| Basic Information | |
|---|---|
| Family ID | F067708 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MSPFSESAFHDRDEGPSFLSRVLLSVVLLTAGIGFAVFVAAV |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 14.40 % |
| % of genes near scaffold ends (potentially truncated) | 32.80 % |
| % of genes from short scaffolds (< 2000 bps) | 85.60 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.400 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (17.600 % of family members) |
| Environment Ontology (ENVO) | Unclassified (54.400 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (62.400 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.29% β-sheet: 0.00% Coil/Unstructured: 55.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF06983 | 3-dmu-9_3-mt | 20.00 |
| PF04024 | PspC | 14.40 |
| PF13561 | adh_short_C2 | 12.00 |
| PF09851 | SHOCT | 7.20 |
| PF03171 | 2OG-FeII_Oxy | 4.80 |
| PF00034 | Cytochrom_C | 4.00 |
| PF00596 | Aldolase_II | 4.00 |
| PF08439 | Peptidase_M3_N | 2.40 |
| PF00497 | SBP_bac_3 | 2.40 |
| PF00106 | adh_short | 1.60 |
| PF00899 | ThiF | 1.60 |
| PF12833 | HTH_18 | 0.80 |
| PF08240 | ADH_N | 0.80 |
| PF13450 | NAD_binding_8 | 0.80 |
| PF09995 | MPAB_Lcp_cat | 0.80 |
| PF05988 | DUF899 | 0.80 |
| PF00067 | p450 | 0.80 |
| PF09361 | Phasin_2 | 0.80 |
| PF02885 | Glycos_trans_3N | 0.80 |
| PF00892 | EamA | 0.80 |
| PF13556 | HTH_30 | 0.80 |
| PF02775 | TPP_enzyme_C | 0.80 |
| PF01925 | TauE | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 20.00 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 20.00 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 2.40 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 0.80 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.80 |
| COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.40 % |
| Unclassified | root | N/A | 9.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002070|JGI24750J21931_1045937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
| 3300004156|Ga0062589_101949484 | Not Available | 594 | Open in IMG/M |
| 3300005093|Ga0062594_101347273 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 720 | Open in IMG/M |
| 3300005093|Ga0062594_101880210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 634 | Open in IMG/M |
| 3300005327|Ga0070658_11400498 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 607 | Open in IMG/M |
| 3300005327|Ga0070658_11642248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
| 3300005329|Ga0070683_100172907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2051 | Open in IMG/M |
| 3300005331|Ga0070670_100004394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 11799 | Open in IMG/M |
| 3300005331|Ga0070670_100102684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2462 | Open in IMG/M |
| 3300005331|Ga0070670_100492271 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1090 | Open in IMG/M |
| 3300005335|Ga0070666_10056006 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2662 | Open in IMG/M |
| 3300005345|Ga0070692_10253932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella | 1054 | Open in IMG/M |
| 3300005345|Ga0070692_10601166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 728 | Open in IMG/M |
| 3300005347|Ga0070668_101399161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 638 | Open in IMG/M |
| 3300005353|Ga0070669_100320321 | All Organisms → cellular organisms → Bacteria | 1252 | Open in IMG/M |
| 3300005354|Ga0070675_100985290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 774 | Open in IMG/M |
| 3300005355|Ga0070671_100629413 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300005367|Ga0070667_100004997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 11107 | Open in IMG/M |
| 3300005456|Ga0070678_101413851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 650 | Open in IMG/M |
| 3300005456|Ga0070678_101616583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 609 | Open in IMG/M |
| 3300005539|Ga0068853_100203203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1803 | Open in IMG/M |
| 3300005543|Ga0070672_100405576 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300005543|Ga0070672_100597725 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 961 | Open in IMG/M |
| 3300005618|Ga0068864_100027930 | All Organisms → cellular organisms → Bacteria | 4768 | Open in IMG/M |
| 3300005719|Ga0068861_100915212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → Advenella → Advenella kashmirensis | 832 | Open in IMG/M |
| 3300005842|Ga0068858_102457100 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300005843|Ga0068860_101582373 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300006603|Ga0074064_11789117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 766 | Open in IMG/M |
| 3300006606|Ga0074062_12728217 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300009094|Ga0111539_12973078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 548 | Open in IMG/M |
| 3300009098|Ga0105245_10206313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 1889 | Open in IMG/M |
| 3300009098|Ga0105245_12636043 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300009137|Ga0066709_100697487 | All Organisms → cellular organisms → Bacteria | 1459 | Open in IMG/M |
| 3300009177|Ga0105248_10149515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2635 | Open in IMG/M |
| 3300009553|Ga0105249_11729149 | Not Available | 698 | Open in IMG/M |
| 3300010147|Ga0126319_1643872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 735 | Open in IMG/M |
| 3300010154|Ga0127503_11222084 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300010326|Ga0134065_10233287 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300010397|Ga0134124_12288541 | Not Available | 581 | Open in IMG/M |
| 3300010401|Ga0134121_12577877 | Not Available | 552 | Open in IMG/M |
| 3300010403|Ga0134123_10057919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2942 | Open in IMG/M |
| 3300012046|Ga0136634_10016554 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2492 | Open in IMG/M |
| 3300012212|Ga0150985_104279795 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012499|Ga0157350_1021904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 648 | Open in IMG/M |
| 3300012519|Ga0157352_1052578 | Not Available | 611 | Open in IMG/M |
| 3300012892|Ga0157294_10168479 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
| 3300012895|Ga0157309_10246911 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 580 | Open in IMG/M |
| 3300012904|Ga0157282_10077035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium | 883 | Open in IMG/M |
| 3300012958|Ga0164299_10612788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 746 | Open in IMG/M |
| 3300012984|Ga0164309_11890765 | Not Available | 512 | Open in IMG/M |
| 3300012985|Ga0164308_10728787 | Not Available | 857 | Open in IMG/M |
| 3300012986|Ga0164304_10583868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 831 | Open in IMG/M |
| 3300013296|Ga0157374_10355867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 1455 | Open in IMG/M |
| 3300013297|Ga0157378_12843613 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300013308|Ga0157375_10580586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1281 | Open in IMG/M |
| 3300014166|Ga0134079_10128255 | All Organisms → cellular organisms → Bacteria | 1000 | Open in IMG/M |
| 3300014326|Ga0157380_11624958 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 702 | Open in IMG/M |
| 3300014969|Ga0157376_10194896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 1860 | Open in IMG/M |
| 3300014969|Ga0157376_12406989 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300015201|Ga0173478_10788662 | Not Available | 520 | Open in IMG/M |
| 3300015371|Ga0132258_12588923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1268 | Open in IMG/M |
| 3300015374|Ga0132255_100908326 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1317 | Open in IMG/M |
| 3300017792|Ga0163161_10719546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 833 | Open in IMG/M |
| 3300017792|Ga0163161_11239761 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300018073|Ga0184624_10286478 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium | 739 | Open in IMG/M |
| 3300018083|Ga0184628_10038220 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2409 | Open in IMG/M |
| 3300018432|Ga0190275_10258833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1683 | Open in IMG/M |
| 3300018432|Ga0190275_11165531 | Not Available | 845 | Open in IMG/M |
| 3300018433|Ga0066667_11001225 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300018476|Ga0190274_10077517 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2541 | Open in IMG/M |
| 3300018476|Ga0190274_12177662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 651 | Open in IMG/M |
| 3300018476|Ga0190274_13161150 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300018481|Ga0190271_10280931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1716 | Open in IMG/M |
| 3300018481|Ga0190271_11025027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 949 | Open in IMG/M |
| 3300018920|Ga0190273_10612580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 825 | Open in IMG/M |
| 3300018920|Ga0190273_10807103 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 746 | Open in IMG/M |
| 3300022897|Ga0247764_1166779 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 670 | Open in IMG/M |
| 3300022908|Ga0247779_1125161 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
| 3300024055|Ga0247794_10081440 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 937 | Open in IMG/M |
| 3300024055|Ga0247794_10131348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 769 | Open in IMG/M |
| 3300025315|Ga0207697_10054523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella | 1657 | Open in IMG/M |
| 3300025315|Ga0207697_10088128 | All Organisms → cellular organisms → Bacteria | 1314 | Open in IMG/M |
| 3300025315|Ga0207697_10266537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 758 | Open in IMG/M |
| 3300025321|Ga0207656_10017774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2790 | Open in IMG/M |
| 3300025321|Ga0207656_10022467 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2531 | Open in IMG/M |
| 3300025321|Ga0207656_10331533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
| 3300025893|Ga0207682_10115121 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1187 | Open in IMG/M |
| 3300025893|Ga0207682_10421171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas | 632 | Open in IMG/M |
| 3300025907|Ga0207645_10363304 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → unclassified Comamonadaceae → Comamonadaceae bacterium | 970 | Open in IMG/M |
| 3300025908|Ga0207643_10061891 | Not Available | 2138 | Open in IMG/M |
| 3300025920|Ga0207649_10194191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1430 | Open in IMG/M |
| 3300025927|Ga0207687_11743618 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300025931|Ga0207644_10259839 | Not Available | 1388 | Open in IMG/M |
| 3300025931|Ga0207644_11343848 | Not Available | 600 | Open in IMG/M |
| 3300025932|Ga0207690_10431383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella | 1056 | Open in IMG/M |
| 3300025940|Ga0207691_10279877 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1435 | Open in IMG/M |
| 3300025941|Ga0207711_11884746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium PBB5 | 541 | Open in IMG/M |
| 3300025945|Ga0207679_10414082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1188 | Open in IMG/M |
| 3300025960|Ga0207651_10264160 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1414 | Open in IMG/M |
| 3300025960|Ga0207651_11503127 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300025972|Ga0207668_10271403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium | 1387 | Open in IMG/M |
| 3300026035|Ga0207703_12135199 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 536 | Open in IMG/M |
| 3300026067|Ga0207678_10059589 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3285 | Open in IMG/M |
| 3300026075|Ga0207708_10047024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3287 | Open in IMG/M |
| 3300026078|Ga0207702_10390572 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1340 | Open in IMG/M |
| 3300026089|Ga0207648_11667387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 599 | Open in IMG/M |
| 3300026121|Ga0207683_11761345 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300027821|Ga0209811_10362184 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300028587|Ga0247828_11067054 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 532 | Open in IMG/M |
| 3300028592|Ga0247822_10194978 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1511 | Open in IMG/M |
| 3300028597|Ga0247820_10472233 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300028608|Ga0247819_10871724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
| 3300028802|Ga0307503_10132159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1109 | Open in IMG/M |
| 3300028802|Ga0307503_10350621 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 757 | Open in IMG/M |
| 3300031226|Ga0307497_10146895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 975 | Open in IMG/M |
| 3300031366|Ga0307506_10023073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1573 | Open in IMG/M |
| 3300031366|Ga0307506_10114796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 902 | Open in IMG/M |
| 3300031731|Ga0307405_10424127 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1048 | Open in IMG/M |
| 3300031903|Ga0307407_10745226 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Massilia group → Massilia → unclassified Massilia → Massilia sp. LPB0304 | 741 | Open in IMG/M |
| 3300031938|Ga0308175_103201972 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031939|Ga0308174_10008953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 5666 | Open in IMG/M |
| 3300032004|Ga0307414_11356440 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
| 3300032074|Ga0308173_10082249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2453 | Open in IMG/M |
| 3300033550|Ga0247829_10364515 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 1183 | Open in IMG/M |
| 3300033550|Ga0247829_11741814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 513 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 17.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 10.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.20% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 5.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.20% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 2.40% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 2.40% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.40% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.40% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.60% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.60% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.60% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.60% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.60% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.60% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.80% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Host-Associated | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012046 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ833 (21.06) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012499 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610 | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012895 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S208-509C-2 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300022897 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L051-202B-4 | Environmental | Open in IMG/M |
| 3300022908 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5 | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24750J21931_10459372 | 3300002070 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPFSESAFHDRDEGPSFLSRVVLSVVLLTAGTSVWSS* |
| Ga0062589_1019494842 | 3300004156 | Soil | MSPFSESAFHDRDEGPSFLSRVFLSVVLLTAGIGLAVFIAAA* |
| Ga0062594_1013472732 | 3300005093 | Soil | MSPFSESAFHDRDEGPSFLSRLVLSVVLLTAGTAFAVLIAAV* |
| Ga0062594_1018802102 | 3300005093 | Soil | MSPFSESAFHDRDEGPSFLSRVLLSVVLLTAGIGFAVFIAAV* |
| Ga0070658_114004982 | 3300005327 | Corn Rhizosphere | MRPYRRRMPPFSESAFHDRDEGPSFLSRVLISIVLLTAGIGFAVFVAAAS* |
| Ga0070658_116422482 | 3300005327 | Corn Rhizosphere | FSESAFHDRDEGPSFLSRLLLSVALLTAGVGFAVFIAAV* |
| Ga0070683_1001729071 | 3300005329 | Corn Rhizosphere | RACLYRRRMSEFSESALPDRDEGPSFLSRVLLSFVLLTAGIGFAVFVAAV* |
| Ga0070670_1000043943 | 3300005331 | Switchgrass Rhizosphere | MSPFSESAFQDRDEGPTFLSRVILSVVLLTAGIGFALLIAAA* |
| Ga0070670_1001026843 | 3300005331 | Switchgrass Rhizosphere | MSRFSESAFHDRDEGPSFLSRLLLSVALLTAGVGFAVFIAAV* |
| Ga0070670_1004922711 | 3300005331 | Switchgrass Rhizosphere | MTSFSESAFQDRDEGPSFLSRVVLSVVLLTAGIGVALLIASA* |
| Ga0070666_100560063 | 3300005335 | Switchgrass Rhizosphere | MRPYRRRMPPFSESAFHDRDEGPSFLSRVLISFVLLTAGIGFAVFVAAAS* |
| Ga0070692_102539324 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | FSESAFHDRDEGPSFLSRVVLSVVLLTAGIGLAVFVAAV* |
| Ga0070692_106011661 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEFSESALPDRDEGPSFLSRVLLSFVLLTAGIGFAVFVAAV* |
| Ga0070668_1013991612 | 3300005347 | Switchgrass Rhizosphere | MSRFSESAFHDRDEGPTFLSRVLLSVVLLTAGIGFAVFIAAV* |
| Ga0070669_1003203212 | 3300005353 | Switchgrass Rhizosphere | MSRFSESAFQDRDEGPSFLSRVVLSVVLLTAGIGVALLIASA* |
| Ga0070675_1009852901 | 3300005354 | Miscanthus Rhizosphere | MRLYRRPMSRFSESAFHDRDEGPSFLSRLLLSVALLTAGVGFAVFIAAV* |
| Ga0070671_1006294132 | 3300005355 | Switchgrass Rhizosphere | MSPFSESSFHDRDEGPTFLSRVVLSVVLLTAGIGLALLVAAA* |
| Ga0070667_1000049976 | 3300005367 | Switchgrass Rhizosphere | MSPFSESAFHDRDEGPSFLSRVVLSVVLLTAGIGLAVFVAAV* |
| Ga0070678_1014138512 | 3300005456 | Miscanthus Rhizosphere | MREFSESVLPDRDEGGPTFLSRVLLSFVLLTAGIGFAVFVAAA* |
| Ga0070678_1016165832 | 3300005456 | Miscanthus Rhizosphere | MSRFSESTFHDRDEGPTFLSRVLLSVVLLTAGIGFAVFIAAV* |
| Ga0068853_1002032031 | 3300005539 | Corn Rhizosphere | MREFSESVLPDRDEGGPTFLSRVLLSFVLLTAGIGFAVFVA |
| Ga0070672_1004055762 | 3300005543 | Miscanthus Rhizosphere | MSPFSESAFQERDEGPTFLSRVILSVVLLTAGIGFALLIAAA* |
| Ga0070672_1005977252 | 3300005543 | Miscanthus Rhizosphere | MRPYRRRMSPFSESAFHDRDEGPSFLSRVLLSVVLLTAGVGFAVFVAAV* |
| Ga0068864_1000279301 | 3300005618 | Switchgrass Rhizosphere | SESAFQDRDEGPSFLSRVVLSVVLLTAGIGVALLIAAV* |
| Ga0068861_1009152122 | 3300005719 | Switchgrass Rhizosphere | MSRFSESAFQDRDEGPSFLSRVLLSVVLLTAGIGFAVFIAAV* |
| Ga0068858_1024571002 | 3300005842 | Switchgrass Rhizosphere | YRRRMSPFSESAFQDRDEGPTFLSRVILSVVLLTAGIGFALLIAAA* |
| Ga0068860_1015823732 | 3300005843 | Switchgrass Rhizosphere | RRRMSPFSESSFHDRDEGPTFLSRVVLSVVLLTAGIGLALLVAAA* |
| Ga0074064_117891172 | 3300006603 | Soil | MRAYRRRMSRFSESAFHDRDEGPTFLSRVLLSVVLLTAGIGFAVFVAAV* |
| Ga0074062_127282172 | 3300006606 | Soil | MRAYRRRMSRFSESAFHDRDEGPSFLSRVLLSGVLLTAGIGFAVFLAAV* |
| Ga0111539_129730782 | 3300009094 | Populus Rhizosphere | MPPFSESAFHDRDEGPSFLSRVLISIVLLTAGIGFAVFVAAAS* |
| Ga0105245_102063133 | 3300009098 | Miscanthus Rhizosphere | MSPFSESAFHDRDEGPSFLSRVLLSVVLLTAGIGFALFVAAV* |
| Ga0105245_126360432 | 3300009098 | Miscanthus Rhizosphere | SESAFQDRDEGPSFLSRVVLSVVLLTAGIGVALLIASA* |
| Ga0066709_1006974872 | 3300009137 | Grasslands Soil | MSPFSESAFHDRDEGPTFLSRVLLSVVLLTAGIGFAVFIAAA* |
| Ga0105248_101495152 | 3300009177 | Switchgrass Rhizosphere | MPPFSESAFHDRDEGPSFLSRVLISFVLLTAGIGFAVFVAAAS* |
| Ga0105249_117291492 | 3300009553 | Switchgrass Rhizosphere | MSPFSESAFHDRDEGPSFLSRVLLSVVLLTAGTAFAVLIAAV* |
| Ga0126319_16438722 | 3300010147 | Soil | MRAYRRRMSRFSESAFQDRDEGPTFLSRVLLSVVLLTAGIGFAVFVAAV* |
| Ga0127503_112220842 | 3300010154 | Soil | MSRFSESAFQDRDEGPTFLSRVLLSVVLLTAGIGFAVFVAAV* |
| Ga0134065_102332872 | 3300010326 | Grasslands Soil | MRPFSESAFHDRDEGPTFLSRVLLSFVLLTAGIGFAVFIAAA* |
| Ga0134124_122885412 | 3300010397 | Terrestrial Soil | MSSFSESAFHDRDEGPSFLSRVLISFVLLTAGIGFAVFVAAAS* |
| Ga0134121_125778772 | 3300010401 | Terrestrial Soil | FSESAFHDRDEGPSFLSRVLISFVLLTAGIGFAVFVAAAS* |
| Ga0134123_100579195 | 3300010403 | Terrestrial Soil | MSRFSESAFHDRDEGPSFLSRVVLSVVLLTAGIGLAVFVAAV* |
| Ga0136634_100165542 | 3300012046 | Polar Desert Sand | MSQFSESAFQDNGEGPSFLSRVGIAFVLFTAGIGFALFLSAA* |
| Ga0150985_1042797951 | 3300012212 | Avena Fatua Rhizosphere | MSPFSESAFHDRDEGPTFLSRVLLSFVLLTAGIGFAVFIAAA* |
| Ga0157350_10219042 | 3300012499 | Unplanted Soil | MPPFSESAFHDRDEGPSFLSRVLISFVLLTAGVGFAVFVAAAS* |
| Ga0157352_10525782 | 3300012519 | Unplanted Soil | MSSFSESAFHDRDEGPSFLSRVVLSLVLLTAGIGLA |
| Ga0157294_101684792 | 3300012892 | Soil | MSPFSESAFHDRDEGPSFLSRVFLSVVLLTAGIGFAVFVAAV* |
| Ga0157309_102469112 | 3300012895 | Soil | SESVLPDRDEGGPTFLSRVLLSFVLLTAGIGFAVFVAAV* |
| Ga0157282_100770351 | 3300012904 | Soil | MSPFSESAFHDRDEGPSFLSRVFLSVVLLTAGIGFALFVAAV* |
| Ga0164299_106127882 | 3300012958 | Soil | MSPFSESAFQDPDEGPTFLSRVVLSVVLLTAGIGLAVFVAAV* |
| Ga0164309_118907652 | 3300012984 | Soil | ESAFQDRDEGPTFLSRVLLSVVLLTAGISFAVFVAAV* |
| Ga0164308_107287872 | 3300012985 | Soil | MSPFSESAFHDRDEGPSFLSRVLLSVVLLTAGIGFAVFVAAV* |
| Ga0164304_105838681 | 3300012986 | Soil | FQDPDEGPTFLSRVVLSVVLLAAGIGLAVFVAAV* |
| Ga0157374_103558671 | 3300013296 | Miscanthus Rhizosphere | PFSESAFQERDEGPTFLSRVILSVVLLTAGIGFALLIAAA* |
| Ga0157378_128436132 | 3300013297 | Miscanthus Rhizosphere | MTSFSESAFQDRDEGPSFLSRVVLSFVLLTAGIGLAVFVAAV* |
| Ga0157375_105805862 | 3300013308 | Miscanthus Rhizosphere | MSPFSESAFQDRDEGPSFLSRVFLSVVLLTAGIGFALFVAAV* |
| Ga0134079_101282551 | 3300014166 | Grasslands Soil | PFSESAFHDRDEGPTFLSRVLLSFVLLTAGIGFAVFIAAA* |
| Ga0157380_116249582 | 3300014326 | Switchgrass Rhizosphere | MSPFSESAFQDRDEGPTFLSRVLLSVVLLTAGIGFAVFIAAV* |
| Ga0157376_101948963 | 3300014969 | Miscanthus Rhizosphere | FHDRDEGPSFLSRLVLSVVLLTAGTAFAVLIAAV* |
| Ga0157376_124069891 | 3300014969 | Miscanthus Rhizosphere | MPPFSESAFHDRDEGPSFLSRVLISFVLLTAGIGFAVFVAAA |
| Ga0173478_107886621 | 3300015201 | Soil | MSRFSESAFHDRDEGPTFLSRVLLSVVLLTAGIGFALFVAA |
| Ga0132258_125889233 | 3300015371 | Arabidopsis Rhizosphere | MSSFSESAFHDRDEGPSFLSRVVLSLVLLTAGIGLAVFVAAV* |
| Ga0132255_1009083262 | 3300015374 | Arabidopsis Rhizosphere | MSPFSESAFHDRDEGPSFLSRVLLSVVLLTAGIGFALFEAAV* |
| Ga0163161_107195461 | 3300017792 | Switchgrass Rhizosphere | MSPFSESAFHDRDEGPSFLSRVLLSVVLLTAGIGFALFVAAV |
| Ga0163161_112397612 | 3300017792 | Switchgrass Rhizosphere | MSPFSESSFHDRDEGPTFLSRVVLSVVLLTAGIGLALLVAAA |
| Ga0184624_102864781 | 3300018073 | Groundwater Sediment | ESAFHDHDEGPSFLSRVLLSVVLLTAGIGFALFVAAV |
| Ga0184628_100382203 | 3300018083 | Groundwater Sediment | MRPYRRRMSPFSESAFHDRDEGPTFLSRVVLSVVLLTAGIGLALLIAAA |
| Ga0190275_102588333 | 3300018432 | Soil | MSQSPESAFQHASEGPSFLSRLGIAVVLLTAGIGVALALASA |
| Ga0190275_111655312 | 3300018432 | Soil | MRPFSESAFQNAGEGPSFLSRLGIAVVLWTAGMGVALALAAA |
| Ga0066667_110012251 | 3300018433 | Grasslands Soil | MSPFSESAFHDRDEGPTFLSRVLLSVVLLTAGIGFAVFIAAA |
| Ga0190274_100775173 | 3300018476 | Soil | MSPFSESAFHDRDEGPSFLSRVLLSVVLLTAGIGFALLVAAV |
| Ga0190274_121776621 | 3300018476 | Soil | MSPFSESAFHDRDEGPSFLSRVVLSVVLLTAGVSLAVFVSAV |
| Ga0190274_131611502 | 3300018476 | Soil | MRPYRRRMSPFSESALQDRDEGPTFLSRVVLSVVLLTAGTAFAVLIAAV |
| Ga0190271_102809313 | 3300018481 | Soil | MRPYRRRMSRFSESTFHDHDEGPSFLSRVVLSVVLLTAGTAFAVLIAAV |
| Ga0190271_110250271 | 3300018481 | Soil | MSPFSESAFHDRDEGPSFLSRVLLSVVLLTAGIGFAVFIAAV |
| Ga0190273_106125802 | 3300018920 | Soil | MSPFSESAFQDRDEGPTFLSRVVLSVVLLTAGIGFAVLIAAV |
| Ga0190273_108071031 | 3300018920 | Soil | MSQFSESTFPDHRAEGPSFLSRVAIAFVVLTAGISLAVLVAAA |
| Ga0247764_11667792 | 3300022897 | Plant Litter | ARLYRRHMSPFSESAFHDRDEGPSFLSRLVLSVVLLTAGTAFAVLIAAV |
| Ga0247779_11251611 | 3300022908 | Plant Litter | PFSESAFHDRDEGPSFLSRVLLSVVLLTAGIGFALFVAAV |
| Ga0247794_100814402 | 3300024055 | Soil | MSEFSESALPDRDEGPSFLSRVLLSFVLLTAGIGFAVFVAAV |
| Ga0247794_101313482 | 3300024055 | Soil | MSPFSESAFHDRDEGPSFLSRLVLSVVLLTAGTAFAVLIAAV |
| Ga0207697_100545234 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPFSESAFHDRDEGPSFLSRVVLSVVLLTAGIGLAVFVAAV |
| Ga0207697_100881282 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MSRFSESAFHDRDEGPTFLSRVLLSVVLLTAGIGFAVFIAAV |
| Ga0207697_102665372 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MSPFSESAFHDRDEGPSFLSRLVLSVVLLTAGTAF |
| Ga0207656_100177743 | 3300025321 | Corn Rhizosphere | MSPFSESAFQERDEGPTFLSRVILSVVLLTAGIGFALLIAAA |
| Ga0207656_100224673 | 3300025321 | Corn Rhizosphere | MSRFSESAFHDRDEGPSFLSRLLLSVALLTAGVGFAVFIAAV |
| Ga0207656_103315332 | 3300025321 | Corn Rhizosphere | MRPYRRRMPPFSESAFHDRDEGPSFLSRVLISFVLLTAGIGFAVFVAAAS |
| Ga0207682_101151212 | 3300025893 | Miscanthus Rhizosphere | MRPYRRRMPPFSESAFHDRDEGPSFLSRVLISIVLLTAGIGFAVFVAAAS |
| Ga0207682_104211713 | 3300025893 | Miscanthus Rhizosphere | SPFSESAFQERDEGPTFLSRVILSVVLLTAGIGFALLIAAA |
| Ga0207645_103633041 | 3300025907 | Miscanthus Rhizosphere | SAFHDRDEGPTFLSRVILSVVLLTAGIGFALLIAAA |
| Ga0207643_100618911 | 3300025908 | Miscanthus Rhizosphere | MSPFSESAFQDRDEGPTFLSRVILSVVLLTAGIGFALLIAAA |
| Ga0207649_101941913 | 3300025920 | Corn Rhizosphere | MREFSESVLPDRDEGGPTFLSRVLLSFVLLTAGIGFAVFVAAA |
| Ga0207687_117436181 | 3300025927 | Miscanthus Rhizosphere | ESAFQDRDEGPSFLSRVVLSVVLLTAGIGVALLIASA |
| Ga0207644_102598391 | 3300025931 | Switchgrass Rhizosphere | MSPFSESAFQDRDEGPTFLSRVILSVVLLTAVIGFALLIAAA |
| Ga0207644_113438482 | 3300025931 | Switchgrass Rhizosphere | MSPFSESAFHDRDEGPSFLSRVVLSVVLLTAGIGLAVFVA |
| Ga0207690_104313832 | 3300025932 | Corn Rhizosphere | MSRFSESAFHDRDEGPSFLSRVVLSVVLLTAGIGLAVFVAAV |
| Ga0207691_102798772 | 3300025940 | Miscanthus Rhizosphere | MRPYRRRMSPFSESAFHDRDEGPSFLSRVLLSVVLLTAGVGFAVFVAAV |
| Ga0207711_118847462 | 3300025941 | Switchgrass Rhizosphere | MSSFSESAFHDRDEGPSFLSRVVLSLVLLTAGIGLAVFVAAV |
| Ga0207679_104140822 | 3300025945 | Corn Rhizosphere | MSEFSESALPDHDEGPTFLSRVLLSFVLLTAGVGFAVFVAAV |
| Ga0207651_102641603 | 3300025960 | Switchgrass Rhizosphere | MSRFSESAFHDRDEGPSFLSRLLLSVALLTAGVGFAV |
| Ga0207651_115031272 | 3300025960 | Switchgrass Rhizosphere | MRPYRRRMPPFSESAFHDRDEGPSFLSRVLISFVLLTAGI |
| Ga0207668_102714031 | 3300025972 | Switchgrass Rhizosphere | SPFSESAFHDRDEGPSFLSRVLLSVVLLTAGIGFALFVAAV |
| Ga0207703_121351991 | 3300026035 | Switchgrass Rhizosphere | GGPRPYRRRMSPFSESAFQDRDEGPTFLSRVILSVVLLTAGIGFALLIAAA |
| Ga0207678_100595891 | 3300026067 | Corn Rhizosphere | FSESAFHDRDEGPSFLSRVLLSVVLLTAGIGFALFVAAV |
| Ga0207708_100470241 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | SRFSESAFHDRDEGPSFLSRLLLSVALLTAGVGFAVFIAAV |
| Ga0207702_103905722 | 3300026078 | Corn Rhizosphere | MNPFSESAFQARAEGPSFLARVGIAFVVLTAGIGVALLMAAA |
| Ga0207648_116673871 | 3300026089 | Miscanthus Rhizosphere | MSRFSESAFHDRDEGPTFLSRVLLSVVLLTAGIGFAVFIAAL |
| Ga0207683_117613452 | 3300026121 | Miscanthus Rhizosphere | MRPYRRRMPPFSESAFHDRDEGPSFLSRVLISFVL |
| Ga0209811_103621842 | 3300027821 | Surface Soil | HMSRFSESAFQDRDEGPTFLSRVLLSVVLLTAGIGFAVFVAAV |
| Ga0247828_110670541 | 3300028587 | Soil | MSQFPESAFHDRDEGPSFLSRVAITFVLLTAGIGLAVLVAAAQ |
| Ga0247822_101949783 | 3300028592 | Soil | MRPYRRRMSPFSESAFHDRDEGPSFLSRVFLSVVLLTAGIGLAVFIAAA |
| Ga0247820_104722331 | 3300028597 | Soil | MSPFSESAFHDRDEGPSFLSRVLLSVVLLTAGIGFALFVAA |
| Ga0247819_108717242 | 3300028608 | Soil | YRRHMSPFSESAFHDRDEGPSFLSRVLLSVVLLTAGIGFALFVAAV |
| Ga0307503_101321592 | 3300028802 | Soil | MSPFSESAFHDRDEGPSFLSRVVLSVVLLTAGTAFAVLIAAV |
| Ga0307503_103506211 | 3300028802 | Soil | RLYRRRMSPFSESAFHDRDEGPSFLSRVVLSVVLLTAGIGLALFMAAA |
| Ga0307497_101468952 | 3300031226 | Soil | MRAYRRRMSRFSESAFHDPDEGPTFLSRVLLSVVLLTAGISFAVFVAAV |
| Ga0307506_100230732 | 3300031366 | Soil | MRRYRRRMSPFSESAFHDRDEGPSFLSRVLLSVVLLTAGIGFAVFVAAV |
| Ga0307506_101147962 | 3300031366 | Soil | MSPFSESSFHDRDEGPTFLSRVVLSVVLLTAGIGLALFMAAA |
| Ga0307405_104241272 | 3300031731 | Rhizosphere | MSPFSESAYQDAGEGPSFLSRLGIAIVLLSAGIGVALALASAA |
| Ga0307407_107452261 | 3300031903 | Rhizosphere | PFSESAFQDAGEGPSFLSRLGIAVVLLTAGIGVALALAAAA |
| Ga0308175_1032019722 | 3300031938 | Soil | MSEFSESALPDRDEGPSFLSRVLLSFVLLTAGIGFAVFVAAE |
| Ga0308174_100089533 | 3300031939 | Soil | MPPFSESAFHDRDEGPTFLSRVLLSFVLLTAGIGFAVFIAAA |
| Ga0307414_113564402 | 3300032004 | Rhizosphere | MSPFSESAFQDAGEGPSFLSRLGIAVVLLTAGIGVALALAAAA |
| Ga0308173_100822493 | 3300032074 | Soil | MSPFSESAFHDGDEGPTFLSRVILSVVLLTAGIGFAVFIAAA |
| Ga0247829_103645151 | 3300033550 | Soil | MRPYRRRMSPFSESAFHDRDEGPSFLSRVFLSVVLLTAGIGLAV |
| Ga0247829_117418142 | 3300033550 | Soil | MSRFSESAFQDRDEGPSFLSRVLLSVVLLTAGIGFAVFIAAV |
| ⦗Top⦘ |