG/M
3300005057|Ga0068511_1085219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194552Open in IMG/M
3300006027|Ga0075462_10212477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194580Open in IMG/M
3300006357|Ga0075502_1702966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194944Open in IMG/M
3300006400|Ga0075503_1187972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941323Open in IMG/M
3300006400|Ga0075503_1192691Not Available1468Open in IMG/M
3300006402|Ga0075511_1074530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194981Open in IMG/M
3300006403|Ga0075514_1182951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941051Open in IMG/M
3300006404|Ga0075515_10045136All Organisms → Viruses → Predicted Viral1311Open in IMG/M
3300006735|Ga0098038_1023909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1942311Open in IMG/M
3300006810|Ga0070754_10422928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194581Open in IMG/M
3300006916|Ga0070750_10308318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194675Open in IMG/M
3300006919|Ga0070746_10349012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194671Open in IMG/M
3300006921|Ga0098060_1144420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194661Open in IMG/M
3300007236|Ga0075463_10183257All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194675Open in IMG/M
3300007276|Ga0070747_1016992All Organisms → Viruses → Predicted Viral3002Open in IMG/M
3300007345|Ga0070752_1373764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194531Open in IMG/M
3300007640|Ga0070751_1349279All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194542Open in IMG/M
3300007778|Ga0102954_1078537All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194919Open in IMG/M
3300008012|Ga0075480_10248789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194920Open in IMG/M
3300009001|Ga0102963_1254203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194695Open in IMG/M
3300009076|Ga0115550_1242233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194593Open in IMG/M
3300009434|Ga0115562_1261696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194600Open in IMG/M
3300009449|Ga0115558_1402325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194534Open in IMG/M
3300009467|Ga0115565_10519190All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194534Open in IMG/M
3300009472|Ga0115554_1115562All Organisms → Viruses → Predicted Viral1131Open in IMG/M
3300009472|Ga0115554_1169487All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194896Open in IMG/M
3300009703|Ga0114933_10588836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194718Open in IMG/M
3300009705|Ga0115000_10415684All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium855Open in IMG/M
3300009785|Ga0115001_10933057All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium521Open in IMG/M
3300010149|Ga0098049_1197843All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194616Open in IMG/M
3300010368|Ga0129324_10323543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194603Open in IMG/M
3300011013|Ga0114934_10436583All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194581Open in IMG/M
3300012928|Ga0163110_10625569All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194833Open in IMG/M
3300012928|Ga0163110_11795460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194500Open in IMG/M
3300012936|Ga0163109_10505155All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194885Open in IMG/M
3300016754|Ga0182072_1264848All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941037Open in IMG/M
3300017706|Ga0181377_1051488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194787Open in IMG/M
3300017708|Ga0181369_1099065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194607Open in IMG/M
3300017710|Ga0181403_1035261All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941053Open in IMG/M
3300017713|Ga0181391_1129934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194562Open in IMG/M
3300017717|Ga0181404_1126897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194621Open in IMG/M
3300017719|Ga0181390_1067775All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941010Open in IMG/M
3300017732|Ga0181415_1048869All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194963Open in IMG/M
3300017735|Ga0181431_1078108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194743Open in IMG/M
3300017738|Ga0181428_1088795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194721Open in IMG/M
3300017741|Ga0181421_1028642Not Available1508Open in IMG/M
3300017741|Ga0181421_1178204All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194546Open in IMG/M
3300017755|Ga0181411_1218479All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194531Open in IMG/M
3300017759|Ga0181414_1023092All Organisms → Viruses → Predicted Viral1695Open in IMG/M
3300017763|Ga0181410_1058471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941169Open in IMG/M
3300017767|Ga0181406_1023782All Organisms → cellular organisms → Bacteria1930Open in IMG/M
3300017776|Ga0181394_1145716Not Available738Open in IMG/M
3300017824|Ga0181552_10320971All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194758Open in IMG/M
3300017969|Ga0181585_11058953All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194515Open in IMG/M
3300018420|Ga0181563_10598089All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194613Open in IMG/M
3300018424|Ga0181591_10747448All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194684Open in IMG/M
3300018428|Ga0181568_10565280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194900Open in IMG/M
3300019282|Ga0182075_1592959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194782Open in IMG/M
3300019708|Ga0194016_1021810All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194716Open in IMG/M
3300020055|Ga0181575_10409665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194745Open in IMG/M
3300020246|Ga0211707_1057826All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194514Open in IMG/M
3300020274|Ga0211658_1068653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194719Open in IMG/M
3300020297|Ga0211490_1053265Not Available706Open in IMG/M
3300020336|Ga0211510_1101441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194662Open in IMG/M
3300020403|Ga0211532_10350709Not Available561Open in IMG/M
3300020405|Ga0211496_10398068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194513Open in IMG/M
3300020422|Ga0211702_10053247All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941105Open in IMG/M
3300020437|Ga0211539_10096111Not Available1188Open in IMG/M
3300020440|Ga0211518_10535126All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194524Open in IMG/M
3300020442|Ga0211559_10401541All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194633Open in IMG/M
3300020450|Ga0211641_10236104All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194903Open in IMG/M
3300020454|Ga0211548_10646433All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194515Open in IMG/M
3300020470|Ga0211543_10213258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194953Open in IMG/M
3300020470|Ga0211543_10578134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194529Open in IMG/M
3300020474|Ga0211547_10315642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194792Open in IMG/M
3300020584|Ga0211540_1040644All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194638Open in IMG/M
3300021347|Ga0213862_10296858All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194572Open in IMG/M
3300021347|Ga0213862_10297853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194571Open in IMG/M
3300021356|Ga0213858_10355547All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194692Open in IMG/M
3300021356|Ga0213858_10543653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194533Open in IMG/M
3300021364|Ga0213859_10165836All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941034Open in IMG/M
3300021368|Ga0213860_10167101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194970Open in IMG/M
3300021442|Ga0206685_10242495All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium609Open in IMG/M
3300021958|Ga0222718_10577824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194530Open in IMG/M
3300022909|Ga0255755_1147784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194956Open in IMG/M
3300022925|Ga0255773_10072343All Organisms → Viruses → Predicted Viral1931Open in IMG/M
3300022937|Ga0255770_10207269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194978Open in IMG/M
3300023170|Ga0255761_10538785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194542Open in IMG/M
3300023176|Ga0255772_10432600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194653Open in IMG/M
3300025098|Ga0208434_1091576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194606Open in IMG/M
3300025120|Ga0209535_1029485All Organisms → Viruses → Predicted Viral2614Open in IMG/M
3300025127|Ga0209348_1180026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194603Open in IMG/M
3300025138|Ga0209634_1215255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194722Open in IMG/M
3300025577|Ga0209304_1070798All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194855Open in IMG/M
3300025666|Ga0209601_1183355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194566Open in IMG/M
3300025687|Ga0208019_1021610All Organisms → Viruses → Predicted Viral2511Open in IMG/M
3300025769|Ga0208767_1013382All Organisms → Viruses → Predicted Viral4891Open in IMG/M
3300025769|Ga0208767_1183365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194722Open in IMG/M
3300025769|Ga0208767_1229538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194598Open in IMG/M
3300025803|Ga0208425_1006335All Organisms → Viruses → Predicted Viral3411Open in IMG/M
3300025822|Ga0209714_1001918Not Available10891Open in IMG/M
3300025840|Ga0208917_1126726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194908Open in IMG/M
3300025876|Ga0209223_10223900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194902Open in IMG/M
3300025886|Ga0209632_10242193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194927Open in IMG/M
3300025889|Ga0208644_1184839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194920Open in IMG/M
3300025889|Ga0208644_1211151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194834Open in IMG/M
3300026270|Ga0207993_1197946All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194507Open in IMG/M
3300027298|Ga0208970_1009047All Organisms → Viruses → Predicted Viral2072Open in IMG/M
3300029319|Ga0183748_1112796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194602Open in IMG/M
3300029448|Ga0183755_1106538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194538Open in IMG/M
3300029787|Ga0183757_1036286All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194975Open in IMG/M
3300029787|Ga0183757_1070156All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194522Open in IMG/M
3300031167|Ga0308023_1093394All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → unclassified Verrucomicrobiales → Verrucomicrobiales bacterium554Open in IMG/M
3300031785|Ga0310343_11536368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194503Open in IMG/M
3300032073|Ga0315315_10409137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED1941261Open in IMG/M
3300032373|Ga0316204_10811853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium TMED194671Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous18.40%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine16.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater11.20%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine10.40%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh10.40%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine7.20%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater4.80%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water2.40%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater2.40%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.40%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.40%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.60%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface1.60%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment0.80%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.80%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.80%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.80%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.80%
Surface SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Surface Seawater0.80%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.80%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.80%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.80%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water0.80%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.80%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004831Marine surface microbial communities from the North Atlantic Ocean - filtered matterEnvironmentalOpen in IMG/M
3300005057Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2umEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006402Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006403Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006404Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007640Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28EnvironmentalOpen in IMG/M
3300007778Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MGEnvironmentalOpen in IMG/M
3300008012Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009449Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426EnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009472Pelagic marine microbial communities from North Sea - COGITO_mtgs_110404EnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300016754Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071405BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017969Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019708Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MGEnvironmentalOpen in IMG/M
3300020055Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020246Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105)EnvironmentalOpen in IMG/M
3300020274Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943)EnvironmentalOpen in IMG/M
3300020297Marine microbial communities from Tara Oceans - TARA_B000000437 (ERX555970-ERR598979)EnvironmentalOpen in IMG/M
3300020336Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289008-ERR315860)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020405Marine microbial communities from Tara Oceans - TARA_B000000532 (ERX556129-ERR599012)EnvironmentalOpen in IMG/M
3300020422Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126)EnvironmentalOpen in IMG/M
3300020437Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)EnvironmentalOpen in IMG/M
3300020440Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020450Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077)EnvironmentalOpen in IMG/M
3300020454Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300020474Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976)EnvironmentalOpen in IMG/M
3300020584Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555983-ERR599011)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021442Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022909Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaGEnvironmentalOpen in IMG/M
3300022925Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaGEnvironmentalOpen in IMG/M
3300022937Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaGEnvironmentalOpen in IMG/M
3300023170Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaGEnvironmentalOpen in IMG/M
3300023176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaGEnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025577Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 (SPAdes)EnvironmentalOpen in IMG/M
3300025666Pelagic marine microbial communities from North Sea - COGITO_mtgs_110426 (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025822Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025876Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes)EnvironmentalOpen in IMG/M
3300025886Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026270Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 (SPAdes)EnvironmentalOpen in IMG/M
3300027298Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C49A8_35 (SPAdes)EnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300029787Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172EnvironmentalOpen in IMG/M
3300031167Marine microbial communities from water near the shore, Antarctic Ocean - #418EnvironmentalOpen in IMG/M
3300031785Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MGEnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M
3300032373Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOWin2010_1006843613300000117MarineLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGEKREVRKPKKETQSVH
DelMOWin2010_1009226113300000117MarineAYLTALKEDMIKAPRNFSNLSMTTDQLQNLIDDWSAPKPIDAFYKRVFNMTYAEKKQQEELEYFIYENGEKREVRKSKKETQSIH*
DelMOWin2010_1013112313300000117MarineDMIKVPKNFSNLSINEVQLQNLIDDWSAPNPRDATYMRVFKMTYAEKKQQEELEFFIYENGEKKEVRKSKKDTQSIH*
JGI24006J15134_1009275313300001450MarineDQLQNLIDDWSAPNPRDATYMRVFKMTYAEKKQQEELEFFIYENGEKKEVRKSKKDTQSIH*
Ga0055584_10044910153300004097Pelagic MarineVAYLSALKEDMIKAPKNFSNLSMTTDQLQNLIDDWSAPKPIDAFYKRVFNMTYAEKKQQEELEYFIYENGEKKEVRKPKQETQPIH*
Ga0065861_105259873300004448MarineLIDDWSAPNPRDAMYMRVFGMTFAEKKAQEELEFFIYENGEKKEVRKTKQVS*
Ga0069134_16646833300004831Surface SeawaterPKNFSNLNLTTDNLQNLIDDWSAPKPLDAFYKRIFGMTYAEKKAQEELEYVIYENGEKKEVRKSKKETQSVH*
Ga0068511_102042913300005057Marine WaterNFSNISISSQQLQNLIDDWSASKPIDAFYKRVFNMTYAEKKAQEEMEYFIYENGEKREVRKSKQETQSIH*
Ga0068511_108144423300005057Marine WaterKKSYKHRIEYLKALKEDMIKSPKYFRDISMTPDQLQNIIDDWSAPKPIDAFYKRVFGMTYAEKKAQEDAEYFYYDENGKKREVRKSKEETQSVH*
Ga0068511_108521923300005057Marine WaterKHKIAYLTALKEDMIKSPKYFRDISMTPDQVQNLIDDWSAPKPIDAFYKRVFNMTYAEKKAQEDAEYFYYDENGKKKEVRKSKEETQSVH*
Ga0075462_1021247713300006027AqueousNFSNLSINEVQLQNLIDDWSAPNPRDATYMRVFKMTYAEKKQQEELEFFIYENGEKKEVRKSKKDTQSIH*
Ga0075502_170296653300006357AqueousDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGKKREVRKSKEATL*
Ga0075503_118797213300006400AqueousSLTTDHLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGKKREVRKSKEATL*
Ga0075503_119269113300006400AqueousSLTTDHLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGEKREVRKPKKETQSVH*
Ga0075511_107453053300006402AqueousTDHLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGEKREVRKPKKETQSVH*
Ga0075514_118295113300006403AqueousSLTTDHLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGKKKRS*
Ga0075515_1004513613300006404AqueousLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGKKKRS*
Ga0098038_102390913300006735MarineKEDMITSPKYFIDVKITTDQLQNLIDDWSAPKPIDAFYKRIFGMTFAEKKAQEEAEHFTYENGEKKEVRKSKEKTQSVH*
Ga0070754_1042292813300006810AqueousRIEYLKALKEDMIEAPKNFSNLSLTTDNLQNLIDDWSAPKPIDAFYKRVFNMTYAEKKSQEEAEYFTYDENGKKREVRKSKEATL*
Ga0070750_1030831833300006916AqueousKEDMIKVPKNFSNLSINEVQLQNLIDDWSAPNPRDATYMRVFKMTYAEKKQQEELEFFIYENGEKKEVRKSKKDTQSIH*
Ga0070746_1034901213300006919AqueousALKEDMIKVPKNFSNLSINEVQLQNLIDDWSAPNPRDATYMRVFKMTYAEKKQQEELEFFIYENGEKKEVRKSKKDTQSIH*
Ga0098060_114442013300006921MarineSITTDQLQNLIDDWSAPKPIDAFYKRVFNMTYAEKKQQEELEYFIYENGEKKEVRRTKEKSQ*
Ga0075463_1018325733300007236AqueousEVQLQNLIDDWSAPNPRDATYMRVFGMTYAEKKQQEELEFFIYENGEKKEVRKSKQETQSVH*
Ga0070747_1016992103300007276AqueousLIDDWSAPNPRDATYMRVFGMTYAEKKQQEELEYFVYENGEKKEVRKSKQDA*
Ga0070752_137376413300007345AqueousTDHLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGKKREVRKSKEATL
Ga0070751_134927913300007640AqueousTHRVAYLSALKEDIIKAPKNFSNLSINEVQLQNLIDDWSAPKPIDAFYKRVFNMTYAEKKSQEEAEYFTYDENGKKREVRKSKEATL*
Ga0102954_107853723300007778WaterMIKAPKNFSNLSMNTDQLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGKKREVRKSKEATL*
Ga0075480_1024878953300008012AqueousQNLIDDWSAPNPRDATYMRVFGMTYAEKKQQEELEFFIYENGEKKEVRKSKQETQSVH*
Ga0102963_125420333300009001Pond WaterEAPKNFSNLSLTTDHLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGEKREVRKPKKETQSVH*
Ga0115550_124223333300009076Pelagic MarineLIDDWSAPKPLDAFYKRIFGMTYAEKKAQEELEYVIYENGEKKEVRKSKKETQSVH*
Ga0115562_126169613300009434Pelagic MarineNLIDDWSAPNPRDATYMRVFGMTYAEKKQQEELEFFIYENGEKKEVRKSKQDA*
Ga0115558_140232523300009449Pelagic MarineEYLKALKEYMIKAPKNFSNLNLTTDNLQNLIDDWSAPKPLDAFYKRLFGMTYAEKKAQEELEYVIYENGEKKEVRKSKEKTQSVH*
Ga0115565_1051919013300009467Pelagic MarineLSINEVQLQNLIDDWSAPNPRDATYMRVFKMTYAEKKQQEELEFFIYENGEKKEVRKSKQETQSVH*
Ga0115554_111556263300009472Pelagic MarinePKNFSNLSINEVQLQNLIDDWSAPNPRDATYMRVFKMTYAEKKQQEELEFFIYENGEKKEVRKSKKDTQSIH*
Ga0115554_116948743300009472Pelagic MarineNFSNLNLTTDNLQNLIDDWSAPKPLDAFYKRIFGMTYAEKKAQEELEYVIYENGEKKEVRKSKKETQSVH*
Ga0114933_1058883613300009703Deep SubsurfaceFDNLISDWSSPKPVDAFYKRIFGMTYAEKKQQEELEYFIYENGEKKEVRKSKEETQSIH*
Ga0115000_1041568443300009705MarineVPKNFNNLSIKPDQLQNLIDDWSAPNPRDATYMRVFGMTYAEKKAQEELEFFIYENGEKKEVRKTKQDA*
Ga0115001_1093305713300009785MarineNFNNLSIKPDQLQNLIDDWSAPNPRDATYMRVFGMTYAEKKAQEELEFFIYENGEKKEVRKTKQVS*
Ga0098049_119784313300010149MarineFANISITPQQLQNTIDCWSAPKPIDAFYKSVFGMTYAEKKQQEELEYFVYENGEKKEVRRTKQTTQ*
Ga0129324_1032354313300010368Freshwater To Marine Saline GradientSALKEDMIKVPKNFSNLSINEVQLQNLIDDWSAPNPRDATYMRVFKMTYAEKKQQEELEFFIYENGEKKEVRKSKKDTQSIH*
Ga0114934_1043658313300011013Deep SubsurfaceITTDQLQNLIDDWSASKPIDAFYKRVFGMTYAEKKAQEEMEYFIYENGEKKEVRKSKEKTQSIH*
Ga0163110_1062556943300012928Surface SeawaterLKSPKYFRDISMTTDQLQNIIDDWSAPKPIDAFYKRVFGMTYAEKKAQEDAEYFYYDENGKKKEVRKSKEETQSIH*
Ga0163110_1179546013300012928Surface SeawaterTIDCWSAPKPIDAFYKKVFGMTFAEKKAQEEAEYFTYENGEKKEVRKSKEKTQSVH*
Ga0163109_1050515513300012936Surface SeawaterNIIDDWSAPKPIDAFYTRVFGMTYAEKKAQEEAEYFTYENGEKKEVRKSKEETLSIH*
Ga0182072_126484853300016754Salt MarshIKVPKHFSNLNLTTDQLQNLIDDWSAPKPIDAFYKRIFGVTYAEKKAQEELEYFTYDENGKKREVRKSKEATL
Ga0181377_105148843300017706MarineRNFSNISITPEQLQNTIDCYLAPNPRDAFYMKVFNMTYAEKKQQEELEFFIYENGEKKEVRKSKQDS
Ga0181369_109906513300017708MarineKITYLTALKEDMIKSPKYFRDVKITTDQLQNLIDDWSAPKPIDAFYKRVFNMTYAEKKAQEEAEYFTYENGEKREVRKSKEKTQSVH
Ga0181403_103526113300017710SeawaterQNLIDDWSAPNPRDATYMRVFGMTYAEKKQQEELEYFVYENGEKKEVRKSKKETQSIH
Ga0181391_112993433300017713SeawaterLIDDWSAPNPRDATYMRVFGMTYAEKKQQEELEYFVYENGEKKEVRKSKKETQSIH
Ga0181404_112689713300017717SeawaterEVFTNRIAYLKALKEDMIQVPKNFNNINISPDQLQNLIDDWSAPKPIDAFYKRVFNMTYAEKKQQEELEFFIYENGEKREVRKTKETTQ
Ga0181390_106777513300017719SeawaterNTIDCWSAPNPRDAFYMKVFNMTYAEKKQQEELEYFIYENGEKKEVRKSKQDA
Ga0181415_104886953300017732SeawaterEDMIAMPKNFNNISMSPDQLQNLIDCWSAPKPIDAFYMKVFNMTYAEKKQQEELEFFVYENGEKREVRKTKETTQ
Ga0181431_107810843300017735SeawaterSLQNTIDCYSAPNPRDAFYMKVFNMTYAEKKQQEELEFFIYENGEKKEVRKSKQDS
Ga0181428_108879513300017738SeawaterKNFANISITPDQMQNLIDDYSAPNPRDATYMRVFNMTYAEKKAQEELEYFVYENGEKREVRKTKETTQ
Ga0181421_102864263300017741SeawaterQNTIDCWSAPNPRDAFYMKVFNMTYAEKKQQEELEYFIYENGEKKEVRKSKQETQSIH
Ga0181421_117820413300017741SeawaterNTIDCYLAPNPRDAFYMKVFNMTYAEKQQQEELEFFIYENGEKKEVRKSKQDA
Ga0181411_121847913300017755SeawaterKEDMIQVPKNFNNINISPDQLQNLIDDYSAPNPRDATYMRVFNMTYAEKKAQEELEYFVYENGEKREVRKTKETTQ
Ga0181414_102309213300017759SeawaterLIDDWSAPNPRDATYMRVFGMTYAEKKQQEELEYFIYENGEKKEVRKSKQETQSIH
Ga0181410_105847153300017763SeawaterQNTIDCWSASNPRDAFYMKVFNMTYAEKKAQEELEHFTYENGEKKEVRKSKEKTQSVH
Ga0181406_102378283300017767SeawaterMIKVPRNLSNISMKPEQLHNLIDDWSVPKPRDATYMRVFGMTYAEKKQQEELEYFVYENGEKKEVRKSKKETQSIH
Ga0181394_114571643300017776SeawaterCWSAPNPRDAFYMKVFNMTYAEKKQQEELEYFIYENGEKKEVRKSKQETQSIH
Ga0181552_1032097113300017824Salt MarshNPKNFDISVTQQQLQNLIDDWSSPKPIDAFYKRVFNMTYAEKKQQEEMEYFTYENGEKKEVRKSKEKTQSIH
Ga0181585_1105895323300017969Salt MarshEAPKNFSNLSLTTDHLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGKKREVRKSKEATL
Ga0181563_1059808913300018420Salt MarshEVFTQRIKYLKQLKEDMIKSPKYFRDVKITTDQLQNLIDDWSAPKPIDAFYKRVFGMSYAEKKAQEEAEYFTYENGEKKEVRKSKEKTQSIH
Ga0181591_1074744833300018424Salt MarshLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGKKREVRKSKEATL
Ga0181568_1056528013300018428Salt MarshKNFDFNVTPDQLQNTINCYLAPNPRDAFYKSVFGMTYAEKKQQEEMEYFIYENGEKKEVRKSKEKTLSVH
Ga0182075_159295913300019282Salt MarshLTTDHLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGKKREVRKSKEATL
Ga0194016_102181013300019708SedimentRIEYLKALKEDMIEAPKNFSNLSLTTDHLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGKKREVRKSKETTL
Ga0181575_1040966513300020055Salt MarshLTALKEDMIKAPKNFSNLSLTTDHLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGEKREVRKPKKETQSVH
Ga0211707_105782623300020246MarineHKIAYLTALKEDMIKSPKYFRDISMTTDQLQNIIDDWSAPKPIDAFYKRVFNMTYAEKKAQEEAEYFTYENGEKKEVRKSKEKTQSVH
Ga0211658_106865333300020274MarineKNFANISMTPDQLQNTIDCWSAPKPIDAFYKKVFGMTFAEKKAQEEAEYFTYENGEKKEVRRTKETTQ
Ga0211490_105326523300020297MarineMIKVPKNFSIKITPDQIQNLIDDWSASKPIDAFYKRIFGMTYAEKKSQEDAEYFTYENGEKKEVRKSKEETQSIH
Ga0211510_110144113300020336MarineLQNLIDDWSAPKPIDAFYKRIFGMTFAEKKQQEELEYFIYENGEKKEVRKSKQETQSIH
Ga0211532_1035070913300020403MarineQLQNTINCYLAPNPRDAFYKSVFGMTFAEKKQQEEMEYFIYEDGEKREVRKSKKETQSIH
Ga0211496_1039806823300020405MarineSPKYFRDISMTTDQLQNIIDDWSAPKPIDAFYKRVFNMTYAEKKAQEDAEYFYYDENGKKREVRKSKEETQSVH
Ga0211702_1005324753300020422MarineKSYKHRIEYLKALKEDMIKSPKYFRDISMTTDQLQNIIDDWSAPKPLDAFYKRVFGLTYAEKKAQEEAEYFTYENGEKKEVRKSKEKTQSVH
Ga0211539_1009611113300020437MarineLKTLKDDVQKNPKNFDISITQQQFQNLIDDWSATKPIDAFYKRIFGMTFAEKKSQEDAEYFTFENGEKREVRKSKDEKVEAIV
Ga0211518_1053512623300020440MarineKSNKHKITYLTALKEDMIKSPKYFRDVKITTDQLQNLIDDWSAPKPIDAFYTRIFGMTYAEKKAQEEAEYFTYENGEKKEIRKPKEKTQSVH
Ga0211559_1040154113300020442MarineIAYLTALKEDMIKSPKYFRDISMTPDQVQNLIDDWSAPKPIDAFYKRVFNMTYAEKKAQEDAEYFYYDENGKKKEVRKSKEETQSVH
Ga0211641_1023610413300020450MarineGKKSYKFRVEYLKTLKEDMIKSPKYFRDVKMSTDQLQNLIDDWSAPKPIDAFYKRVFNMTYAEKKAQEEAEYFTYENGEKKEVRKSKEKTQSVH
Ga0211548_1064643313300020454MarineYLQALKEDMTKMPKNFANIAISPDQLQNLIDDWSAPKPIDAFYKRIFGMTYAEKKAQEEAEYFTYENGEKKEVRKVKETTQ
Ga0211543_1021325813300020470MarineFRDVKMTTDQLQNLIDDWSAPKPIDAFYKRVFGLTYAEKKAQEDAEYFYYDENGKKKEVRKSKEETLSIH
Ga0211543_1057813413300020470MarineIEFLKTLKDDIQKNPKNFDVSISQQQLQNLIDDWSSPKPIDAFYKRVFNMTYAEKKSQEDAEYFTYENGEKKEVRKNTEETQSIH
Ga0211547_1031564233300020474MarineNKHKITYLTALKEDMIKSPKYFRDVKMTTDQLQNLIDDWSAPKPIDAFYKRVFNMTFAEKKAQEEAEYFTYENGEKKEVRKPKEKTQSVH
Ga0211540_104064433300020584MarineKIAYLTALKEDMIKSPKYFRDISMTPDQVQNLIDDWSAPKPIDAFYKRVFNMTYAEKKAQEDAEYFYYDENGKKKEVRKSKEETQSVH
Ga0213862_1029685833300021347SeawaterNFDISTTQQQFQNLIDDWSSPKPIDAFYKRVFNMTFAEKKQQEELEYFIYENGEKKEIRKSNKETQSIH
Ga0213862_1029785333300021347SeawaterKEDMIKAPKNFSNLSLTTDHLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGEKREVRKPKKETQSVH
Ga0213858_1035554733300021356SeawaterQLKEDMLKTPKYFRDVAITTDQVQNLIDDWSAPKPVDAFYKRVFGMTYAEKKAQEEMEYFTYENGEKREVRNTKEATQ
Ga0213858_1054365313300021356SeawaterQKNPKNFDISPTQQQLQNLIDDWSSPKPIDAFYKRVFNMTFAEKKQQEELEYFIYENGEKKEIRKSDKETQSIH
Ga0213859_1016583653300021364SeawaterNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGEKREVRKPKKETQSVH
Ga0213860_1016710113300021368SeawaterKDDIQKNPKNFDISPTQQQLQNLIDDWSSPKPIDAFYKRVFNMTFAEKKQQEELEYFIYENGEKKEIRKSDKETQSIH
Ga0206685_1024249513300021442SeawaterKETMIKSPRTFSTLSINTTQIQNLIDDWSSPKPIDAFYKRVFNMTYAEKKHQEDTEYFTYEDGKKKEVRKPKEETQKIH
Ga0222718_1057782423300021958Estuarine WaterHRIEYLKALKEDMIEAPKNFSNLSLTTDHLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEELEYFTYDENGKKREVRKSKEATL
Ga0255755_114778413300022909Salt MarshLQNTINCYLAPNPRDAFYKSVFGMTYAEKKAQEEMEYFIYENGEKKEVRKSKETTQSIH
Ga0255773_1007234373300022925Salt MarshFRDVAITTDQVQNLIDDWSAPKPVDAFYKRVFGMTYAEKKAQEEMEYFTYENGEKREVRNTKEATQ
Ga0255770_1020726913300022937Salt MarshSLTTDQLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGKKREVRKSKEATL
Ga0255761_1053878523300023170Salt MarshTLKEDMIKVPKHFSNLNLTTDQLQNLIDDWSAPKPIDAFYKRIFGVTYAEKKAQEEAEYITYDENGEKREVRKTKEETL
Ga0255772_1043260013300023176Salt MarshTALKEDMIKAPKNFSNLSMTTDQLQNLIDDWSAPKPIDAFYKRVFNMTYAEKKQQEELEYFTYENGEKREVRKSKKETQSIH
Ga0208434_109157633300025098MarineQLQKTIDCWSAPNPRDAFYKSVFGMTYAEKKQQEELEYFIYENGEKKEVRKSKQDS
Ga0209535_1029485103300025120MarineTTLKEDMIKVPKNFVNISISPDQMQNLIDDYSAPNPRDATYMRVFNMTYAEKKAQEEAEYFIYENGEKREVRKTKETTQ
Ga0209348_118002633300025127MarineDMIKVPKNFSNFNVTPDQLQNTIDCWSAPKPIDAFYKSVFGMTYAEKKQQEELEYFIYENGEKKEVRKSKEETQSIH
Ga0209634_121525513300025138MarineKNFVNISISPDQMQNLIDDYSAPNPRDATYMRVFNMTYAEKKAQEEAEYFIYENGEKREVRKTKETTQ
Ga0209304_107079833300025577Pelagic MarineMIKAPKNFSNLNLTTDNLQNLIDDWSAPKPLDAFYKRIFGMTYAEKKAQEELEYVIYENGEKKEVRKSKKETQSVH
Ga0209601_118335533300025666Pelagic MarineNFSNLSINEVQLQNLIDDWSAPNPRDATYMRVFKMTYAEKKQQEELEFFIYENGEKKEVRKSKKDTQSIH
Ga0208019_102161093300025687AqueousTDQLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGKKREVRKSKEATL
Ga0208767_101338213300025769AqueousLSLTTDHLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGEKREVRKPKKETQSVH
Ga0208767_118336513300025769AqueousAYLTALKEDMIKAPRNFSNLSMTTDQLQNLIDDWSAPKPIDAFYKRVFNMTYAEKKQQEELEYFIYENGEKREVRKSKKETQSIH
Ga0208767_122953813300025769AqueousDDWSAPNPRDATYMRVFKMTYAEKKQQEELEFFIYENGEKKEVRKSKKDTQSIH
Ga0208425_1006335113300025803AqueousKVPKNFSNLSINEVQLQNLIDDWSAPNPRDATYMRVFKMTYAEKKQQEELEFFIYENGEKKEVRKSKKDTQSIH
Ga0209714_100191813300025822Pelagic MarineDMIKVPKNFSNLSINEVQLQNLIDDWSAPNPRDATYMRVFKMTYAEKKQQEELEFFIYENGEKKEVRKSKQETQSVH
Ga0208917_112672613300025840AqueousNEVQLQNLIDDWSAPNPRDATYMRVFGMTYAEKKQQEELEFFIYENGEKKEVRKSKQETQSVH
Ga0209223_1022390013300025876Pelagic MarineQLQNTIDCYLAPNPRDAFYMKVFNMTYAEKKQQEELEFFIYENGEKKEVRKSKQDS
Ga0209632_1024219353300025886Pelagic MarineISITPEQLQNTIDCYLAPNPRDAFYMKVFNMTYAEKKQQEELEFFIYENGEKKEVRKSKQDS
Ga0208644_118483913300025889AqueousTANKQSYKNRIAYLTALKEDMIKAPKNFSNLSMTTDQLQNLIDDWSAPKPIDAFYKRVFNMTYAEKKAQEELEYFTYENGEKREVRKSKKETQSIH
Ga0208644_121115113300025889AqueousLSLTTDHLQNLIDDWSAPKPIDAFYKRIFNMTYAEKKAQEEAEYFTYDENGKKREVRKSKEATL
Ga0207993_119794623300026270MarineQSLKEDFDKSPKHFSNLNITSQQLQNLIDDWSAPKPIDAFYKRVFGMTYAEKKAQEEAEYFTYENGEKKEVRKSKQETQSIH
Ga0208970_100904713300027298MarineFSNISITPEQLQNTINCYLAPNPRDAFYMKVFNMTYAEKKQQEELEFFIYENGEKKEVRKSKQDA
Ga0183748_111279633300029319MarinePKNFDISISQQQLQNLIDDWSSPKPIDAFYKRIFGMTFAEKKQQEEIEYFTYENGEKKEVTKSSKETQSIH
Ga0183755_110653813300029448MarineEDMIKSPKYFRDVKITTDQLQNLIDDWSAPKPIDAFYTRIFGMTYAEKKAQEEAEYFTYENGEKKEIRKPKEKTQSVH
Ga0183757_103628613300029787MarineKEDMIKSPKYFRDVKITTDQLQNLIDDWSAPKPIDAFYTRIFGMTYAEKKAQEEAEYFTYENGEKREVRKPKEKTQSVH
Ga0183757_107015633300029787MarineLIDDWSAPKPIDAFYKRIFGMTFAEKKQQEELEYFIYENGEKKEVRKSKQETQSIH
Ga0308023_109339433300031167MarineTDQLQNLIDDWSAPNPRDAMYMRGFGLTYAQKKEQEELEHFIYENGEKKEVRKTKQDS
Ga0310343_1153636823300031785SeawaterQKNPKNFDISTTQQQFQNLIDDWSSPKPIDAFYKRVFNMTFAEKKQQEELEYFIYENGEKKEVRKTKEETQSIH
Ga0315315_1040913753300032073SeawaterITTDQLQNSIDCWSAPNPRDAFYMKVFNMTYAEKKAQEELEHFTYENGEKKEVRKSKEKTQSVH
Ga0316204_1081185313300032373Microbial MatVPKNFSNLSINEVQLQNLIDDWSAPNPRDATYMRVFKMTYAEKKQQEELEFFIYENGEKKEVRKSKKDTQSIH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.