| Basic Information | |
|---|---|
| Family ID | F067714 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MVKLALILLFGTAFAQGLAATSSQPPLLIEDTTAAHR |
| Number of Associated Samples | 87 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 15.20 % |
| % of genes near scaffold ends (potentially truncated) | 14.40 % |
| % of genes from short scaffolds (< 2000 bps) | 80.00 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (95.200 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere (11.200 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.200 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.800 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 32.31% β-sheet: 0.00% Coil/Unstructured: 67.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF00892 | EamA | 41.60 |
| PF04551 | GcpE | 37.60 |
| PF07077 | DUF1345 | 4.00 |
| PF00893 | Multi_Drug_Res | 2.40 |
| PF00106 | adh_short | 1.60 |
| PF08937 | DUF1863 | 0.80 |
| PF01145 | Band_7 | 0.80 |
| PF07715 | Plug | 0.80 |
| PF13536 | EmrE | 0.80 |
| PF01425 | Amidase | 0.80 |
| PF13469 | Sulfotransfer_3 | 0.80 |
| PF03061 | 4HBT | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG0821 | 4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE | Lipid transport and metabolism [I] | 37.60 |
| COG4291 | Uncharacterized membrane protein | Function unknown [S] | 4.00 |
| COG2076 | Multidrug transporter EmrE and related cation transporters | Defense mechanisms [V] | 2.40 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 95.20 % |
| Unclassified | root | N/A | 4.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_7400864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 983 | Open in IMG/M |
| 3300001205|C688J13580_1022151 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 773 | Open in IMG/M |
| 3300001991|JGI24743J22301_10006287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 2018 | Open in IMG/M |
| 3300001991|JGI24743J22301_10026661 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1125 | Open in IMG/M |
| 3300002075|JGI24738J21930_10058629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 789 | Open in IMG/M |
| 3300002568|C688J35102_120075266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 869 | Open in IMG/M |
| 3300002568|C688J35102_120963181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 3319 | Open in IMG/M |
| 3300003324|soilH2_10115656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1094 | Open in IMG/M |
| 3300004153|Ga0063455_100146359 | Not Available | 1076 | Open in IMG/M |
| 3300004479|Ga0062595_102289466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6 | 532 | Open in IMG/M |
| 3300005093|Ga0062594_100034832 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2371 | Open in IMG/M |
| 3300005163|Ga0066823_10001905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2465 | Open in IMG/M |
| 3300005175|Ga0066673_10722628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 573 | Open in IMG/M |
| 3300005179|Ga0066684_10148471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1485 | Open in IMG/M |
| 3300005184|Ga0066671_10754673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 625 | Open in IMG/M |
| 3300005184|Ga0066671_10893877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 563 | Open in IMG/M |
| 3300005329|Ga0070683_101187562 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 733 | Open in IMG/M |
| 3300005355|Ga0070671_100001037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 20449 | Open in IMG/M |
| 3300005356|Ga0070674_100151600 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1750 | Open in IMG/M |
| 3300005434|Ga0070709_10075284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2189 | Open in IMG/M |
| 3300005454|Ga0066687_10321658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 881 | Open in IMG/M |
| 3300005456|Ga0070678_100652976 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 944 | Open in IMG/M |
| 3300005543|Ga0070672_100002691 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 11370 | Open in IMG/M |
| 3300005543|Ga0070672_100098993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2362 | Open in IMG/M |
| 3300005543|Ga0070672_100124307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2115 | Open in IMG/M |
| 3300005543|Ga0070672_100126623 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2096 | Open in IMG/M |
| 3300005543|Ga0070672_100336231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1285 | Open in IMG/M |
| 3300005543|Ga0070672_101172639 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 684 | Open in IMG/M |
| 3300005548|Ga0070665_100006014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 12406 | Open in IMG/M |
| 3300005548|Ga0070665_101211372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 766 | Open in IMG/M |
| 3300005560|Ga0066670_10219848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1146 | Open in IMG/M |
| 3300005563|Ga0068855_100691030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 1093 | Open in IMG/M |
| 3300005563|Ga0068855_101535153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 683 | Open in IMG/M |
| 3300005564|Ga0070664_100649980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 980 | Open in IMG/M |
| 3300005575|Ga0066702_10358215 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 887 | Open in IMG/M |
| 3300005575|Ga0066702_10548433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 699 | Open in IMG/M |
| 3300005575|Ga0066702_10714748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 597 | Open in IMG/M |
| 3300005578|Ga0068854_100817336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 813 | Open in IMG/M |
| 3300005616|Ga0068852_101999411 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 602 | Open in IMG/M |
| 3300005616|Ga0068852_102121963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 584 | Open in IMG/M |
| 3300005985|Ga0081539_10008112 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 9275 | Open in IMG/M |
| 3300006574|Ga0074056_11390514 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 549 | Open in IMG/M |
| 3300006581|Ga0074048_12883034 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 675 | Open in IMG/M |
| 3300006605|Ga0074057_10975193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 550 | Open in IMG/M |
| 3300006800|Ga0066660_10065670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2439 | Open in IMG/M |
| 3300006806|Ga0079220_10869427 | Not Available | 694 | Open in IMG/M |
| 3300006881|Ga0068865_101159362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 683 | Open in IMG/M |
| 3300006954|Ga0079219_10735342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 759 | Open in IMG/M |
| 3300006954|Ga0079219_10849340 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 728 | Open in IMG/M |
| 3300009098|Ga0105245_10197928 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1928 | Open in IMG/M |
| 3300009137|Ga0066709_102612204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 676 | Open in IMG/M |
| 3300009148|Ga0105243_10631520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1035 | Open in IMG/M |
| 3300009177|Ga0105248_10130775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 2832 | Open in IMG/M |
| 3300009177|Ga0105248_10411521 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1523 | Open in IMG/M |
| 3300009551|Ga0105238_10861581 | Not Available | 923 | Open in IMG/M |
| 3300012202|Ga0137363_10579707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 946 | Open in IMG/M |
| 3300012957|Ga0164303_11145239 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6 | 565 | Open in IMG/M |
| 3300012958|Ga0164299_10043684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2047 | Open in IMG/M |
| 3300012958|Ga0164299_10064596 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1770 | Open in IMG/M |
| 3300012958|Ga0164299_10353957 | Not Available | 925 | Open in IMG/M |
| 3300012958|Ga0164299_10900503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 642 | Open in IMG/M |
| 3300012960|Ga0164301_10436707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 927 | Open in IMG/M |
| 3300012960|Ga0164301_10694606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 765 | Open in IMG/M |
| 3300012960|Ga0164301_11634688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6 | 536 | Open in IMG/M |
| 3300012961|Ga0164302_10634207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 780 | Open in IMG/M |
| 3300012986|Ga0164304_11209433 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 611 | Open in IMG/M |
| 3300012987|Ga0164307_10285695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1169 | Open in IMG/M |
| 3300012987|Ga0164307_11763398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 525 | Open in IMG/M |
| 3300013100|Ga0157373_10104311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1994 | Open in IMG/M |
| 3300013102|Ga0157371_10938594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6 | 657 | Open in IMG/M |
| 3300013105|Ga0157369_10158475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2390 | Open in IMG/M |
| 3300014325|Ga0163163_10330474 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 1579 | Open in IMG/M |
| 3300014497|Ga0182008_10815801 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 543 | Open in IMG/M |
| 3300015371|Ga0132258_11813400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1537 | Open in IMG/M |
| 3300018431|Ga0066655_10901424 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 605 | Open in IMG/M |
| 3300018433|Ga0066667_11239319 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 650 | Open in IMG/M |
| 3300018433|Ga0066667_12065156 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 526 | Open in IMG/M |
| 3300018468|Ga0066662_10127016 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1875 | Open in IMG/M |
| 3300018468|Ga0066662_10507958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1100 | Open in IMG/M |
| 3300018468|Ga0066662_11563544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 687 | Open in IMG/M |
| 3300018468|Ga0066662_12507067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6 | 544 | Open in IMG/M |
| 3300018482|Ga0066669_10427695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1130 | Open in IMG/M |
| 3300021377|Ga0213874_10016127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1983 | Open in IMG/M |
| 3300021445|Ga0182009_10377603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 729 | Open in IMG/M |
| 3300025315|Ga0207697_10010388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 3981 | Open in IMG/M |
| 3300025315|Ga0207697_10058645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1599 | Open in IMG/M |
| 3300025321|Ga0207656_10026953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2347 | Open in IMG/M |
| 3300025321|Ga0207656_10666765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. | 532 | Open in IMG/M |
| 3300025893|Ga0207682_10021220 | All Organisms → cellular organisms → Bacteria | 2554 | Open in IMG/M |
| 3300025893|Ga0207682_10051196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1710 | Open in IMG/M |
| 3300025893|Ga0207682_10095241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 1296 | Open in IMG/M |
| 3300025899|Ga0207642_10106802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1417 | Open in IMG/M |
| 3300025899|Ga0207642_10734384 | Not Available | 624 | Open in IMG/M |
| 3300025901|Ga0207688_10184710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1245 | Open in IMG/M |
| 3300025901|Ga0207688_10926576 | Not Available | 551 | Open in IMG/M |
| 3300025903|Ga0207680_10562148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 815 | Open in IMG/M |
| 3300025904|Ga0207647_10158177 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1322 | Open in IMG/M |
| 3300025907|Ga0207645_10085999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2019 | Open in IMG/M |
| 3300025907|Ga0207645_10363766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 969 | Open in IMG/M |
| 3300025913|Ga0207695_10688808 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 903 | Open in IMG/M |
| 3300025924|Ga0207694_11044743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 691 | Open in IMG/M |
| 3300025926|Ga0207659_10280564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1362 | Open in IMG/M |
| 3300025931|Ga0207644_10001236 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 16423 | Open in IMG/M |
| 3300025931|Ga0207644_10004563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 9003 | Open in IMG/M |
| 3300025931|Ga0207644_10960072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 717 | Open in IMG/M |
| 3300025932|Ga0207690_11560563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 552 | Open in IMG/M |
| 3300025937|Ga0207669_10373738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1108 | Open in IMG/M |
| 3300025949|Ga0207667_10923726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → environmental samples → uncultured Sphingomonas sp. | 863 | Open in IMG/M |
| 3300025986|Ga0207658_10497651 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 1085 | Open in IMG/M |
| 3300026089|Ga0207648_11986188 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 543 | Open in IMG/M |
| 3300026319|Ga0209647_1053997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 2139 | Open in IMG/M |
| 3300026527|Ga0209059_1009709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 4346 | Open in IMG/M |
| 3300027310|Ga0207983_1004331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 1538 | Open in IMG/M |
| 3300028379|Ga0268266_12194669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 524 | Open in IMG/M |
| 3300028381|Ga0268264_10112977 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057 | 2382 | Open in IMG/M |
| 3300031716|Ga0310813_10262586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 1442 | Open in IMG/M |
| 3300031901|Ga0307406_10866551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 767 | Open in IMG/M |
| 3300031938|Ga0308175_101381060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 785 | Open in IMG/M |
| 3300031938|Ga0308175_101448565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007 | 767 | Open in IMG/M |
| 3300031938|Ga0308175_101837047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 679 | Open in IMG/M |
| 3300031939|Ga0308174_10593535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 916 | Open in IMG/M |
| 3300031939|Ga0308174_10887205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis | 752 | Open in IMG/M |
| 3300031995|Ga0307409_100305478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 1482 | Open in IMG/M |
| 3300031996|Ga0308176_11770219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 659 | Open in IMG/M |
| 3300031996|Ga0308176_12668634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6 | 532 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 11.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 8.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 7.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 5.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 4.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.20% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.40% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.60% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.60% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.80% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.80% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.80% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003324 | Sugarcane bulk soil Sample H2 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005163 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0507.00001910 | 2162886012 | Miscanthus Rhizosphere | GAMVKLALILLFGTAFAQGLAATSSQPPLLIEDTTAAHR |
| C688J13580_10221512 | 3300001205 | Soil | LSAQLGAVIKLALILFMGTAFAQGLAATSSEPPLLIQDTTAAPLDGAH* |
| JGI24743J22301_100062871 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKLVLLLIMGTAFAQGIAATHQQPPLLVQDTTVAG |
| JGI24743J22301_100266611 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | KLALILFFGTAFAQGLAATSSQPPLLIEDTTAAHR* |
| JGI24738J21930_100586292 | 3300002075 | Corn Rhizosphere | MVKLVLLLIMGTAFAQGIAATHXQPPLLXQDTTVAGR* |
| C688J35102_1200752662 | 3300002568 | Soil | MVKLALILIMGAFAQGLAATSNQPPLLIQDTTAPLDAAR* |
| C688J35102_1209631815 | 3300002568 | Soil | VIKLALILLMGTVFAQGLATNSQPPLLIQDTTAPLDGAH* |
| soilH2_101156562 | 3300003324 | Sugarcane Root And Bulk Soil | MVKLIVILIMGSAFAQGLALTDNQPPLLIQDTTAPLDGAH* |
| Ga0063455_1001463591 | 3300004153 | Soil | VIKLALILFMGTAFAQGLAATSSEPPLLIQDTTAAPLDGA |
| Ga0062595_1022894661 | 3300004479 | Soil | MIKLLLILTVGTAFAQGLASNASQRPLLIQDTTAPLDAAH* |
| Ga0062594_1000348322 | 3300005093 | Soil | MIKLLLILTMGTAFAQELASNASQPPMLIQDTTAPLDAAH* |
| Ga0066823_100019052 | 3300005163 | Soil | MVKLALILILGAFAQGFAATSSQPPMLIQDTTAPLDGAR* |
| Ga0066673_107226282 | 3300005175 | Soil | MVKLALILIMGTAFAQGLAATASQPPLLIQDTTAPSLDGAR* |
| Ga0066684_101484713 | 3300005179 | Soil | MVKLALILIMGTAFAQGLSSANSQPPLLIQDTTAPSLDGAR* |
| Ga0066671_107546731 | 3300005184 | Soil | MVKLAMILIMGAFAQGLAATSNQPPLLIQDTTAPLDAAR* |
| Ga0066671_108938772 | 3300005184 | Soil | MVKLVLILIMGTAFAQGLAATNSQPPLLIEDTTAAPLDGGR* |
| Ga0070683_1011875621 | 3300005329 | Corn Rhizosphere | AGAHQCAMIKLLLILTMGTAFAQGLASNASQPPLLIQDTTAAPLDAAH* |
| Ga0070671_1000010377 | 3300005355 | Switchgrass Rhizosphere | MVKLALILIIGAFAQGLAATSSQRPMLIQDTTAPLDGAR* |
| Ga0070674_1001516002 | 3300005356 | Miscanthus Rhizosphere | MVKLALILILGAFAQGLAATSSQPPMLIQDTTAPLDDAR* |
| Ga0070709_100752842 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKLALILLFGTAFAQGLSSANNPPPLLIQDTTAAPLDGGR* |
| Ga0066687_103216582 | 3300005454 | Soil | MVKLVLILIMGTAFAQGLAATSSPPPLLIQDTTAPLDGAG* |
| Ga0070678_1006529762 | 3300005456 | Miscanthus Rhizosphere | MIKLLLILTMGTAFAQGLASNASQPPLLIQDTTAAPLDAAH* |
| Ga0070672_1000026916 | 3300005543 | Miscanthus Rhizosphere | MVKLVLLLIMGTAFAQGIAATHQQPPLLVQDTTVAGR* |
| Ga0070672_1000989935 | 3300005543 | Miscanthus Rhizosphere | CAMVKLVLILLMGSAFAQGLASTNAQPPLLIEDTTAAHR* |
| Ga0070672_1001243072 | 3300005543 | Miscanthus Rhizosphere | MVKLALILLFGTAFAQGLAATSSQPPLLIEDTTAAHR* |
| Ga0070672_1001266232 | 3300005543 | Miscanthus Rhizosphere | MVKLALILFFGTAFAQGLAATSSQPPLLIEDTTAAHR* |
| Ga0070672_1003362313 | 3300005543 | Miscanthus Rhizosphere | MVKLVLILIMGAFAQGLAATSSQPPLLIEDTTAAHR* |
| Ga0070672_1011726392 | 3300005543 | Miscanthus Rhizosphere | MVKLALILILGAFAQGFAANSGQPPMLIQDTTAPLDGAR* |
| Ga0070665_1000060142 | 3300005548 | Switchgrass Rhizosphere | MVKLALILLFGTAFAQGLASTNAQPPLLIEDTTAAHR* |
| Ga0070665_1012113722 | 3300005548 | Switchgrass Rhizosphere | MVKLVLLLIMGTAFAQGIAATHQQPPLLIQDTTVAGR* |
| Ga0066670_102198482 | 3300005560 | Soil | MVKLALILLFGTAFAQGIAATASQPPLLIEDTTAAHR* |
| Ga0068855_1006910302 | 3300005563 | Corn Rhizosphere | MVKLALILFFGTAFAQGLAATNTQPPLLIEDTTAAYR* |
| Ga0068855_1015351532 | 3300005563 | Corn Rhizosphere | MVKLVLILLFGTAFAQGLAATASQPPLLIEDTTAAHR* |
| Ga0070664_1006499802 | 3300005564 | Corn Rhizosphere | MVKLALILLMGTAFAQGIAATSSQPPLLIQDTTASQR* |
| Ga0066702_103582151 | 3300005575 | Soil | MVKLVLILVMGTAFAQGLASTSSQPPLLIEDTTAAPLDAGR* |
| Ga0066702_105484332 | 3300005575 | Soil | MVKLALILLFGTAFAQGIAATTTQPPLLIEDTTAAHR* |
| Ga0066702_107147482 | 3300005575 | Soil | MVKLALILLFGTAFAQGLSAAGNQPPLLIQDTTAAPLDGAH* |
| Ga0068854_1008173362 | 3300005578 | Corn Rhizosphere | MVKLALILIMGTAFAQGISATSSQPPLLIQDTTASQR* |
| Ga0068852_1019994112 | 3300005616 | Corn Rhizosphere | MVKLAIILLMGSAFAHGLASTNSQPPLLIEDTTAAHR* |
| Ga0068852_1021219632 | 3300005616 | Corn Rhizosphere | MVKLIVILIMGSAFAQGLALTDSQPPLLIQDTTAAPLDGAH* |
| Ga0081539_100081129 | 3300005985 | Tabebuia Heterophylla Rhizosphere | MVKLVLILIMGTAFAQGLAATHSQPPLLIEDTTAAPLDDAR* |
| Ga0074056_113905142 | 3300006574 | Soil | MVKLALILIMGTAFVQGLTAAASAPPLLIEDTTAAHR* |
| Ga0074048_128830341 | 3300006581 | Soil | QCAMIKLLLILTVGTAFAQGLASNASQRPLLIQDTTAPLDAAH* |
| Ga0074057_109751931 | 3300006605 | Soil | AHLRAMVKLALILIMGTAFVQGLTAAASAPPLLIEDTTAAHR* |
| Ga0066660_100656703 | 3300006800 | Soil | MLKLALLLIMGTAFAQGLAASASQPPLLIQDTTAPPLDAAG* |
| Ga0079220_108694272 | 3300006806 | Agricultural Soil | MVKLALILLMGTAFAQGLSSSSQPPLLIEDTTAAHR* |
| Ga0068865_1011593622 | 3300006881 | Miscanthus Rhizosphere | MVKLVLILLMGSAFAQGLASTNAQPPLLIEDTTAAHR* |
| Ga0079219_107353422 | 3300006954 | Agricultural Soil | MVKLVLILLMGTAFAQELSSSTTPPLLIQDTTAPLDGAR* |
| Ga0079219_108493401 | 3300006954 | Agricultural Soil | MVKLLLILLMGSAFAQGLSNSAQPPLLIQDTTAAQR* |
| Ga0105245_101979283 | 3300009098 | Miscanthus Rhizosphere | MVKLAIILLFGTAFAQGFASTHKQPPLLIQDTTAAQR* |
| Ga0066709_1026122042 | 3300009137 | Grasslands Soil | MVKLALILLFGTAFAQGLAVASQPPLLIQDTTAPLDGSR* |
| Ga0105243_106315202 | 3300009148 | Miscanthus Rhizosphere | MVKLALILFFGTAFAQGLAATNTQPPLLIEDTTAAHR* |
| Ga0105248_101307753 | 3300009177 | Switchgrass Rhizosphere | MVKLALILVLGAFAQGFAANSGQPPMLIQDTTAPLDGAR* |
| Ga0105248_104115213 | 3300009177 | Switchgrass Rhizosphere | MVKLALILIIGAFAQGLAATSSQPPMLIQDTTAPLDGAR* |
| Ga0105238_108615812 | 3300009551 | Corn Rhizosphere | MIKLVLILVTATAFAQGLASASSQPPLLVQDTTAH* |
| Ga0137363_105797072 | 3300012202 | Vadose Zone Soil | MVKLVLILIMGTAFAQGLAATSSPPPLLIQDTTAPLDGAR* |
| Ga0164303_111452391 | 3300012957 | Soil | MVKLVLILIMGTAFAQGIAATGNQPPLLIEDTTAAQR* |
| Ga0164299_100436844 | 3300012958 | Soil | VIKLALILFMGTAFAQGLASTSSEPPLLIQDTTVAPLDGAH* |
| Ga0164299_100645963 | 3300012958 | Soil | MIKLLRILTVGTAFAQGLASNASQRPLLIQDTTAPLDAAH* |
| Ga0164299_103539571 | 3300012958 | Soil | MVKLLLILIMGTAFAQGLSGSTQPPLLVQDTTAAPLDGAH* |
| Ga0164299_109005031 | 3300012958 | Soil | MVKLALILIIGAFAHGLAAISNQPTMLIQDTTAPLDGAR* |
| Ga0164301_104367072 | 3300012960 | Soil | MIKLALILIMGTSFAQGLAATTSQPPLLIQDTTAPLDGAR* |
| Ga0164301_106946062 | 3300012960 | Soil | AALHRAMVKLALILLFGTAFAQGIAATSSQPPLLIQDTSAAPLDAAR* |
| Ga0164301_116346881 | 3300012960 | Soil | MVKLLLILIMGTAFAQGLSGSTQPPLLIQDTTAAPLDGAH* |
| Ga0164302_106342072 | 3300012961 | Soil | VIKLALILFMGTAFAQGLASTSSEPPLLIQDTTAAPLDGAH* |
| Ga0164304_112094332 | 3300012986 | Soil | MIKLLLILTVGTAFAQGLASNASQPPMLIQDTTAPLDAAH* |
| Ga0164307_102856952 | 3300012987 | Soil | VIKLALILFMGTAFAQGLASTSSEPPLLIQDTTAEPLDGAH* |
| Ga0164307_117633982 | 3300012987 | Soil | MVKLLLILIMGTAFAQGLWGSTQPPLLIQDTTAAPLDGAH* |
| Ga0157373_101043112 | 3300013100 | Corn Rhizosphere | MVKLALIVLMGTAFAQGLASTNNQPPLLIQDTTAAQR* |
| Ga0157371_109385942 | 3300013102 | Corn Rhizosphere | MIKLLLILTVGTAFAQGLASNASQPPLLIQDTAAAPLDAAH* |
| Ga0157369_101584752 | 3300013105 | Corn Rhizosphere | MIKLVLILVTATAFAQGLASASSQPPLLIQDTSGH* |
| Ga0163163_103304741 | 3300014325 | Switchgrass Rhizosphere | MVKLVLLLIMGTAFAQGIAATHQQPPLLIQDTTVA |
| Ga0182008_108158012 | 3300014497 | Rhizosphere | VIKLLLILVTGTAFAQGLASSSNQPPLLIQDTTAPLDGAH* |
| Ga0132258_118134002 | 3300015371 | Arabidopsis Rhizosphere | MVKLALILIMGTAFAQGIAAADQQPPLLIQDTTAAQR* |
| Ga0066655_109014242 | 3300018431 | Grasslands Soil | MVKLALILLFGTAFAQGLSATSSQPPLLIEDTTAAPLDGAR |
| Ga0066667_112393192 | 3300018433 | Grasslands Soil | LVLILIMGTAFAQGLAATNSQPPLLIEDTTAAPLDGGR |
| Ga0066667_120651562 | 3300018433 | Grasslands Soil | MVKLALVLLFGTAFAQGLAAANSQPPLLIEDTTAAHG |
| Ga0066662_101270162 | 3300018468 | Grasslands Soil | MLKLALLLIMGTAFAQGLAASASQPPLLIQDTTAPPLDAAG |
| Ga0066662_105079582 | 3300018468 | Grasslands Soil | MVKLVLILVMGTAFAQGLASTSSQPPLLIEDTTAAPLDAGR |
| Ga0066662_115635442 | 3300018468 | Grasslands Soil | YAAHDGAMVKLALILLMGTAFAQGLAASKQPPLLIQDTTAAPLDAAR |
| Ga0066662_125070671 | 3300018468 | Grasslands Soil | MVKLVLILLFGTAFAQGLAATASPPPLLIQDTTAPLDGAR |
| Ga0066669_104276952 | 3300018482 | Grasslands Soil | MVKLALILIMGTAFAQGLSSANSQPPLLIQDTTAPSLDGAR |
| Ga0213874_100161272 | 3300021377 | Plant Roots | MVKLALILLMGTAFAQGIAATSSQPPLLIQDTTASQR |
| Ga0182009_103776032 | 3300021445 | Soil | MVKLVLLLIMGTAFAQGIAATHQQPPLLIQDTTVAGR |
| Ga0207697_100103885 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKLALILLFGTAFAQGLAATSSQPPLLIEDTTAAHR |
| Ga0207697_100586453 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | RAHHCAMVKLALILLFGTAFAQGLASTNAQPPLLIEDTTAAHR |
| Ga0207656_100269534 | 3300025321 | Corn Rhizosphere | MVKLVLILLFGTAFAQGLAATASQPPLLIEDTTAAHR |
| Ga0207656_106667652 | 3300025321 | Corn Rhizosphere | MIKLVLILVTATAFAQGLASASSQPPLLVQDTTAH |
| Ga0207682_100212202 | 3300025893 | Miscanthus Rhizosphere | MIKLLLILTMGTAFAQGLASNASQPPLLIQDTTAAPLDAAH |
| Ga0207682_100511962 | 3300025893 | Miscanthus Rhizosphere | MVKLALILFFGTAFAQGLAATNTQPPLLIEDTTAAYR |
| Ga0207682_100952412 | 3300025893 | Miscanthus Rhizosphere | MIKLLLILTMGTAFAQELASNASQPPMLIQDTTAPLDAAH |
| Ga0207642_101068022 | 3300025899 | Miscanthus Rhizosphere | MVKLALILFFGTAFAQGLAATSSQPPLLIEDTTAAYR |
| Ga0207642_107343842 | 3300025899 | Miscanthus Rhizosphere | MVKLVLILIMGAFAQGLAATSSQPPLLIEDTTAAHR |
| Ga0207688_101847103 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKLALILFFGTAFAQGLAATSSQPPLLIEDTTAAHR |
| Ga0207688_109265761 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MVKLALILLFGTAFAQGLASTNAQPPLLIEDTTAAHR |
| Ga0207680_105621482 | 3300025903 | Switchgrass Rhizosphere | MVKLALILILGAFAQGFAANSGQPPMLIQDTTAPLDGAR |
| Ga0207647_101581772 | 3300025904 | Corn Rhizosphere | MVKLALIVLMGTAFAQGLASTNNQPPLLIQDTTAAQR |
| Ga0207645_100859994 | 3300025907 | Miscanthus Rhizosphere | MVKLALILFFGTAFAQGLAATNTQPPLLIEDTTAAHR |
| Ga0207645_103637662 | 3300025907 | Miscanthus Rhizosphere | MVKLAIILLFGTAFAQGFASTHKQPPLLIQDTTAAQR |
| Ga0207695_106888081 | 3300025913 | Corn Rhizosphere | RAHQCAMVKLVLLLIMGTAFAQGIAATHQQPPLLIQDTTVAGR |
| Ga0207694_110447432 | 3300025924 | Corn Rhizosphere | MIKLVLILVAATAFAQGLASASSQPPLLIQDTTAH |
| Ga0207659_102805642 | 3300025926 | Miscanthus Rhizosphere | MVKLVLILLMGSAFAQGLASTNAQPPLLIEDTTAAHR |
| Ga0207644_1000123614 | 3300025931 | Switchgrass Rhizosphere | MVKLALILIIGAFAQGLAATSSQRPMLIQDTTAPLDGAR |
| Ga0207644_100045637 | 3300025931 | Switchgrass Rhizosphere | MIKLLLILTVGTAFAQGLASNASQRPLLIQDTTAPLDAAH |
| Ga0207644_109600721 | 3300025931 | Switchgrass Rhizosphere | MVKLALILVLGAFAQGFAANSGQPPMLIQDTTAPLDGAR |
| Ga0207690_115605632 | 3300025932 | Corn Rhizosphere | MVKLALILIMGTAFAQGISATSSQPPLLIQDTTASQR |
| Ga0207669_103737382 | 3300025937 | Miscanthus Rhizosphere | MVKLALILILGAFAQGLAATSSQPPMLIQDTTAPLDDAR |
| Ga0207667_109237262 | 3300025949 | Corn Rhizosphere | MVKLALILLFGTAFAQGLAATSSQHPLLIEDTTAAHR |
| Ga0207658_104976512 | 3300025986 | Switchgrass Rhizosphere | HHGAMVKLALILLFGTAFAQGLAATSSQPPLLIEDTTAAHR |
| Ga0207648_119861882 | 3300026089 | Miscanthus Rhizosphere | MIKLLLILTMGTAFAQGLASNASQRPLLIQDTTAPLDAAH |
| Ga0209647_10539974 | 3300026319 | Grasslands Soil | MVKLALILLFGTAFAQGFAATASPPPLLIQDTTAAPLDGAR |
| Ga0209059_10097092 | 3300026527 | Soil | MVKLALILLFGTAFAQGLSAAGNQPPLLIQDTTAAPLDGAH |
| Ga0207983_10043312 | 3300027310 | Soil | MVKLALILILGAFAQGFAATSSQPPMLIQDTTAPLDGAR |
| Ga0268266_121946692 | 3300028379 | Switchgrass Rhizosphere | CAMVKLALILILGAFAQGFAANSGQPPMLIQDTTAPLDGAR |
| Ga0268264_101129775 | 3300028381 | Switchgrass Rhizosphere | HHCAMVKLALILLFGTAFAQGLASTNAQPPLLIEDTTAAHR |
| Ga0310813_102625862 | 3300031716 | Soil | MVKLALILIMGTAFAQGIAATNQQPPLLIQDTTAVQR |
| Ga0307406_108665512 | 3300031901 | Rhizosphere | MAKLLLILLLGGAFADGLASTKERPPLLIEDTTAAALDAAG |
| Ga0308175_1013810602 | 3300031938 | Soil | MVKLLLILLMGTAFAQGLEATSRQPPLLIQDTTAAPR |
| Ga0308175_1014485652 | 3300031938 | Soil | MVKLVLILLFGTAFAQGLSAADSQPPLLIQDTTAAPLDGGR |
| Ga0308175_1018370472 | 3300031938 | Soil | KLALILLFGTAFAQGLSSANDPPPLLIQDTTAAPLDGGR |
| Ga0308174_105935352 | 3300031939 | Soil | MVKLVLILLFGTAFAQGLSSANNQPPLLIQDTTAAPLDGGR |
| Ga0308174_108872052 | 3300031939 | Soil | MVKLALILLFGTAFAQGLSSANDPPPLLIQDTTAAPLDGGR |
| Ga0307409_1003054782 | 3300031995 | Rhizosphere | MAKLLLILLLGGAFADGLASTKEQPPLLIEDTTAAALDAAG |
| Ga0308176_117702192 | 3300031996 | Soil | MVKLVLILLMGTAFAQELSSSTPPPLLIQDTTTPLDGAH |
| Ga0308176_126686342 | 3300031996 | Soil | MVKLVLILLFGTAFAQGLSSANNPPPLLIQDTTAAPLDGGR |
| ⦗Top⦘ |