| Basic Information | |
|---|---|
| Family ID | F067734 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 50 residues |
| Representative Sequence | MANTDKLLLICIIGMIIGFIIVIIDVQKTSYKKGVRDGYHRGRSIKGQE |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 79.20 % |
| % of genes near scaffold ends (potentially truncated) | 23.20 % |
| % of genes from short scaffolds (< 2000 bps) | 72.00 % |
| Associated GOLD sequencing projects | 74 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (69.600 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (28.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (42.400 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.25% β-sheet: 0.00% Coil/Unstructured: 46.75% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF01844 | HNH | 3.20 |
| PF05869 | Dam | 2.40 |
| PF09250 | Prim-Pol | 1.60 |
| PF05065 | Phage_capsid | 1.60 |
| PF04860 | Phage_portal | 1.60 |
| PF12850 | Metallophos_2 | 0.80 |
| PF16778 | Phage_tail_APC | 0.80 |
| PF02018 | CBM_4_9 | 0.80 |
| PF13385 | Laminin_G_3 | 0.80 |
| PF04586 | Peptidase_S78 | 0.80 |
| PF14279 | HNH_5 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 1.60 |
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.40 % |
| Unclassified | root | N/A | 1.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352004|2199905357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14006 | Open in IMG/M |
| 3300002408|B570J29032_109255536 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
| 3300002408|B570J29032_109330258 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
| 3300002447|JGI24768J34885_10014381 | All Organisms → Viruses → Predicted Viral | 2615 | Open in IMG/M |
| 3300002447|JGI24768J34885_10118409 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 893 | Open in IMG/M |
| 3300002835|B570J40625_100817093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
| 3300004112|Ga0065166_10109580 | All Organisms → Viruses → Predicted Viral | 1014 | Open in IMG/M |
| 3300004154|Ga0066603_10403804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 638 | Open in IMG/M |
| 3300004481|Ga0069718_15844300 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 803 | Open in IMG/M |
| 3300004481|Ga0069718_15844409 | All Organisms → cellular organisms → Bacteria | 2021 | Open in IMG/M |
| 3300004481|Ga0069718_16087611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300005527|Ga0068876_10039745 | All Organisms → cellular organisms → Bacteria | 2904 | Open in IMG/M |
| 3300005527|Ga0068876_10234401 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300005527|Ga0068876_10522829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 650 | Open in IMG/M |
| 3300005528|Ga0068872_10724911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
| 3300006030|Ga0075470_10002006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6349 | Open in IMG/M |
| 3300006484|Ga0070744_10074336 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
| 3300006484|Ga0070744_10110719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
| 3300006639|Ga0079301_1110834 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300006802|Ga0070749_10109130 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1631 | Open in IMG/M |
| 3300006802|Ga0070749_10606921 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300006805|Ga0075464_10225630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1117 | Open in IMG/M |
| 3300006805|Ga0075464_10319359 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
| 3300006920|Ga0070748_1088787 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300006920|Ga0070748_1194611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 742 | Open in IMG/M |
| 3300006920|Ga0070748_1280910 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300007162|Ga0079300_10099477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 836 | Open in IMG/M |
| 3300007363|Ga0075458_10048242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1341 | Open in IMG/M |
| 3300007363|Ga0075458_10245534 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300007735|Ga0104988_10316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13412 | Open in IMG/M |
| 3300008055|Ga0108970_10473630 | All Organisms → Viruses → Predicted Viral | 1854 | Open in IMG/M |
| 3300008055|Ga0108970_11516351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 801 | Open in IMG/M |
| 3300008107|Ga0114340_1043037 | All Organisms → Viruses → Predicted Viral | 2010 | Open in IMG/M |
| 3300008261|Ga0114336_1028190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3149 | Open in IMG/M |
| 3300008266|Ga0114363_1002710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15230 | Open in IMG/M |
| 3300008266|Ga0114363_1248914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300009009|Ga0105105_10330026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
| 3300009009|Ga0105105_10916472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
| 3300009037|Ga0105093_10383580 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
| 3300009037|Ga0105093_10411423 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 739 | Open in IMG/M |
| 3300009037|Ga0105093_10531896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
| 3300009081|Ga0105098_10051078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1686 | Open in IMG/M |
| 3300009081|Ga0105098_10206297 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 910 | Open in IMG/M |
| 3300009081|Ga0105098_10784900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300009082|Ga0105099_10320803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 911 | Open in IMG/M |
| 3300009082|Ga0105099_10883509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300009085|Ga0105103_10696206 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300009165|Ga0105102_10614404 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300009169|Ga0105097_10057199 | All Organisms → Viruses → Predicted Viral | 2106 | Open in IMG/M |
| 3300009169|Ga0105097_10138007 | All Organisms → Viruses → Predicted Viral | 1339 | Open in IMG/M |
| 3300009169|Ga0105097_10326886 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
| 3300009169|Ga0105097_10395760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 767 | Open in IMG/M |
| 3300009169|Ga0105097_10467121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
| 3300009169|Ga0105097_10491125 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300010354|Ga0129333_10243366 | All Organisms → Viruses → Predicted Viral | 1624 | Open in IMG/M |
| 3300010354|Ga0129333_11229416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300010354|Ga0129333_11337806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
| 3300010368|Ga0129324_10413518 | Not Available | 520 | Open in IMG/M |
| 3300011009|Ga0129318_10213505 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
| 3300011334|Ga0153697_1279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17083 | Open in IMG/M |
| 3300011336|Ga0153703_1454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14060 | Open in IMG/M |
| 3300011338|Ga0153699_1222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 23967 | Open in IMG/M |
| 3300011339|Ga0153700_10768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15341 | Open in IMG/M |
| 3300012352|Ga0157138_1001153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4833 | Open in IMG/M |
| 3300012352|Ga0157138_1034969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 797 | Open in IMG/M |
| 3300012706|Ga0157627_1083694 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
| 3300012708|Ga0157595_1071457 | All Organisms → Viruses → Predicted Viral | 1645 | Open in IMG/M |
| 3300012715|Ga0157599_1004978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
| 3300012720|Ga0157613_1054010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300012725|Ga0157610_1266497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
| 3300012729|Ga0157625_1265157 | All Organisms → Viruses → Predicted Viral | 1202 | Open in IMG/M |
| 3300012759|Ga0157626_1136173 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300012764|Ga0157624_1120102 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
| 3300013004|Ga0164293_10062892 | All Organisms → cellular organisms → Bacteria | 2945 | Open in IMG/M |
| 3300013004|Ga0164293_10121194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1980 | Open in IMG/M |
| 3300013004|Ga0164293_10373081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
| 3300013004|Ga0164293_10570810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 738 | Open in IMG/M |
| 3300013005|Ga0164292_10573225 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
| 3300013005|Ga0164292_10578429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
| 3300013074|Ga0157618_1089634 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 619 | Open in IMG/M |
| 3300014050|Ga0119952_1128658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300016686|Ga0180056_1067952 | All Organisms → Viruses → Predicted Viral | 1282 | Open in IMG/M |
| 3300016695|Ga0180059_1120618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 948 | Open in IMG/M |
| 3300016697|Ga0180057_1163917 | All Organisms → Viruses → Predicted Viral | 1177 | Open in IMG/M |
| 3300016699|Ga0180058_1124661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
| 3300017754|Ga0181344_1000453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16424 | Open in IMG/M |
| 3300017780|Ga0181346_1085923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1235 | Open in IMG/M |
| 3300020498|Ga0208050_1005368 | All Organisms → Viruses → Predicted Viral | 1565 | Open in IMG/M |
| 3300020498|Ga0208050_1023916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300020536|Ga0207939_1002526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3916 | Open in IMG/M |
| 3300020539|Ga0207941_1003046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3530 | Open in IMG/M |
| 3300025585|Ga0208546_1001904 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6392 | Open in IMG/M |
| 3300025635|Ga0208147_1005063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 3847 | Open in IMG/M |
| 3300025635|Ga0208147_1114119 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
| 3300025896|Ga0208916_10332142 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 663 | Open in IMG/M |
| 3300025896|Ga0208916_10417250 | Not Available | 585 | Open in IMG/M |
| 3300027721|Ga0209492_1023866 | All Organisms → Viruses → Predicted Viral | 2109 | Open in IMG/M |
| 3300027721|Ga0209492_1085157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1115 | Open in IMG/M |
| 3300027726|Ga0209285_10166457 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
| 3300027762|Ga0209288_10031227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1556 | Open in IMG/M |
| 3300027792|Ga0209287_10362180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
| 3300027816|Ga0209990_10010495 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5758 | Open in IMG/M |
| 3300027836|Ga0209230_10002931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7096 | Open in IMG/M |
| 3300027836|Ga0209230_10573427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 634 | Open in IMG/M |
| 3300029349|Ga0238435_101480 | All Organisms → Viruses → Predicted Viral | 4254 | Open in IMG/M |
| 3300029349|Ga0238435_106005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 1292 | Open in IMG/M |
| 3300031787|Ga0315900_10113539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 2599 | Open in IMG/M |
| 3300031951|Ga0315904_10101105 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3031 | Open in IMG/M |
| 3300031963|Ga0315901_10381868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1136 | Open in IMG/M |
| 3300033981|Ga0334982_0049037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 2342 | Open in IMG/M |
| 3300033995|Ga0335003_0005471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6454 | Open in IMG/M |
| 3300033996|Ga0334979_0003302 | All Organisms → cellular organisms → Bacteria | 11550 | Open in IMG/M |
| 3300033996|Ga0334979_0081386 | All Organisms → Viruses → Predicted Viral | 2045 | Open in IMG/M |
| 3300033996|Ga0334979_0148525 | All Organisms → Viruses → Predicted Viral | 1419 | Open in IMG/M |
| 3300034012|Ga0334986_0450189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 643 | Open in IMG/M |
| 3300034061|Ga0334987_0796077 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
| 3300034101|Ga0335027_0006389 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10341 | Open in IMG/M |
| 3300034104|Ga0335031_0005187 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9737 | Open in IMG/M |
| 3300034104|Ga0335031_0019754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4947 | Open in IMG/M |
| 3300034111|Ga0335063_0033667 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales | 3280 | Open in IMG/M |
| 3300034111|Ga0335063_0114931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1607 | Open in IMG/M |
| 3300034119|Ga0335054_0107249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1719 | Open in IMG/M |
| 3300034200|Ga0335065_0651341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300034283|Ga0335007_0151107 | All Organisms → Viruses → Predicted Viral | 1662 | Open in IMG/M |
| 3300034357|Ga0335064_0131502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1536 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 28.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 18.40% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.00% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 6.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 4.80% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 4.00% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.00% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 3.20% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.20% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.20% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 2.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.40% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.40% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.60% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.60% |
| Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 1.60% |
| Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352004 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004154 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - High cellulose week 8 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300007363 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
| 3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
| 3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
| 3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
| 3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
| 3300011338 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Haengju | Environmental | Open in IMG/M |
| 3300011339 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012708 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES113 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012720 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012725 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES137 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012729 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012759 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES158 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012764 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES155 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013074 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES147 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
| 3300016686 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES143 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016695 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES164 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016697 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES156 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300016699 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES160 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020536 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027726 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027762 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
| 3300034357 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME12May2017-rr0187 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200084126 | 2199352004 | Freshwater | MANTDKLLLICMLGMIIGFIMITIDVQRRSYEKGVRDGYHRGRSIKGEE |
| B570J29032_1092555362 | 3300002408 | Freshwater | MANTDKLLLICIIGMIIGFVIVIIDVQKTSYKRGVRDGYHRGRSYKGQE* |
| B570J29032_1093302582 | 3300002408 | Freshwater | MSNTDKLLLICIIGMLFGFGVALYDVSKRSYEKGLREGYHRGRSIKGQE* |
| JGI24768J34885_100143813 | 3300002447 | Freshwater And Sediment | MSSLDKLFVISLVGIFIGFALVLLDVQKTAYNKGVRDGYHRGRSYKGQE* |
| JGI24768J34885_101184091 | 3300002447 | Freshwater And Sediment | MSSLDKLFVISLVGIFIGFALVLLDVQKTAYNKGVRDGYHRGRSYKGQE*KPVK |
| B570J40625_1008170933 | 3300002835 | Freshwater | MANTDKLLLICIIGMIIGFIIVIIDVQKTAYNKGVRDGYHRGRSIKGQE* |
| Ga0065166_101095803 | 3300004112 | Freshwater Lake | MENTDKLLLICMLGMIIGFILIAIDVQRTSYKKGVRDGYHRGRSVKGQE* |
| Ga0066603_104038042 | 3300004154 | Freshwater | MSNLDKLFIISIIGVFIGFAIVILDVQKTAYKKGVRDGYHRGRSYKGQE* |
| Ga0069718_158443002 | 3300004481 | Sediment | MTNTDKLLLICMLGMIIGFIMVTIDVQKRSYEKGVRDGYHRGRSYKGQE* |
| Ga0069718_158444093 | 3300004481 | Sediment | MSSLDKLFIISLIGMCIGFALIIIDVQRTSYNKGVRDGYHRGRTYKGQE* |
| Ga0069718_160876113 | 3300004481 | Sediment | MSNNDKLLMICIIGMWIGFTMVIIDVRRTAYQKGLREGWHRGRSVSRQEFWEE* |
| Ga0068876_100397456 | 3300005527 | Freshwater Lake | MANTDKLLLICIFGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE* |
| Ga0068876_102344012 | 3300005527 | Freshwater Lake | MANTDKLLLICIIGMIIGFIVVIVDVQKTAYKKGVRDGYHRGRSIKGQE* |
| Ga0068876_105228292 | 3300005527 | Freshwater Lake | MSNTDKLLLICIIGMLIGFAITVFDVQRRSYEKGVRDGYHRGRSFKGQE* |
| Ga0068872_107249112 | 3300005528 | Freshwater Lake | MSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE* |
| Ga0075470_100020067 | 3300006030 | Aqueous | MANTDKLLLICIFGMIIGFVIVIIDVQKTAYKKGVRDGYHRGRSYKGQE* |
| Ga0070744_100743362 | 3300006484 | Estuarine | MANTDKLLLICMLGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSIKGQE* |
| Ga0070744_101107191 | 3300006484 | Estuarine | MANTDKLLLICIIGMIIGFIIVIIDVQKTSYKRGVRDGYHRGRSYKGQE* |
| Ga0079301_11108343 | 3300006639 | Deep Subsurface | MSNTDKLLLICIIGMVIGFAITIFDVQRRSYDKGVRDGYHRGRSVKGQE* |
| Ga0070749_101091303 | 3300006802 | Aqueous | MSSLDKLFIISLIGMCIGFALIIIDVQRTSYNKGVRDGYHRGRSYKGQE* |
| Ga0070749_106069211 | 3300006802 | Aqueous | NKGFGAVRYKMSNTDKLLLICIIGMVIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE* |
| Ga0075464_102256303 | 3300006805 | Aqueous | MSSLDKLFIISLVGIFIGFALVLLDVQKTAYNKGVRDGYHRGRSYKGQE* |
| Ga0075464_103193593 | 3300006805 | Aqueous | MANTDKLLLICIFGMIVGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE* |
| Ga0070748_10887873 | 3300006920 | Aqueous | MSSLDKLFIISLIGMCIGFALIIIDVQRTSYNKGVRDGYHRGRAYKGEE* |
| Ga0070748_11946113 | 3300006920 | Aqueous | MANTDKLLLICIIFMIVGFSVAIFDVQRRSYDKGVRDGYHRGRSIKGQE* |
| Ga0070748_12809102 | 3300006920 | Aqueous | MANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE* |
| Ga0079300_100994773 | 3300007162 | Deep Subsurface | MSNTDKLLLICIILMIVGFSVAIFDVQRRSYDKGVRDGYHRGRSYKGQE* |
| Ga0075458_100482423 | 3300007363 | Aqueous | MSNTDKLLLICIIGMCIGFAITVFDVQRRSYEKGVRDGYHRGRSYKGQE* |
| Ga0075458_102455342 | 3300007363 | Aqueous | MANTDKLLLICIILMIVGFSVAIFDVQRRSYDKGVRDGYHRGRSIKGQE* |
| Ga0104988_1031618 | 3300007735 | Freshwater | MSSLDKLFIISLVGIAIGFGLVLLDVQKTAYNKGVRDGYHRGRSIKGKE* |
| Ga0108970_104736303 | 3300008055 | Estuary | MANTDKLLLICMLGMIIGFIMITIDVQKRSYDKGVRDGYHRGRSIKGQE* |
| Ga0108970_115163511 | 3300008055 | Estuary | MSSLDKLFIISLVGIAIGFGLVLLDVQKTAYNKGVRDGYHRGRSYKGQE* |
| Ga0114340_10430372 | 3300008107 | Freshwater, Plankton | MSNTDKLLLICIIGMIAGFIVVIIDVQKTAYNKGVRDGYHRGRSYKGQE* |
| Ga0114336_10281905 | 3300008261 | Freshwater, Plankton | MSNTDKLLLICIIGMIAGFIVVIIDVQKTAYKKGVRDGYHRGRSYKGQE* |
| Ga0114363_100271021 | 3300008266 | Freshwater, Plankton | MSNLDKLLLICIIGMVIGFAITIFDVQRRSYDKGLRDGWHRGRNFRGDLD* |
| Ga0114363_12489141 | 3300008266 | Freshwater, Plankton | MANTDKLLLICMLGMIIGFIMITIDVQRRSYEKGVRDGYHRGRSIKGEE* |
| Ga0105105_103300262 | 3300009009 | Freshwater Sediment | MDNTDKLLLICMLGMIVGFILITMDVQRTAYKKGVRDGYHRGRNYKGQE* |
| Ga0105105_109164721 | 3300009009 | Freshwater Sediment | ICMLGMIIGFILITIDVQRSSYKKGVRDGYHRGRSVKGQE* |
| Ga0105093_103835802 | 3300009037 | Freshwater Sediment | MDNTDKLLLICMLGMIVGFIIITIDVQRTAYKKGVRDGYHRGRTYKGQE* |
| Ga0105093_104114231 | 3300009037 | Freshwater Sediment | IGTEMANTDKLLLICIIGMVIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE* |
| Ga0105093_105318961 | 3300009037 | Freshwater Sediment | KQSRALLQIGTRMENTDKLLLICMLGMIIGFILITIDVQRTSYKKGVRDGYHRGRSIKGQE* |
| Ga0105098_100510783 | 3300009081 | Freshwater Sediment | MANTDKLLLICIIGMIIGFIIVIIDVQKTAYNKGLREGYHRGRSIKGQE* |
| Ga0105098_102062972 | 3300009081 | Freshwater Sediment | MSNLDKLFIISIIGIFIGFAIVIFDVQRTAYDKGVRDGYHRGRSIKGQE* |
| Ga0105098_107849001 | 3300009081 | Freshwater Sediment | MANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSIKGEE* |
| Ga0105099_103208032 | 3300009082 | Freshwater Sediment | MANTDKLLLICMLGMIVGFILITIDVQRSSYKKGVRDGYHRGRNYKGQE* |
| Ga0105099_108835091 | 3300009082 | Freshwater Sediment | MANTDKLLLICIFGMIVGFIIVIIDVQRTAYKKGVRD |
| Ga0105103_106962061 | 3300009085 | Freshwater Sediment | MANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSIKGQE* |
| Ga0105102_106144042 | 3300009165 | Freshwater Sediment | MANTDKLLLICMLGMIIGFIMITKDVQRRSYEKGVRDGYHRGRSIKGEE* |
| Ga0105097_100571993 | 3300009169 | Freshwater Sediment | MSNTDKLLIICIFGMMVGFIMILIDVQRTGYQKGLREGYHRGRSVSRQEFWEE* |
| Ga0105097_101380072 | 3300009169 | Freshwater Sediment | MSNTDKLLIICIIGMWIGFIMVIIDVRHSAYQRGQREGWHRGRSTSRQEFWEE* |
| Ga0105097_103268863 | 3300009169 | Freshwater Sediment | MSNNDKLLMICIIGMWIGLTIVIIDVRRTAYQKGLREGWHRGRSVSRQEFWEE* |
| Ga0105097_103957601 | 3300009169 | Freshwater Sediment | DKLLLICIIGMIIGFIIVIIDVQKTSYKRGVRDGYHRGRSYKGQE* |
| Ga0105097_104671212 | 3300009169 | Freshwater Sediment | MANTDKLLLICILGMIVGFAIIIIDVQKSAYKKGVRDGYHRGRSIKGQE* |
| Ga0105097_104911254 | 3300009169 | Freshwater Sediment | LICIIGMIIGFIIVIIDVQKTSYKRGVRDGYHRGRSYKGQE* |
| Ga0129333_102433665 | 3300010354 | Freshwater To Marine Saline Gradient | VRETPDQIGLRMANTDKLLLICIILMIVGFSVAIFDVQRRSYDKGVRDGYHRGRSIKGQE |
| Ga0129333_112294161 | 3300010354 | Freshwater To Marine Saline Gradient | MANTDKLLLICIALMVIGFAVALFDVQKRSYDKGVRDGYHRGRSFKGQE* |
| Ga0129333_113378062 | 3300010354 | Freshwater To Marine Saline Gradient | MSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSI |
| Ga0129324_104135181 | 3300010368 | Freshwater To Marine Saline Gradient | MSSLDKLFIISLIGMCIGFALIIIDVQRTSYNKGVRDGYHRGRTYKGQV* |
| Ga0129318_102135053 | 3300011009 | Freshwater To Marine Saline Gradient | LICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSVKGQE* |
| Ga0153697_12799 | 3300011334 | Freshwater | MANTDKLLLICMLGMIIGFIMITIDVQKRSYEKGVRDGYHRGRNFRGDLD* |
| Ga0153703_145420 | 3300011336 | Freshwater | MSNTDKLLIIAIIGMLIGFILVLLDVQRVAYQKGLREGWHRGRSTSRQEFWEE* |
| Ga0153699_122218 | 3300011338 | Freshwater | MSNLDKLFIISIIGIFIGFAIVIFDVQRTAYDKGVRDGYHRGRSIKGEE* |
| Ga0153700_107688 | 3300011339 | Freshwater | MSSLDKLFIISLVGIAIGFGLVLLDVQKTAYNKGVRDGYHRGRSIKGEE* |
| Ga0157138_100115310 | 3300012352 | Freshwater | MNNTDKLLLICIILMIVGFSVAIFDVQRRSYDKGVRDGYHRGRSIKGQE* |
| Ga0157138_10349692 | 3300012352 | Freshwater | MQGTQLMANTDKLLLICMLGMIVGFILITIDVQRSSYKKGVRDGYHRGRSVKGKE* |
| Ga0157627_10836943 | 3300012706 | Freshwater | DKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE* |
| Ga0157595_10714575 | 3300012708 | Freshwater | GIGAVRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE* |
| Ga0157599_10049783 | 3300012715 | Freshwater | VRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE* |
| Ga0157613_10540101 | 3300012720 | Freshwater | ALLQIGTEMANTDKLLLICIIGMIIGFVIVIIDVQKTSYKRGVRDGYHRGRSYKGQE* |
| Ga0157610_12664971 | 3300012725 | Freshwater | EMANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE* |
| Ga0157625_12651574 | 3300012729 | Freshwater | LSPIKGIGAVRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE* |
| Ga0157626_11361733 | 3300012759 | Freshwater | LGLRMANTDKLLLICIFGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE* |
| Ga0157624_11201021 | 3300012764 | Freshwater | DSSVTLSLSPIKGIGAVRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE* |
| Ga0164293_100628921 | 3300013004 | Freshwater | MSNTDKLLLICIIGMVIGFAITIFDVQRRSYDKGLRDGYHRGRNFRGDLD* |
| Ga0164293_101211945 | 3300013004 | Freshwater | MSNTDKLLLICIIGMIIGFIIVIIDVQKSAYKKGVRDGYHRGRSIKGQE* |
| Ga0164293_103730812 | 3300013004 | Freshwater | MSNTDKLLLICIIGMLFGFGVALYDVSKRSYEKGLREGYHRGRRIKGQE* |
| Ga0164293_105708102 | 3300013004 | Freshwater | LQLGNEMANTDKLLLICIIGMIIGFVIVIIDVQKTSYKRGVRDGYHRGRSYKGQE* |
| Ga0164292_105732252 | 3300013005 | Freshwater | MSNTDKLLLICIIGMLFGFGVALYDVSKRSYEKGLREGYHRGRRIKGQ |
| Ga0164292_105784292 | 3300013005 | Freshwater | MANTDKLLLICIVGMIVGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE* |
| Ga0157618_10896343 | 3300013074 | Freshwater | GAVRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE* |
| Ga0119952_11286582 | 3300014050 | Freshwater | MSNTDKLLLICIIGMLIGFAITVFDVQRRSYEKGVRDGYHRGRSIKGQE* |
| Ga0180056_10679521 | 3300016686 | Freshwater | AVRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE |
| Ga0180059_11206182 | 3300016695 | Freshwater | MSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIK |
| Ga0180057_11639171 | 3300016697 | Freshwater | GIGAVRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE |
| Ga0180058_11246611 | 3300016699 | Freshwater | SVRYKMSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE |
| Ga0181344_100045311 | 3300017754 | Freshwater Lake | MENTDKLLLICMLGMIIGFILIAIDVQRTSYKKGVRDGYHRGRSVKGQE |
| Ga0181346_10859233 | 3300017780 | Freshwater Lake | MANTDKLLLICIIGMIIGFAIVILDVQKTAYNKGVRDGYHRGRSYKGQE |
| Ga0208050_10053683 | 3300020498 | Freshwater | MANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSIKGQE |
| Ga0208050_10239163 | 3300020498 | Freshwater | MSNTDKLLLICIIGMIVGFIIVIIDVQKTAYKKGVRD |
| Ga0207939_100252610 | 3300020536 | Freshwater | MTNTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE |
| Ga0207941_10030467 | 3300020539 | Freshwater | MANTDKLLLICIIGMIIGFVIVIIDVQKTSYKRGVRDGYHRGRSYKGQE |
| Ga0208546_10019049 | 3300025585 | Aqueous | MANTDKLLLICIFGMIIGFVIVIIDVQKTAYKKGVRDGYHRGRSYKGQE |
| Ga0208147_10050637 | 3300025635 | Aqueous | MSNTDKLLLICIIGMLIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE |
| Ga0208147_11141192 | 3300025635 | Aqueous | MSNTDKLLLICIIGMCIGFAITVFDVQRRSYEKGVRDGYHRGRSYKGQE |
| Ga0208916_103321422 | 3300025896 | Aqueous | VSNTDKLLLICIIGMVIGFAITIFDVQRRSYDKGVRDGYHRGRSIKGQE |
| Ga0208916_104172501 | 3300025896 | Aqueous | MANTDKLLLICIFGMIVGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQEXEP |
| Ga0209492_10238665 | 3300027721 | Freshwater Sediment | MSNTDKLLIICIFGMMVGFIMILIDVQRTGYQKGLREGYHRGRSVSRQEFWEE |
| Ga0209492_10851572 | 3300027721 | Freshwater Sediment | MSNTDKLLIICIIGMWIGFIMVIIDVRHSAYQRGQREGWHRGRSTSRQEFWEE |
| Ga0209285_101664572 | 3300027726 | Freshwater Sediment | MANTDKLLLICIIGMIVGFAIAIFDVQRRSYDKGVRDGYHRGRTYKGQE |
| Ga0209288_100312273 | 3300027762 | Freshwater Sediment | MANTDKLLLICIIGMIVGFAIAIFDVQRRSYDKGVRDGYHRGRSIKGQE |
| Ga0209287_103621801 | 3300027792 | Freshwater Sediment | MENTDKLLLICMLGMIIGFILITIDVQRTSYKKGVRDGYHRGRS |
| Ga0209990_1001049513 | 3300027816 | Freshwater Lake | MANTDKLLLICIIGMIIGFIVVIVDVQKTAYKKGVRDGYHRGRSIKGQE |
| Ga0209230_1000293114 | 3300027836 | Freshwater And Sediment | MSSLDKLFVISLVGIFIGFALVLLDVQKTAYNKGVRDGYHRGRSYKGQE |
| Ga0209230_105734273 | 3300027836 | Freshwater And Sediment | ASGQIGKKMSSLDKLFVISLVGIFIGFALVLLDVQKTAYNKGVRDGYHRGRSYKGQE |
| Ga0238435_1014805 | 3300029349 | Freshwater | MANTDKLLLICIIGMIIGFIVVIIDVQKSAYKKGVRDGYHRGRSIKGQE |
| Ga0238435_1060053 | 3300029349 | Freshwater | MSSLDKLFILSLIGIAVGLIIVVIDVQKTAYDKGVRDGYHRGRSYKGQE |
| Ga0315900_101135394 | 3300031787 | Freshwater | MSNTDKLLLICIIGMIAGFIVVIIDVQKTAYKKGVRDGYHRGRSYKGQE |
| Ga0315904_101011056 | 3300031951 | Freshwater | MSNTDKLLLICIIGMLIGFAITVFDVQRRSYEKGVRDGYHRGRSFKGQE |
| Ga0315901_103818683 | 3300031963 | Freshwater | MSNLDKLLLICIIGMVIGFAITIFDVQRRSYDKGLRDGWHRGRNFRGDLD |
| Ga0334982_0049037_789_938 | 3300033981 | Freshwater | MSNTDKLLLICIIGMIIGFIIVIIDVQKSAYNKGVRDGYHRGRSIKGQE |
| Ga0335003_0005471_2600_2749 | 3300033995 | Freshwater | MANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSYKGQE |
| Ga0334979_0003302_4188_4337 | 3300033996 | Freshwater | MANTDKLLLICIIGMIIGFIIVIIDVQKTSYKRGVRDGYHRGRSYKGQE |
| Ga0334979_0081386_933_1082 | 3300033996 | Freshwater | MSNTDKLLLICIIGMIIGFIIVIIDVQKSAYKKGVRDGYHRGRSIKGQE |
| Ga0334979_0148525_447_599 | 3300033996 | Freshwater | MSNTDKLLLICIIGMVIGFAITIFDVQRRSYDKGLRDGYHRGRNFRGDLD |
| Ga0334986_0450189_291_461 | 3300034012 | Freshwater | LAQLGKKMANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSIKGQE |
| Ga0334987_0796077_254_403 | 3300034061 | Freshwater | MSNTDKLLLICIIGMIIGFIIVIIDVQKTAYNKGVRDGYHRGRSIKGQE |
| Ga0335027_0006389_2811_2960 | 3300034101 | Freshwater | MANTDKLLLICIIGMIIGFIIVIIDVQKSAYNKGVRDGYHRGRSIKGQE |
| Ga0335031_0005187_7214_7363 | 3300034104 | Freshwater | MSNTDKLLLICIIGMLFGFGVALYDVSKRSYEKGLREGYHRGRRVKGQE |
| Ga0335031_0019754_2382_2531 | 3300034104 | Freshwater | MSNTDKLLLICIIGMIIGFIIVIIDVQKTSYKRGVRDGYHRGRSYKGQE |
| Ga0335063_0033667_1755_1904 | 3300034111 | Freshwater | MSNTDKLLLICIIGMCIGFAITIFDVQRRSYEKGVRDGYHRGRSIKGQE |
| Ga0335063_0114931_1186_1335 | 3300034111 | Freshwater | MANTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGMRDGYHRGRSIKGQE |
| Ga0335054_0107249_488_637 | 3300034119 | Freshwater | MANTDKLLLICIIGMIIGFIIVIIDVQKTSYKKGVRDGYHRGRSIKGQE |
| Ga0335065_0651341_299_448 | 3300034200 | Freshwater | MTNTDKLLLICIIGMIIGFIIVIIDVQKTAYKKGVRDGYHRGRSIKGQE |
| Ga0335007_0151107_1515_1661 | 3300034283 | Freshwater | ANTDKLLLICIIGMIIGFIIVIIDVQKTSYKRGVRDGYHRGRSYKGQE |
| Ga0335064_0131502_842_991 | 3300034357 | Freshwater | MANTDKLLMICLIGMIVGFGIALFDVQKRSYEKGVRDGYHRGRSYKGQE |
| ⦗Top⦘ |