Metagenome / Metatranscriptome Family F067714

Overview

Basic Information

• Family ID: F067714
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 125
• Average Sequence Length: 39 residues
• Representative Sequence: MVKLALILLFGTAFAQGLAATSSQPPLLIEDTTAAHR
• Number of Associated Samples: 87
• Number of Associated Scaffolds: 125

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Bacteria
• % of genes with valid RBS motifs: 15.20 %
• % of genes near scaffold ends (potentially truncated): 14.40 %
• % of genes from short scaffolds (< 2000 bps): 80.00 %
• Associated GOLD sequencing projects: 79
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.38

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Bacteria (95.200 % of family members)
• NCBI Taxonomy ID: 2
• Taxonomy: All Organisms → cellular organisms → Bacteria

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere (11.200 % of family members)
• Environment Ontology (ENVO): Unclassified (47.200 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant rhizosphere (52.800 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: Yes
• Secondary Structure distribution:
  α-helix: 32.31%
  β-sheet: 0.00%
  Coil/Unstructured: 67.69%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 125 Family Scaffolds
PF00892	EamA	41.60
PF04551	GcpE	37.60
PF07077	DUF1345	4.00
PF00893	Multi_Drug_Res	2.40
PF00106	adh_short	1.60
PF08937	DUF1863	0.80
PF01145	Band_7	0.80
PF07715	Plug	0.80
PF13536	EmrE	0.80
PF01425	Amidase	0.80
PF13469	Sulfotransfer_3	0.80
PF03061	4HBT	0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 125 Family Scaffolds
COG0821	4-hydroxy-3-methylbut-2-enyl diphosphate synthase IspG/GcpE	Lipid transport and metabolism [I]	37.60
COG4291	Uncharacterized membrane protein	Function unknown [S]	4.00
COG2076	Multidrug transporter EmrE and related cation transporters	Defense mechanisms [V]	2.40
COG0154	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase	Translation, ribosomal structure and biogenesis [J]	0.80

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	95.20 %
Unclassified	root	N/A	4.80 %

Level 2

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	95.20 %
Unclassified	root	N/A	4.80 %

Level 3

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	95.20 %
Unclassified	root	N/A	4.80 %

Level 4

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	94.40 %
Unclassified	root	N/A	4.80 %

Level 5

Name	Rank	Taxonomy	Distribution
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	94.40 %
Unclassified	root	N/A	4.80 %

Level 6

Name	Rank	Taxonomy	Distribution
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	89.60 %
Caulobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales	4.80 %
Unclassified	root	N/A	4.80 %

Level 7

Name	Rank	Taxonomy	Distribution
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	89.60 %
unclassified Caulobacterales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales	4.80 %
Unclassified	root	N/A	4.80 %

Level 8

Name	Rank	Taxonomy	Distribution
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	84.00 %
Caulobacterales bacterium 32-67-6	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	4.80 %
Unclassified	root	N/A	4.80 %

Level 9

Name	Rank	Taxonomy	Distribution
unclassified Sphingomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas	26.40 %
Sphingomonas segetis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	20.00 %
Caulobacterales bacterium 32-67-6	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	4.80 %
Unclassified	root	N/A	4.80 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → environmental samples	0.80 %

Level 10

Name	Rank	Taxonomy	Distribution
Sphingomonas segetis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	20.00 %
Sphingomonas sp. URHD0057	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	9.60 %
Sphingomonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	8.80 %
Sphingomonas sp. URHD0007	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	8.00 %
Caulobacterales bacterium 32-67-6	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	4.80 %
Unclassified	root	N/A	4.80 %
uncultured Sphingomonas sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → environmental samples → uncultured Sphingomonas sp.	0.80 %

Associated Scaffolds

Scaffold	Taxonomy	Length
2162886012|MBSR1b_contig_7400864	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	983
3300001205|C688J13580_1022151	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	773
3300001991|JGI24743J22301_10006287	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	2018
3300001991|JGI24743J22301_10026661	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1125
3300002075|JGI24738J21930_10058629	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	789
3300002568|C688J35102_120075266	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	869
3300002568|C688J35102_120963181	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	3319
3300003324|soilH2_10115656	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	1094
3300004153|Ga0063455_100146359	Not Available	1076
3300004479|Ga0062595_102289466	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	532
3300005093|Ga0062594_100034832	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	2371
3300005163|Ga0066823_10001905	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2465
3300005175|Ga0066673_10722628	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	573
3300005179|Ga0066684_10148471	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1485
3300005184|Ga0066671_10754673	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	625
3300005184|Ga0066671_10893877	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	563
3300005329|Ga0070683_101187562	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	733
3300005355|Ga0070671_100001037	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	20449
3300005356|Ga0070674_100151600	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1750
3300005434|Ga0070709_10075284	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	2189
3300005454|Ga0066687_10321658	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	881
3300005456|Ga0070678_100652976	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	944
3300005543|Ga0070672_100002691	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	11370
3300005543|Ga0070672_100098993	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2362
3300005543|Ga0070672_100124307	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	2115
3300005543|Ga0070672_100126623	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2096
3300005543|Ga0070672_100336231	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	1285
3300005543|Ga0070672_101172639	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	684
3300005548|Ga0070665_100006014	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	12406
3300005548|Ga0070665_101211372	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	766
3300005560|Ga0066670_10219848	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1146
3300005563|Ga0068855_100691030	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	1093
3300005563|Ga0068855_101535153	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	683
3300005564|Ga0070664_100649980	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	980
3300005575|Ga0066702_10358215	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	887
3300005575|Ga0066702_10548433	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	699
3300005575|Ga0066702_10714748	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	597
3300005578|Ga0068854_100817336	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	813
3300005616|Ga0068852_101999411	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	602
3300005616|Ga0068852_102121963	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	584
3300005985|Ga0081539_10008112	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	9275
3300006574|Ga0074056_11390514	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	549
3300006581|Ga0074048_12883034	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	675
3300006605|Ga0074057_10975193	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	550
3300006800|Ga0066660_10065670	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2439
3300006806|Ga0079220_10869427	Not Available	694
3300006881|Ga0068865_101159362	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	683
3300006954|Ga0079219_10735342	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	759
3300006954|Ga0079219_10849340	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	728
3300009098|Ga0105245_10197928	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1928
3300009137|Ga0066709_102612204	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	676
3300009148|Ga0105243_10631520	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1035
3300009177|Ga0105248_10130775	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	2832
3300009177|Ga0105248_10411521	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1523
3300009551|Ga0105238_10861581	Not Available	923
3300012202|Ga0137363_10579707	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	946
3300012957|Ga0164303_11145239	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	565
3300012958|Ga0164299_10043684	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2047
3300012958|Ga0164299_10064596	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1770
3300012958|Ga0164299_10353957	Not Available	925
3300012958|Ga0164299_10900503	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	642
3300012960|Ga0164301_10436707	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	927
3300012960|Ga0164301_10694606	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	765
3300012960|Ga0164301_11634688	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	536
3300012961|Ga0164302_10634207	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	780
3300012986|Ga0164304_11209433	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	611
3300012987|Ga0164307_10285695	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1169
3300012987|Ga0164307_11763398	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	525
3300013100|Ga0157373_10104311	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1994
3300013102|Ga0157371_10938594	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	657
3300013105|Ga0157369_10158475	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2390
3300014325|Ga0163163_10330474	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	1579
3300014497|Ga0182008_10815801	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	543
3300015371|Ga0132258_11813400	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1537
3300018431|Ga0066655_10901424	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	605
3300018433|Ga0066667_11239319	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	650
3300018433|Ga0066667_12065156	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	526
3300018468|Ga0066662_10127016	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1875
3300018468|Ga0066662_10507958	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	1100
3300018468|Ga0066662_11563544	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	687
3300018468|Ga0066662_12507067	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	544
3300018482|Ga0066669_10427695	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	1130
3300021377|Ga0213874_10016127	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	1983
3300021445|Ga0182009_10377603	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	729
3300025315|Ga0207697_10010388	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	3981
3300025315|Ga0207697_10058645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	1599
3300025321|Ga0207656_10026953	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	2347
3300025321|Ga0207656_10666765	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp.	532
3300025893|Ga0207682_10021220	All Organisms → cellular organisms → Bacteria	2554
3300025893|Ga0207682_10051196	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1710
3300025893|Ga0207682_10095241	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	1296
3300025899|Ga0207642_10106802	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1417
3300025899|Ga0207642_10734384	Not Available	624
3300025901|Ga0207688_10184710	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1245
3300025901|Ga0207688_10926576	Not Available	551
3300025903|Ga0207680_10562148	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	815
3300025904|Ga0207647_10158177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1322
3300025907|Ga0207645_10085999	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2019
3300025907|Ga0207645_10363766	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	969
3300025913|Ga0207695_10688808	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	903
3300025924|Ga0207694_11044743	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	691
3300025926|Ga0207659_10280564	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1362
3300025931|Ga0207644_10001236	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	16423
3300025931|Ga0207644_10004563	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	9003
3300025931|Ga0207644_10960072	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	717
3300025932|Ga0207690_11560563	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	552
3300025937|Ga0207669_10373738	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1108
3300025949|Ga0207667_10923726	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → environmental samples → uncultured Sphingomonas sp.	863
3300025986|Ga0207658_10497651	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	1085
3300026089|Ga0207648_11986188	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	543
3300026319|Ga0209647_1053997	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	2139
3300026527|Ga0209059_1009709	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	4346
3300027310|Ga0207983_1004331	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	1538
3300028379|Ga0268266_12194669	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	524
3300028381|Ga0268264_10112977	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0057	2382
3300031716|Ga0310813_10262586	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	1442
3300031901|Ga0307406_10866551	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	767
3300031938|Ga0308175_101381060	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	785
3300031938|Ga0308175_101448565	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. URHD0007	767
3300031938|Ga0308175_101837047	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	679
3300031939|Ga0308174_10593535	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	916
3300031939|Ga0308174_10887205	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas segetis	752
3300031995|Ga0307409_100305478	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	1482
3300031996|Ga0308176_11770219	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	659
3300031996|Ga0308176_12668634	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → unclassified Caulobacterales → Caulobacterales bacterium 32-67-6	532

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	52.00%
Environmental	Environmental	48.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	52.00%
Terrestrial	Environmental → Terrestrial	48.00%

Category

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	48.00%
Rhizosphere	Host-Associated → Plants → Rhizosphere	30.40%
Rhizoplane	Host-Associated → Plants → Rhizoplane	20.00%
Roots	Host-Associated → Plants → Roots	1.60%

Type

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	42.40%
Soil	Host-Associated → Plants → Rhizosphere → Soil	20.00%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	17.60%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.40%
Loam	Environmental → Terrestrial → Soil → Loam	5.60%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	1.60%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.80%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.80%
Unclassified	Host-Associated → Plants → Roots → Unclassified	0.80%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	20.00%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	17.60%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	16.00%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	16.00%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.40%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	5.60%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	4.80%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	4.00%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	1.60%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	1.60%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.80%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	0.80%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	0.80%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	11.20%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	10.40%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	8.00%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	8.00%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	8.00%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	7.20%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	5.60%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	4.80%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	4.80%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	4.00%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.20%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	2.40%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.40%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	2.40%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.60%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.60%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.60%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.60%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	0.80%
Sugarcane Root And Bulk Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil	0.80%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.80%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.80%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.80%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.80%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.80%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.80%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.80%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.80%
Plant Roots	Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots	0.80%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.80%

Associated Samples

Taxon OID	Sample Name	Habitat Type
2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated
3300001205	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental
3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Host-Associated
3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Host-Associated
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental
3300003324	Sugarcane bulk soil Sample H2	Environmental
3300004153	Grasslands soil microbial communities from Hopland, California, USA (version 2)	Environmental
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental
3300005163	Soil and rhizosphere microbial communities from Laval, Canada - mgHMB	Environmental
3300005175	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122	Environmental
3300005179	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133	Environmental
3300005184	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120	Environmental
3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Environmental
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental
3300005454	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136	Environmental
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated
3300005560	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119	Environmental
3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Host-Associated
3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Host-Associated
3300005575	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151	Environmental
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated
3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Host-Associated
3300006574	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome)	Environmental
3300006581	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)	Environmental
3300006605	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)	Environmental
3300006800	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109	Environmental
3300006806	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100	Environmental
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated
3300006954	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control	Environmental
3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Host-Associated
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental
3300012958	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG	Environmental
3300012960	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG	Environmental
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental
3300012986	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG	Environmental
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental
3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Host-Associated
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated
3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Host-Associated
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated
3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Host-Associated
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated
3300018431	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104	Environmental
3300018433	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116	Environmental
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental
3300018482	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118	Environmental
3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Host-Associated
3300021445	Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG	Environmental
3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Host-Associated
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated
3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)	Host-Associated
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated
3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)	Host-Associated
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated
3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)	Host-Associated
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated
3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)	Host-Associated
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated
3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)	Host-Associated
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated
3300026319	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)	Environmental
3300026527	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes)	Environmental
3300027310	Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes)	Environmental
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental
3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Host-Associated
3300031938	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1	Environmental
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental
3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Host-Associated
3300031996	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2	Environmental

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
MBSR1b_0507.00001910	2162886012	Miscanthus Rhizosphere	GAMVKLALILLFGTAFAQGLAATSSQPPLLIEDTTAAHR
C688J13580_10221512	3300001205	Soil	LSAQLGAVIKLALILFMGTAFAQGLAATSSEPPLLIQDTTAAPLDGAH*
JGI24743J22301_100062871	3300001991	Corn, Switchgrass And Miscanthus Rhizosphere	MVKLVLLLIMGTAFAQGIAATHQQPPLLVQDTTVAG
JGI24743J22301_100266611	3300001991	Corn, Switchgrass And Miscanthus Rhizosphere	KLALILFFGTAFAQGLAATSSQPPLLIEDTTAAHR*
JGI24738J21930_100586292	3300002075	Corn Rhizosphere	MVKLVLLLIMGTAFAQGIAATHXQPPLLXQDTTVAGR*
C688J35102_1200752662	3300002568	Soil	MVKLALILIMGAFAQGLAATSNQPPLLIQDTTAPLDAAR*
C688J35102_1209631815	3300002568	Soil	VIKLALILLMGTVFAQGLATNSQPPLLIQDTTAPLDGAH*
soilH2_101156562	3300003324	Sugarcane Root And Bulk Soil	MVKLIVILIMGSAFAQGLALTDNQPPLLIQDTTAPLDGAH*
Ga0063455_1001463591	3300004153	Soil	VIKLALILFMGTAFAQGLAATSSEPPLLIQDTTAAPLDGA
Ga0062595_1022894661	3300004479	Soil	MIKLLLILTVGTAFAQGLASNASQRPLLIQDTTAPLDAAH*
Ga0062594_1000348322	3300005093	Soil	MIKLLLILTMGTAFAQELASNASQPPMLIQDTTAPLDAAH*
Ga0066823_100019052	3300005163	Soil	MVKLALILILGAFAQGFAATSSQPPMLIQDTTAPLDGAR*
Ga0066673_107226282	3300005175	Soil	MVKLALILIMGTAFAQGLAATASQPPLLIQDTTAPSLDGAR*
Ga0066684_101484713	3300005179	Soil	MVKLALILIMGTAFAQGLSSANSQPPLLIQDTTAPSLDGAR*
Ga0066671_107546731	3300005184	Soil	MVKLAMILIMGAFAQGLAATSNQPPLLIQDTTAPLDAAR*
Ga0066671_108938772	3300005184	Soil	MVKLVLILIMGTAFAQGLAATNSQPPLLIEDTTAAPLDGGR*
Ga0070683_1011875621	3300005329	Corn Rhizosphere	AGAHQCAMIKLLLILTMGTAFAQGLASNASQPPLLIQDTTAAPLDAAH*
Ga0070671_1000010377	3300005355	Switchgrass Rhizosphere	MVKLALILIIGAFAQGLAATSSQRPMLIQDTTAPLDGAR*
Ga0070674_1001516002	3300005356	Miscanthus Rhizosphere	MVKLALILILGAFAQGLAATSSQPPMLIQDTTAPLDDAR*
Ga0070709_100752842	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	MVKLALILLFGTAFAQGLSSANNPPPLLIQDTTAAPLDGGR*
Ga0066687_103216582	3300005454	Soil	MVKLVLILIMGTAFAQGLAATSSPPPLLIQDTTAPLDGAG*
Ga0070678_1006529762	3300005456	Miscanthus Rhizosphere	MIKLLLILTMGTAFAQGLASNASQPPLLIQDTTAAPLDAAH*
Ga0070672_1000026916	3300005543	Miscanthus Rhizosphere	MVKLVLLLIMGTAFAQGIAATHQQPPLLVQDTTVAGR*
Ga0070672_1000989935	3300005543	Miscanthus Rhizosphere	CAMVKLVLILLMGSAFAQGLASTNAQPPLLIEDTTAAHR*
Ga0070672_1001243072	3300005543	Miscanthus Rhizosphere	MVKLALILLFGTAFAQGLAATSSQPPLLIEDTTAAHR*
Ga0070672_1001266232	3300005543	Miscanthus Rhizosphere	MVKLALILFFGTAFAQGLAATSSQPPLLIEDTTAAHR*
Ga0070672_1003362313	3300005543	Miscanthus Rhizosphere	MVKLVLILIMGAFAQGLAATSSQPPLLIEDTTAAHR*
Ga0070672_1011726392	3300005543	Miscanthus Rhizosphere	MVKLALILILGAFAQGFAANSGQPPMLIQDTTAPLDGAR*
Ga0070665_1000060142	3300005548	Switchgrass Rhizosphere	MVKLALILLFGTAFAQGLASTNAQPPLLIEDTTAAHR*
Ga0070665_1012113722	3300005548	Switchgrass Rhizosphere	MVKLVLLLIMGTAFAQGIAATHQQPPLLIQDTTVAGR*
Ga0066670_102198482	3300005560	Soil	MVKLALILLFGTAFAQGIAATASQPPLLIEDTTAAHR*
Ga0068855_1006910302	3300005563	Corn Rhizosphere	MVKLALILFFGTAFAQGLAATNTQPPLLIEDTTAAYR*
Ga0068855_1015351532	3300005563	Corn Rhizosphere	MVKLVLILLFGTAFAQGLAATASQPPLLIEDTTAAHR*
Ga0070664_1006499802	3300005564	Corn Rhizosphere	MVKLALILLMGTAFAQGIAATSSQPPLLIQDTTASQR*
Ga0066702_103582151	3300005575	Soil	MVKLVLILVMGTAFAQGLASTSSQPPLLIEDTTAAPLDAGR*
Ga0066702_105484332	3300005575	Soil	MVKLALILLFGTAFAQGIAATTTQPPLLIEDTTAAHR*
Ga0066702_107147482	3300005575	Soil	MVKLALILLFGTAFAQGLSAAGNQPPLLIQDTTAAPLDGAH*
Ga0068854_1008173362	3300005578	Corn Rhizosphere	MVKLALILIMGTAFAQGISATSSQPPLLIQDTTASQR*
Ga0068852_1019994112	3300005616	Corn Rhizosphere	MVKLAIILLMGSAFAHGLASTNSQPPLLIEDTTAAHR*
Ga0068852_1021219632	3300005616	Corn Rhizosphere	MVKLIVILIMGSAFAQGLALTDSQPPLLIQDTTAAPLDGAH*
Ga0081539_100081129	3300005985	Tabebuia Heterophylla Rhizosphere	MVKLVLILIMGTAFAQGLAATHSQPPLLIEDTTAAPLDDAR*
Ga0074056_113905142	3300006574	Soil	MVKLALILIMGTAFVQGLTAAASAPPLLIEDTTAAHR*
Ga0074048_128830341	3300006581	Soil	QCAMIKLLLILTVGTAFAQGLASNASQRPLLIQDTTAPLDAAH*
Ga0074057_109751931	3300006605	Soil	AHLRAMVKLALILIMGTAFVQGLTAAASAPPLLIEDTTAAHR*
Ga0066660_100656703	3300006800	Soil	MLKLALLLIMGTAFAQGLAASASQPPLLIQDTTAPPLDAAG*
Ga0079220_108694272	3300006806	Agricultural Soil	MVKLALILLMGTAFAQGLSSSSQPPLLIEDTTAAHR*
Ga0068865_1011593622	3300006881	Miscanthus Rhizosphere	MVKLVLILLMGSAFAQGLASTNAQPPLLIEDTTAAHR*
Ga0079219_107353422	3300006954	Agricultural Soil	MVKLVLILLMGTAFAQELSSSTTPPLLIQDTTAPLDGAR*
Ga0079219_108493401	3300006954	Agricultural Soil	MVKLLLILLMGSAFAQGLSNSAQPPLLIQDTTAAQR*
Ga0105245_101979283	3300009098	Miscanthus Rhizosphere	MVKLAIILLFGTAFAQGFASTHKQPPLLIQDTTAAQR*
Ga0066709_1026122042	3300009137	Grasslands Soil	MVKLALILLFGTAFAQGLAVASQPPLLIQDTTAPLDGSR*
Ga0105243_106315202	3300009148	Miscanthus Rhizosphere	MVKLALILFFGTAFAQGLAATNTQPPLLIEDTTAAHR*
Ga0105248_101307753	3300009177	Switchgrass Rhizosphere	MVKLALILVLGAFAQGFAANSGQPPMLIQDTTAPLDGAR*
Ga0105248_104115213	3300009177	Switchgrass Rhizosphere	MVKLALILIIGAFAQGLAATSSQPPMLIQDTTAPLDGAR*
Ga0105238_108615812	3300009551	Corn Rhizosphere	MIKLVLILVTATAFAQGLASASSQPPLLVQDTTAH*
Ga0137363_105797072	3300012202	Vadose Zone Soil	MVKLVLILIMGTAFAQGLAATSSPPPLLIQDTTAPLDGAR*
Ga0164303_111452391	3300012957	Soil	MVKLVLILIMGTAFAQGIAATGNQPPLLIEDTTAAQR*
Ga0164299_100436844	3300012958	Soil	VIKLALILFMGTAFAQGLASTSSEPPLLIQDTTVAPLDGAH*
Ga0164299_100645963	3300012958	Soil	MIKLLRILTVGTAFAQGLASNASQRPLLIQDTTAPLDAAH*
Ga0164299_103539571	3300012958	Soil	MVKLLLILIMGTAFAQGLSGSTQPPLLVQDTTAAPLDGAH*
Ga0164299_109005031	3300012958	Soil	MVKLALILIIGAFAHGLAAISNQPTMLIQDTTAPLDGAR*
Ga0164301_104367072	3300012960	Soil	MIKLALILIMGTSFAQGLAATTSQPPLLIQDTTAPLDGAR*
Ga0164301_106946062	3300012960	Soil	AALHRAMVKLALILLFGTAFAQGIAATSSQPPLLIQDTSAAPLDAAR*
Ga0164301_116346881	3300012960	Soil	MVKLLLILIMGTAFAQGLSGSTQPPLLIQDTTAAPLDGAH*
Ga0164302_106342072	3300012961	Soil	VIKLALILFMGTAFAQGLASTSSEPPLLIQDTTAAPLDGAH*
Ga0164304_112094332	3300012986	Soil	MIKLLLILTVGTAFAQGLASNASQPPMLIQDTTAPLDAAH*
Ga0164307_102856952	3300012987	Soil	VIKLALILFMGTAFAQGLASTSSEPPLLIQDTTAEPLDGAH*
Ga0164307_117633982	3300012987	Soil	MVKLLLILIMGTAFAQGLWGSTQPPLLIQDTTAAPLDGAH*
Ga0157373_101043112	3300013100	Corn Rhizosphere	MVKLALIVLMGTAFAQGLASTNNQPPLLIQDTTAAQR*
Ga0157371_109385942	3300013102	Corn Rhizosphere	MIKLLLILTVGTAFAQGLASNASQPPLLIQDTAAAPLDAAH*
Ga0157369_101584752	3300013105	Corn Rhizosphere	MIKLVLILVTATAFAQGLASASSQPPLLIQDTSGH*
Ga0163163_103304741	3300014325	Switchgrass Rhizosphere	MVKLVLLLIMGTAFAQGIAATHQQPPLLIQDTTVA
Ga0182008_108158012	3300014497	Rhizosphere	VIKLLLILVTGTAFAQGLASSSNQPPLLIQDTTAPLDGAH*
Ga0132258_118134002	3300015371	Arabidopsis Rhizosphere	MVKLALILIMGTAFAQGIAAADQQPPLLIQDTTAAQR*
Ga0066655_109014242	3300018431	Grasslands Soil	MVKLALILLFGTAFAQGLSATSSQPPLLIEDTTAAPLDGAR
Ga0066667_112393192	3300018433	Grasslands Soil	LVLILIMGTAFAQGLAATNSQPPLLIEDTTAAPLDGGR
Ga0066667_120651562	3300018433	Grasslands Soil	MVKLALVLLFGTAFAQGLAAANSQPPLLIEDTTAAHG
Ga0066662_101270162	3300018468	Grasslands Soil	MLKLALLLIMGTAFAQGLAASASQPPLLIQDTTAPPLDAAG
Ga0066662_105079582	3300018468	Grasslands Soil	MVKLVLILVMGTAFAQGLASTSSQPPLLIEDTTAAPLDAGR
Ga0066662_115635442	3300018468	Grasslands Soil	YAAHDGAMVKLALILLMGTAFAQGLAASKQPPLLIQDTTAAPLDAAR
Ga0066662_125070671	3300018468	Grasslands Soil	MVKLVLILLFGTAFAQGLAATASPPPLLIQDTTAPLDGAR
Ga0066669_104276952	3300018482	Grasslands Soil	MVKLALILIMGTAFAQGLSSANSQPPLLIQDTTAPSLDGAR
Ga0213874_100161272	3300021377	Plant Roots	MVKLALILLMGTAFAQGIAATSSQPPLLIQDTTASQR
Ga0182009_103776032	3300021445	Soil	MVKLVLLLIMGTAFAQGIAATHQQPPLLIQDTTVAGR
Ga0207697_100103885	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	MVKLALILLFGTAFAQGLAATSSQPPLLIEDTTAAHR
Ga0207697_100586453	3300025315	Corn, Switchgrass And Miscanthus Rhizosphere	RAHHCAMVKLALILLFGTAFAQGLASTNAQPPLLIEDTTAAHR
Ga0207656_100269534	3300025321	Corn Rhizosphere	MVKLVLILLFGTAFAQGLAATASQPPLLIEDTTAAHR
Ga0207656_106667652	3300025321	Corn Rhizosphere	MIKLVLILVTATAFAQGLASASSQPPLLVQDTTAH
Ga0207682_100212202	3300025893	Miscanthus Rhizosphere	MIKLLLILTMGTAFAQGLASNASQPPLLIQDTTAAPLDAAH
Ga0207682_100511962	3300025893	Miscanthus Rhizosphere	MVKLALILFFGTAFAQGLAATNTQPPLLIEDTTAAYR
Ga0207682_100952412	3300025893	Miscanthus Rhizosphere	MIKLLLILTMGTAFAQELASNASQPPMLIQDTTAPLDAAH
Ga0207642_101068022	3300025899	Miscanthus Rhizosphere	MVKLALILFFGTAFAQGLAATSSQPPLLIEDTTAAYR
Ga0207642_107343842	3300025899	Miscanthus Rhizosphere	MVKLVLILIMGAFAQGLAATSSQPPLLIEDTTAAHR
Ga0207688_101847103	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MVKLALILFFGTAFAQGLAATSSQPPLLIEDTTAAHR
Ga0207688_109265761	3300025901	Corn, Switchgrass And Miscanthus Rhizosphere	MVKLALILLFGTAFAQGLASTNAQPPLLIEDTTAAHR
Ga0207680_105621482	3300025903	Switchgrass Rhizosphere	MVKLALILILGAFAQGFAANSGQPPMLIQDTTAPLDGAR
Ga0207647_101581772	3300025904	Corn Rhizosphere	MVKLALIVLMGTAFAQGLASTNNQPPLLIQDTTAAQR
Ga0207645_100859994	3300025907	Miscanthus Rhizosphere	MVKLALILFFGTAFAQGLAATNTQPPLLIEDTTAAHR
Ga0207645_103637662	3300025907	Miscanthus Rhizosphere	MVKLAIILLFGTAFAQGFASTHKQPPLLIQDTTAAQR
Ga0207695_106888081	3300025913	Corn Rhizosphere	RAHQCAMVKLVLLLIMGTAFAQGIAATHQQPPLLIQDTTVAGR
Ga0207694_110447432	3300025924	Corn Rhizosphere	MIKLVLILVAATAFAQGLASASSQPPLLIQDTTAH
Ga0207659_102805642	3300025926	Miscanthus Rhizosphere	MVKLVLILLMGSAFAQGLASTNAQPPLLIEDTTAAHR
Ga0207644_1000123614	3300025931	Switchgrass Rhizosphere	MVKLALILIIGAFAQGLAATSSQRPMLIQDTTAPLDGAR
Ga0207644_100045637	3300025931	Switchgrass Rhizosphere	MIKLLLILTVGTAFAQGLASNASQRPLLIQDTTAPLDAAH
Ga0207644_109600721	3300025931	Switchgrass Rhizosphere	MVKLALILVLGAFAQGFAANSGQPPMLIQDTTAPLDGAR
Ga0207690_115605632	3300025932	Corn Rhizosphere	MVKLALILIMGTAFAQGISATSSQPPLLIQDTTASQR
Ga0207669_103737382	3300025937	Miscanthus Rhizosphere	MVKLALILILGAFAQGLAATSSQPPMLIQDTTAPLDDAR
Ga0207667_109237262	3300025949	Corn Rhizosphere	MVKLALILLFGTAFAQGLAATSSQHPLLIEDTTAAHR
Ga0207658_104976512	3300025986	Switchgrass Rhizosphere	HHGAMVKLALILLFGTAFAQGLAATSSQPPLLIEDTTAAHR
Ga0207648_119861882	3300026089	Miscanthus Rhizosphere	MIKLLLILTMGTAFAQGLASNASQRPLLIQDTTAPLDAAH
Ga0209647_10539974	3300026319	Grasslands Soil	MVKLALILLFGTAFAQGFAATASPPPLLIQDTTAAPLDGAR
Ga0209059_10097092	3300026527	Soil	MVKLALILLFGTAFAQGLSAAGNQPPLLIQDTTAAPLDGAH
Ga0207983_10043312	3300027310	Soil	MVKLALILILGAFAQGFAATSSQPPMLIQDTTAPLDGAR
Ga0268266_121946692	3300028379	Switchgrass Rhizosphere	CAMVKLALILILGAFAQGFAANSGQPPMLIQDTTAPLDGAR
Ga0268264_101129775	3300028381	Switchgrass Rhizosphere	HHCAMVKLALILLFGTAFAQGLASTNAQPPLLIEDTTAAHR
Ga0310813_102625862	3300031716	Soil	MVKLALILIMGTAFAQGIAATNQQPPLLIQDTTAVQR
Ga0307406_108665512	3300031901	Rhizosphere	MAKLLLILLLGGAFADGLASTKERPPLLIEDTTAAALDAAG
Ga0308175_1013810602	3300031938	Soil	MVKLLLILLMGTAFAQGLEATSRQPPLLIQDTTAAPR
Ga0308175_1014485652	3300031938	Soil	MVKLVLILLFGTAFAQGLSAADSQPPLLIQDTTAAPLDGGR
Ga0308175_1018370472	3300031938	Soil	KLALILLFGTAFAQGLSSANDPPPLLIQDTTAAPLDGGR
Ga0308174_105935352	3300031939	Soil	MVKLVLILLFGTAFAQGLSSANNQPPLLIQDTTAAPLDGGR
Ga0308174_108872052	3300031939	Soil	MVKLALILLFGTAFAQGLSSANDPPPLLIQDTTAAPLDGGR
Ga0307409_1003054782	3300031995	Rhizosphere	MAKLLLILLLGGAFADGLASTKEQPPLLIEDTTAAALDAAG
Ga0308176_117702192	3300031996	Soil	MVKLVLILLMGTAFAQELSSSTPPPLLIQDTTTPLDGAH
Ga0308176_126686342	3300031996	Soil	MVKLVLILLFGTAFAQGLSSANNPPPLLIQDTTAAPLDGGR