| Basic Information | |
|---|---|
| Family ID | F067789 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MDTVLSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS |
| Number of Associated Samples | 109 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.81 % |
| % of genes near scaffold ends (potentially truncated) | 44.80 % |
| % of genes from short scaffolds (< 2000 bps) | 86.40 % |
| Associated GOLD sequencing projects | 100 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.47 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (15.200 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.200 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (49.600 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 55.13% β-sheet: 0.00% Coil/Unstructured: 44.87% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.47 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF01262 | AlaDh_PNT_C | 33.60 |
| PF05222 | AlaDh_PNT_N | 8.80 |
| PF01676 | Metalloenzyme | 4.80 |
| PF02885 | Glycos_trans_3N | 1.60 |
| PF08241 | Methyltransf_11 | 1.60 |
| PF00144 | Beta-lactamase | 0.80 |
| PF02777 | Sod_Fe_C | 0.80 |
| PF03129 | HGTP_anticodon | 0.80 |
| PF06418 | CTP_synth_N | 0.80 |
| PF01904 | DUF72 | 0.80 |
| PF01175 | Urocanase | 0.80 |
| PF14698 | ASL_C2 | 0.80 |
| PF01488 | Shikimate_DH | 0.80 |
| PF00117 | GATase | 0.80 |
| PF06831 | H2TH | 0.80 |
| PF12982 | DUF3866 | 0.80 |
| PF03602 | Cons_hypoth95 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG2987 | Urocanate hydratase | Amino acid transport and metabolism [E] | 0.80 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.80 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG2242 | Precorrin-6B methylase 2 | Coenzyme transport and metabolism [H] | 0.80 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.80 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.80 |
| COG0124 | Histidyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG0742 | 16S rRNA G966 N2-methylase RsmD | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG0605 | Superoxide dismutase | Inorganic ion transport and metabolism [P] | 0.80 |
| COG0504 | CTP synthase (UTP-ammonia lyase) | Nucleotide transport and metabolism [F] | 0.80 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG0441 | Threonyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG0423 | Glycyl-tRNA synthetase, class II | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG0266 | Formamidopyrimidine-DNA glycosylase | Replication, recombination and repair [L] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 68.00 % |
| Unclassified | root | N/A | 32.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090015|GPICI_8807713 | All Organisms → cellular organisms → Bacteria | 3061 | Open in IMG/M |
| 3300000890|JGI11643J12802_10665233 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300001978|JGI24747J21853_1021265 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300003987|Ga0055471_10186031 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300003993|Ga0055468_10200681 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300004479|Ga0062595_102677296 | Not Available | 502 | Open in IMG/M |
| 3300004480|Ga0062592_101724823 | Not Available | 610 | Open in IMG/M |
| 3300004480|Ga0062592_101890257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 587 | Open in IMG/M |
| 3300005093|Ga0062594_102196797 | Not Available | 597 | Open in IMG/M |
| 3300005162|Ga0066814_10039425 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300005164|Ga0066815_10103684 | Not Available | 537 | Open in IMG/M |
| 3300005327|Ga0070658_10443144 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300005329|Ga0070683_101301594 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300005332|Ga0066388_103443186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 808 | Open in IMG/M |
| 3300005333|Ga0070677_10338936 | Not Available | 775 | Open in IMG/M |
| 3300005335|Ga0070666_10516309 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 867 | Open in IMG/M |
| 3300005336|Ga0070680_100850532 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300005338|Ga0068868_102206533 | Not Available | 525 | Open in IMG/M |
| 3300005339|Ga0070660_101184301 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005353|Ga0070669_100611769 | Not Available | 914 | Open in IMG/M |
| 3300005356|Ga0070674_102072394 | Not Available | 519 | Open in IMG/M |
| 3300005406|Ga0070703_10093947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1045 | Open in IMG/M |
| 3300005457|Ga0070662_101717764 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005459|Ga0068867_101862858 | Not Available | 566 | Open in IMG/M |
| 3300005535|Ga0070684_101731919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 590 | Open in IMG/M |
| 3300005539|Ga0068853_101156502 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300005543|Ga0070672_101965480 | Not Available | 527 | Open in IMG/M |
| 3300005840|Ga0068870_10676784 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300005841|Ga0068863_101126343 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300005844|Ga0068862_100417294 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300005937|Ga0081455_10516879 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300006358|Ga0068871_101260090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 695 | Open in IMG/M |
| 3300006574|Ga0074056_11777499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 528 | Open in IMG/M |
| 3300006575|Ga0074053_11494017 | Not Available | 645 | Open in IMG/M |
| 3300006580|Ga0074049_12709329 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300006605|Ga0074057_11276559 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300007076|Ga0075435_100917887 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300009094|Ga0111539_11328192 | Not Available | 834 | Open in IMG/M |
| 3300009098|Ga0105245_10244925 | All Organisms → cellular organisms → Bacteria | 1739 | Open in IMG/M |
| 3300009101|Ga0105247_10014196 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4779 | Open in IMG/M |
| 3300009156|Ga0111538_11538252 | Not Available | 839 | Open in IMG/M |
| 3300009177|Ga0105248_12890117 | Not Available | 548 | Open in IMG/M |
| 3300009551|Ga0105238_11523604 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 698 | Open in IMG/M |
| 3300009868|Ga0130016_10000094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 193899 | Open in IMG/M |
| 3300009868|Ga0130016_10930007 | Not Available | 504 | Open in IMG/M |
| 3300009870|Ga0131092_10000086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 186339 | Open in IMG/M |
| 3300009873|Ga0131077_10007990 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 22286 | Open in IMG/M |
| 3300009873|Ga0131077_10022760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10566 | Open in IMG/M |
| 3300010362|Ga0126377_10067327 | All Organisms → cellular organisms → Bacteria | 3175 | Open in IMG/M |
| 3300012481|Ga0157320_1028764 | Not Available | 550 | Open in IMG/M |
| 3300012482|Ga0157318_1003794 | Not Available | 894 | Open in IMG/M |
| 3300012503|Ga0157313_1013704 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300012510|Ga0157316_1029886 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 653 | Open in IMG/M |
| 3300012512|Ga0157327_1093982 | Not Available | 502 | Open in IMG/M |
| 3300012514|Ga0157330_1073857 | Not Available | 533 | Open in IMG/M |
| 3300012515|Ga0157338_1057324 | Not Available | 576 | Open in IMG/M |
| 3300012882|Ga0157304_1050557 | Not Available | 639 | Open in IMG/M |
| 3300012900|Ga0157292_10060588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1043 | Open in IMG/M |
| 3300012903|Ga0157289_10083610 | Not Available | 881 | Open in IMG/M |
| 3300012905|Ga0157296_10184850 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 653 | Open in IMG/M |
| 3300012908|Ga0157286_10270943 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 608 | Open in IMG/M |
| 3300012913|Ga0157298_10355051 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012914|Ga0157297_10244131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 646 | Open in IMG/M |
| 3300012914|Ga0157297_10299119 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012943|Ga0164241_10250506 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300012943|Ga0164241_10402214 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300012943|Ga0164241_10610066 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300012989|Ga0164305_11857793 | Not Available | 545 | Open in IMG/M |
| 3300013102|Ga0157371_11155250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 595 | Open in IMG/M |
| 3300013297|Ga0157378_10803630 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300013297|Ga0157378_10823861 | Not Available | 955 | Open in IMG/M |
| 3300013306|Ga0163162_12450774 | Not Available | 600 | Open in IMG/M |
| 3300014325|Ga0163163_11718832 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300014745|Ga0157377_10533496 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300014968|Ga0157379_10651664 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300015371|Ga0132258_10060049 | All Organisms → cellular organisms → Bacteria | 8752 | Open in IMG/M |
| 3300015372|Ga0132256_101394655 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300015374|Ga0132255_102148007 | Not Available | 851 | Open in IMG/M |
| 3300019356|Ga0173481_10035658 | All Organisms → cellular organisms → Bacteria | 1629 | Open in IMG/M |
| 3300019356|Ga0173481_10042442 | Not Available | 1525 | Open in IMG/M |
| 3300019356|Ga0173481_10363250 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 696 | Open in IMG/M |
| 3300019361|Ga0173482_10004082 | All Organisms → cellular organisms → Bacteria | 3322 | Open in IMG/M |
| 3300019361|Ga0173482_10017035 | All Organisms → cellular organisms → Bacteria | 1999 | Open in IMG/M |
| 3300019362|Ga0173479_10089982 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300020082|Ga0206353_10467136 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300022737|Ga0247747_1033600 | Not Available | 604 | Open in IMG/M |
| 3300022880|Ga0247792_1011438 | Not Available | 1371 | Open in IMG/M |
| 3300022880|Ga0247792_1122471 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300022915|Ga0247790_10015595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1590 | Open in IMG/M |
| 3300023069|Ga0247751_1057681 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 659 | Open in IMG/M |
| 3300025567|Ga0210076_1036096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1063 | Open in IMG/M |
| 3300025791|Ga0210115_1095136 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300025899|Ga0207642_10094846 | All Organisms → cellular organisms → Bacteria | 1483 | Open in IMG/M |
| 3300025899|Ga0207642_10345884 | Not Available | 876 | Open in IMG/M |
| 3300025904|Ga0207647_10447198 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
| 3300025908|Ga0207643_10123175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1537 | Open in IMG/M |
| 3300025919|Ga0207657_10211461 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300025932|Ga0207690_10952194 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300025942|Ga0207689_11791968 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300025944|Ga0207661_10089296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2563 | Open in IMG/M |
| 3300025945|Ga0207679_10358365 | All Organisms → cellular organisms → Bacteria | 1273 | Open in IMG/M |
| 3300025972|Ga0207668_11422508 | Not Available | 625 | Open in IMG/M |
| 3300026023|Ga0207677_10091374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2214 | Open in IMG/M |
| 3300026023|Ga0207677_11205956 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300026089|Ga0207648_10151983 | All Organisms → cellular organisms → Bacteria | 2043 | Open in IMG/M |
| 3300026121|Ga0207683_10096838 | All Organisms → cellular organisms → Bacteria | 2631 | Open in IMG/M |
| 3300026905|Ga0207516_1007716 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300027437|Ga0207476_104920 | Not Available | 633 | Open in IMG/M |
| 3300028590|Ga0247823_10501041 | Not Available | 916 | Open in IMG/M |
| 3300028812|Ga0247825_10103690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1926 | Open in IMG/M |
| 3300031576|Ga0247727_10000882 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 72967 | Open in IMG/M |
| 3300031576|Ga0247727_10027676 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 8034 | Open in IMG/M |
| 3300031576|Ga0247727_10262175 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300031996|Ga0308176_11658464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 682 | Open in IMG/M |
| 3300032000|Ga0310903_10105152 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300032003|Ga0310897_10148779 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300032003|Ga0310897_10396835 | Not Available | 652 | Open in IMG/M |
| 3300032012|Ga0310902_11203952 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300032013|Ga0310906_10127302 | Not Available | 1448 | Open in IMG/M |
| 3300032174|Ga0307470_11360313 | Not Available | 584 | Open in IMG/M |
| 3300033513|Ga0316628_103814765 | Not Available | 541 | Open in IMG/M |
| 3300034090|Ga0326723_0161115 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300034164|Ga0364940_0095871 | Not Available | 832 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 15.20% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 8.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 6.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 4.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.20% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.20% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 3.20% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 2.40% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.80% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.80% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.80% |
| Host-Associated | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated | 0.80% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.80% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.80% |
| Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090015 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Host-Associated | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005162 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAB | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
| 3300009870 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant | Engineered | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Host-Associated | Open in IMG/M |
| 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Host-Associated | Open in IMG/M |
| 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Host-Associated | Open in IMG/M |
| 3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
| 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012882 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012908 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1 | Environmental | Open in IMG/M |
| 3300012913 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S043-104R-2 | Environmental | Open in IMG/M |
| 3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022737 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5 | Environmental | Open in IMG/M |
| 3300022880 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S106-311C-6 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300023069 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S049-202B-5 | Environmental | Open in IMG/M |
| 3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G01A4-10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027437 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G05K2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032000 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| GPICI_03334940 | 2088090015 | Soil | MDTALGLLELLLYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS |
| JGI11643J12802_106652332 | 3300000890 | Soil | MDTVLSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQ |
| JGI24747J21853_10212652 | 3300001978 | Corn, Switchgrass And Miscanthus Rhizosphere | RGTASYPSPPMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA |
| Ga0055471_101860312 | 3300003987 | Natural And Restored Wetlands | VISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0055468_102006811 | 3300003993 | Natural And Restored Wetlands | MDTALGLLELLLYIVAILALSMSVTWAVVKVSPSESAKEQRDRTDADATS* |
| Ga0063356_1023883212 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MRPMDTALGLVELVLYVAGILALSMAITWVVVKVSPSESAKEQTAKDASEG* |
| Ga0062595_1026772962 | 3300004479 | Soil | MDTVLSLVELAAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEATTKS* |
| Ga0062592_1017248232 | 3300004480 | Soil | VDTALGLLELLLYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS* |
| Ga0062592_1018902572 | 3300004480 | Soil | MDTVLSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0058861_119822881 | 3300004800 | Host-Associated | FVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0062594_1021967972 | 3300005093 | Soil | MDTALGLLELLVYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS* |
| Ga0066814_100394251 | 3300005162 | Soil | DTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0066815_101036841 | 3300005164 | Soil | MDTILSLVELAAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEATTKS* |
| Ga0070658_104431442 | 3300005327 | Corn Rhizosphere | MDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA* |
| Ga0070683_1013015942 | 3300005329 | Corn Rhizosphere | MDTVISLLELLVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0066388_1034431862 | 3300005332 | Tropical Forest Soil | MDTVISLVELTVYIVAILALSMSVTWAVVKVSPSESAKEQRAKDKGETSTS* |
| Ga0070677_103389362 | 3300005333 | Miscanthus Rhizosphere | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEANAKS* |
| Ga0070666_105163092 | 3300005335 | Switchgrass Rhizosphere | MDTVLSLVELAAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEAKAKS* |
| Ga0070680_1008505322 | 3300005336 | Corn Rhizosphere | ASYPSPPMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0068868_1022065331 | 3300005338 | Miscanthus Rhizosphere | MDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSESAKEQRA |
| Ga0070660_1011843012 | 3300005339 | Corn Rhizosphere | GTASYPSPPMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0070669_1006117691 | 3300005353 | Switchgrass Rhizosphere | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQR |
| Ga0070674_1020723942 | 3300005356 | Miscanthus Rhizosphere | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAES* |
| Ga0070703_100939472 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0070662_1017177641 | 3300005457 | Corn Rhizosphere | YPSPPVDTALGLLELLVYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS* |
| Ga0068867_1018628582 | 3300005459 | Miscanthus Rhizosphere | MDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAES* |
| Ga0070684_1017319192 | 3300005535 | Corn Rhizosphere | MDTALGLLELLLYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS* |
| Ga0068853_1011565021 | 3300005539 | Corn Rhizosphere | LGLLELLLYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS* |
| Ga0070672_1019654802 | 3300005543 | Miscanthus Rhizosphere | MDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSESAKEQR |
| Ga0068870_106767842 | 3300005840 | Miscanthus Rhizosphere | PMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0068863_1011263432 | 3300005841 | Switchgrass Rhizosphere | MDTVLSLVELAAYIVGILALSMSVTWAVVKVSPSESAKQQRAEAEATTKS* |
| Ga0068862_1004172942 | 3300005844 | Switchgrass Rhizosphere | MDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0081455_105168792 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDTALSLLELLLYILAILALSMSVTWAVVKVSPSESAKEQRDRTDANGKS* |
| Ga0068871_1012600902 | 3300006358 | Miscanthus Rhizosphere | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA* |
| Ga0074056_117774992 | 3300006574 | Soil | VDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0074053_114940172 | 3300006575 | Soil | MDTVLSLVELVAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEAKAKS* |
| Ga0074049_127093292 | 3300006580 | Soil | TVLSLVELAAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEATTKS* |
| Ga0074057_112765592 | 3300006605 | Soil | MDTVLSLVELVAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEATTKS* |
| Ga0075435_1009178871 | 3300007076 | Populus Rhizosphere | ASYPSQPMDTAFSLLELLVYILAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAES* |
| Ga0111539_113281922 | 3300009094 | Populus Rhizosphere | MDTALSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRA |
| Ga0105245_102449252 | 3300009098 | Miscanthus Rhizosphere | MDTVLSLVELAAYIGGILALSMSVTWAVVKVSPSESAKQQRAESEATTKS* |
| Ga0105247_100141962 | 3300009101 | Switchgrass Rhizosphere | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRALAEAKAKS* |
| Ga0111538_115382522 | 3300009156 | Populus Rhizosphere | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKE |
| Ga0105248_128901171 | 3300009177 | Switchgrass Rhizosphere | MDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSES |
| Ga0105238_115236042 | 3300009551 | Corn Rhizosphere | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEA |
| Ga0130016_10000094187 | 3300009868 | Wastewater | VDTVISLLELFLYIAAILALSMSVTWAVVKISPSESAKEQRGRTDAKAKS* |
| Ga0130016_109300072 | 3300009868 | Wastewater | MDTVISLLELTLYIVAILALSMSVTWAVVKVSPSESARQQRAQ |
| Ga0131092_1000008615 | 3300009870 | Activated Sludge | MDTVLSLLELVLYIAGILGLSMFVTWAVVKVSPSESAKQQRAQADDKAKA* |
| Ga0131077_100079904 | 3300009873 | Wastewater | MDTVISLVELTVYIVGILALSMSVTWAVVKVSPSESAKEQRAQEKGEAKKA* |
| Ga0131077_100227602 | 3300009873 | Wastewater | MDTVISLLELTLYIAGILGLSMFVTWAVVKVSPSESAKQQRAQAKGEAKT* |
| Ga0126377_100673274 | 3300010362 | Tropical Forest Soil | MDTVFSLSELILYIAAILALSMAVTWAVVRVSPSESAKEQQASEKAKT* |
| Ga0157320_10287642 | 3300012481 | Arabidopsis Rhizosphere | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQEKDEAKA* |
| Ga0157318_10037942 | 3300012482 | Arabidopsis Rhizosphere | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKG* |
| Ga0157313_10137042 | 3300012503 | Arabidopsis Rhizosphere | MDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0157316_10298862 | 3300012510 | Arabidopsis Rhizosphere | MDTVLSLLELLVYIVAILGLSMFVTWAVVKVSPSESAKE |
| Ga0157327_10939821 | 3300012512 | Arabidopsis Rhizosphere | MDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSEGAKEQRAQEQGEAKA* |
| Ga0157330_10738571 | 3300012514 | Soil | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQEQGEAKA* |
| Ga0157338_10573241 | 3300012515 | Arabidopsis Rhizosphere | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRA |
| Ga0157304_10505571 | 3300012882 | Soil | MDTAFSLLELLVYILAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0157292_100605882 | 3300012900 | Soil | MDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAES* |
| Ga0157289_100836102 | 3300012903 | Soil | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAE |
| Ga0157296_101848502 | 3300012905 | Soil | MDTALGLLELLVYIVAILALSMSVTWAVVRVSPSESAK |
| Ga0157286_102709432 | 3300012908 | Soil | MDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKVQRAQAKAKAKS* |
| Ga0157298_103550511 | 3300012913 | Soil | MDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEANAKS* |
| Ga0157297_102441312 | 3300012914 | Soil | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESA |
| Ga0157297_102991192 | 3300012914 | Soil | METVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA* |
| Ga0164241_102505062 | 3300012943 | Soil | MDTVISLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKG* |
| Ga0164241_104022142 | 3300012943 | Soil | MDTVLSLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0164241_106100662 | 3300012943 | Soil | MDNVISLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA* |
| Ga0164305_118577931 | 3300012989 | Soil | MDTVLSLVELVAYIGGILALSMSVTWAVVRISPSESAKEQRAQAKEQRAQAKGEANT* |
| Ga0157371_111552501 | 3300013102 | Corn Rhizosphere | ELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0157378_108036302 | 3300013297 | Miscanthus Rhizosphere | SLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA* |
| Ga0157378_108238612 | 3300013297 | Miscanthus Rhizosphere | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAK |
| Ga0163162_124507741 | 3300013306 | Switchgrass Rhizosphere | MDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKA |
| Ga0163163_117188321 | 3300014325 | Switchgrass Rhizosphere | LLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS* |
| Ga0157377_105334962 | 3300014745 | Miscanthus Rhizosphere | MDTVLSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEANAKS* |
| Ga0157379_106516643 | 3300014968 | Switchgrass Rhizosphere | LLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA* |
| Ga0132258_100600492 | 3300015371 | Arabidopsis Rhizosphere | MDTVISLLELIVYIVAILALSMSVTWAVVKVSPSESAKEQRAQEKDEAKA* |
| Ga0132256_1013946552 | 3300015372 | Arabidopsis Rhizosphere | MDTALSLLELLVYIVAILGLSMFVTWAVVKVSPSESAKEQRAQEQGEAKA* |
| Ga0132255_1021480071 | 3300015374 | Arabidopsis Rhizosphere | ISLLELFVYIVAILGLSMAVTWAVVKVSPSESAKEQRAQEKGEAKA* |
| Ga0173481_100356582 | 3300019356 | Soil | MDTVLSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS |
| Ga0173481_100424422 | 3300019356 | Soil | VDTALGLLELLLYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS |
| Ga0173481_103632502 | 3300019356 | Soil | MDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA |
| Ga0173482_100040822 | 3300019361 | Soil | MDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS |
| Ga0173482_100170352 | 3300019361 | Soil | VDTALGLLELLVYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS |
| Ga0173479_100899822 | 3300019362 | Soil | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS |
| Ga0206353_104671362 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | LLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS |
| Ga0247747_10336001 | 3300022737 | Soil | MDTVLSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQE |
| Ga0247792_10114382 | 3300022880 | Soil | MDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEK |
| Ga0247792_11224711 | 3300022880 | Soil | TASYPSPPMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS |
| Ga0247790_100155953 | 3300022915 | Soil | PMDTVLSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEANAKS |
| Ga0247751_10576812 | 3300023069 | Soil | MDTALGLLELLVYIVAILALSMSVTWAVVRVSPSESAKQQRDRADADAKS |
| Ga0210076_10360962 | 3300025567 | Natural And Restored Wetlands | MDTALGLLELLLYIVAILALSMSVTWAVVKVSPSESAKEQRDRTDADATS |
| Ga0210115_10951361 | 3300025791 | Natural And Restored Wetlands | VISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS |
| Ga0207642_100948463 | 3300025899 | Miscanthus Rhizosphere | YPSPPMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA |
| Ga0207642_103458842 | 3300025899 | Miscanthus Rhizosphere | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSE |
| Ga0207647_104471982 | 3300025904 | Corn Rhizosphere | MDTVLSLVELAAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEATTKS |
| Ga0207643_101231752 | 3300025908 | Miscanthus Rhizosphere | MDTVLSLVELAAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEAKAKS |
| Ga0207657_102114613 | 3300025919 | Corn Rhizosphere | SYPSPPMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS |
| Ga0207690_109521942 | 3300025932 | Corn Rhizosphere | MDTALGLLELLVYIVAILALSMSVTWAVVRVSPSESAKQQRDRAEPDAKS |
| Ga0207689_117919682 | 3300025942 | Miscanthus Rhizosphere | LELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS |
| Ga0207661_100892964 | 3300025944 | Corn Rhizosphere | LLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA |
| Ga0207679_103583652 | 3300025945 | Corn Rhizosphere | PSPSMDTVLSLVELVAYIGGILALSMSVTWAVVKVSPSESAKQQRAEAEATTKS |
| Ga0207668_114225081 | 3300025972 | Switchgrass Rhizosphere | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAK |
| Ga0207677_100913743 | 3300026023 | Miscanthus Rhizosphere | SPPMDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA |
| Ga0207677_112059562 | 3300026023 | Miscanthus Rhizosphere | SLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEANAKS |
| Ga0207648_101519831 | 3300026089 | Miscanthus Rhizosphere | MDTVISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAK |
| Ga0207683_100968384 | 3300026121 | Miscanthus Rhizosphere | VISLLELLVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA |
| Ga0207516_10077162 | 3300026905 | Soil | PSPPMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS |
| Ga0207476_1049201 | 3300027437 | Soil | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQEKGEAKA |
| Ga0247823_105010412 | 3300028590 | Soil | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQ |
| Ga0247825_101036903 | 3300028812 | Soil | ARGTASYPSPPMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAK |
| Ga0247727_1000088253 | 3300031576 | Biofilm | MQPMDTVLSLVELVFYVIAVLALSMAITWVVVKVSPSESAKQQKAQQTET |
| Ga0247727_100276766 | 3300031576 | Biofilm | MQPMDTAISLLELVFYVIAVLALSMAITWVVVKVSPSESAKQQKAQQTET |
| Ga0247727_102621752 | 3300031576 | Biofilm | MQPMDTALSLLELVFYVMAVLALSMAITWVVVKVSPSESAKQQKAQQTDT |
| Ga0308176_116584642 | 3300031996 | Soil | MDTVLSLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS |
| Ga0310903_101051522 | 3300032000 | Soil | MDTALSLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS |
| Ga0310897_101487792 | 3300032003 | Soil | RPMDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQAEAKAKS |
| Ga0310897_103968352 | 3300032003 | Soil | MDTVISLLELFVYIAGILGLSMFVTWAVVKVSPSESAKEQRAQA |
| Ga0310902_112039521 | 3300032012 | Soil | ELFVYIAGILGLSVFVTWSVVKVSPSESAKEQRAQAEAKAKS |
| Ga0310906_101273021 | 3300032013 | Soil | MHTALSLLELFVYIAAILGLSMFVTWAVVKVSPSESAKEQRAQAEANAKS |
| Ga0307470_113603131 | 3300032174 | Hardwood Forest Soil | MDTALSLVELTAYIVAILALSMSVTWAVVRISPSESAKEQRAQAKEQRA |
| Ga0316628_1038147652 | 3300033513 | Soil | VDTVISLVELFFYIAAILALSASVTWAVVKVSPSESAKEQRAEADAKAKG |
| Ga0326723_0161115_330_482 | 3300034090 | Peat Soil | VDTVIGLFELFFYIVAILALSASVTWAVVKISPSESAKEQRAETDAKAKG |
| Ga0364940_0095871_696_830 | 3300034164 | Sediment | MQPMDTVLSLLELVFYVMAVLALSMAITWVVVKVSPSESAKQQKA |
| ⦗Top⦘ |