| Basic Information | |
|---|---|
| Family ID | F067646 |
| Family Type | Metagenome |
| Number of Sequences | 125 |
| Average Sequence Length | 35 residues |
| Representative Sequence | MIEWILYFIAGIFGLVAIGGIISVIAAIYILNELD |
| Number of Associated Samples | 83 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 90.40 % |
| % of genes near scaffold ends (potentially truncated) | 11.20 % |
| % of genes from short scaffolds (< 2000 bps) | 68.80 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (63.200 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (20.800 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.600 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (88.800 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.38% β-sheet: 0.00% Coil/Unstructured: 47.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF12684 | DUF3799 | 25.60 |
| PF05063 | MT-A70 | 4.80 |
| PF13481 | AAA_25 | 4.00 |
| PF11753 | DUF3310 | 1.60 |
| PF00145 | DNA_methylase | 1.60 |
| PF13884 | Peptidase_S74 | 1.60 |
| PF13662 | Toprim_4 | 0.80 |
| PF07508 | Recombinase | 0.80 |
| PF13155 | Toprim_2 | 0.80 |
| PF05869 | Dam | 0.80 |
| PF06199 | Phage_tail_2 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG4725 | N6-adenosine-specific RNA methylase IME4 | Translation, ribosomal structure and biogenesis [J] | 9.60 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.60 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 63.20 % |
| All Organisms | root | All Organisms | 36.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000116|DelMOSpr2010_c10029116 | Not Available | 2600 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10215650 | Not Available | 605 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10276135 | Not Available | 501 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10014024 | All Organisms → Viruses → Predicted Viral | 4413 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10113672 | Not Available | 962 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10221862 | Not Available | 568 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10230216 | Not Available | 552 | Open in IMG/M |
| 3300000949|BBAY94_10190487 | Not Available | 553 | Open in IMG/M |
| 3300000973|BBAY93_10114137 | Not Available | 685 | Open in IMG/M |
| 3300001748|JGI11772J19994_1003847 | All Organisms → Viruses → Predicted Viral | 2949 | Open in IMG/M |
| 3300001822|ACM39_110364 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales | 1304 | Open in IMG/M |
| 3300001827|ACM21_1003207 | Not Available | 1475 | Open in IMG/M |
| 3300005512|Ga0074648_1003083 | Not Available | 14415 | Open in IMG/M |
| 3300005837|Ga0078893_10158711 | All Organisms → Viruses → Predicted Viral | 2357 | Open in IMG/M |
| 3300006025|Ga0075474_10010710 | All Organisms → Viruses → Predicted Viral | 3494 | Open in IMG/M |
| 3300006025|Ga0075474_10014344 | Not Available | 2963 | Open in IMG/M |
| 3300006735|Ga0098038_1000857 | All Organisms → cellular organisms → Bacteria | 13300 | Open in IMG/M |
| 3300006752|Ga0098048_1026309 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1915 | Open in IMG/M |
| 3300006752|Ga0098048_1161339 | Not Available | 667 | Open in IMG/M |
| 3300006789|Ga0098054_1019869 | All Organisms → Viruses → Predicted Viral | 2680 | Open in IMG/M |
| 3300006789|Ga0098054_1118405 | Not Available | 986 | Open in IMG/M |
| 3300006789|Ga0098054_1289079 | Not Available | 587 | Open in IMG/M |
| 3300006790|Ga0098074_1145921 | Not Available | 608 | Open in IMG/M |
| 3300006793|Ga0098055_1404006 | Not Available | 505 | Open in IMG/M |
| 3300006802|Ga0070749_10076674 | Not Available | 2000 | Open in IMG/M |
| 3300006802|Ga0070749_10120966 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1538 | Open in IMG/M |
| 3300006802|Ga0070749_10558984 | Not Available | 620 | Open in IMG/M |
| 3300006802|Ga0070749_10609944 | Not Available | 588 | Open in IMG/M |
| 3300006810|Ga0070754_10041597 | All Organisms → cellular organisms → Bacteria | 2486 | Open in IMG/M |
| 3300006810|Ga0070754_10243082 | Not Available | 824 | Open in IMG/M |
| 3300006810|Ga0070754_10306843 | Not Available | 711 | Open in IMG/M |
| 3300006874|Ga0075475_10048394 | Not Available | 2007 | Open in IMG/M |
| 3300006919|Ga0070746_10267538 | Not Available | 793 | Open in IMG/M |
| 3300006925|Ga0098050_1017565 | Not Available | 2019 | Open in IMG/M |
| 3300007539|Ga0099849_1008167 | All Organisms → Viruses → Predicted Viral | 4722 | Open in IMG/M |
| 3300007539|Ga0099849_1096687 | Not Available | 1180 | Open in IMG/M |
| 3300007540|Ga0099847_1079630 | Not Available | 1009 | Open in IMG/M |
| 3300007558|Ga0102822_1023929 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1469 | Open in IMG/M |
| 3300008012|Ga0075480_10054133 | All Organisms → cellular organisms → Bacteria | 2344 | Open in IMG/M |
| 3300008050|Ga0098052_1041346 | Not Available | 2034 | Open in IMG/M |
| 3300009001|Ga0102963_1054290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1655 | Open in IMG/M |
| 3300009001|Ga0102963_1083683 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1305 | Open in IMG/M |
| 3300009086|Ga0102812_10237210 | Not Available | 993 | Open in IMG/M |
| 3300009086|Ga0102812_10807933 | Not Available | 520 | Open in IMG/M |
| 3300009124|Ga0118687_10032047 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1732 | Open in IMG/M |
| 3300009149|Ga0114918_10179566 | Not Available | 1243 | Open in IMG/M |
| 3300009149|Ga0114918_10327660 | Not Available | 850 | Open in IMG/M |
| 3300010149|Ga0098049_1176137 | Not Available | 658 | Open in IMG/M |
| 3300010149|Ga0098049_1196095 | Not Available | 619 | Open in IMG/M |
| 3300010149|Ga0098049_1281763 | Not Available | 503 | Open in IMG/M |
| 3300010150|Ga0098056_1074434 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1165 | Open in IMG/M |
| 3300010153|Ga0098059_1190918 | Not Available | 800 | Open in IMG/M |
| 3300010299|Ga0129342_1329019 | Not Available | 522 | Open in IMG/M |
| 3300010300|Ga0129351_1040214 | All Organisms → cellular organisms → Bacteria | 1926 | Open in IMG/M |
| 3300010316|Ga0136655_1165052 | Not Available | 660 | Open in IMG/M |
| 3300010316|Ga0136655_1220069 | Not Available | 565 | Open in IMG/M |
| 3300010368|Ga0129324_10307634 | Not Available | 622 | Open in IMG/M |
| 3300010368|Ga0129324_10374413 | Not Available | 552 | Open in IMG/M |
| 3300011127|Ga0151665_1020253 | Not Available | 1434 | Open in IMG/M |
| 3300017708|Ga0181369_1013861 | All Organisms → Viruses → Predicted Viral | 2026 | Open in IMG/M |
| 3300017726|Ga0181381_1079660 | Not Available | 701 | Open in IMG/M |
| 3300017727|Ga0181401_1006622 | Not Available | 3894 | Open in IMG/M |
| 3300017743|Ga0181402_1030004 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1519 | Open in IMG/M |
| 3300017749|Ga0181392_1005002 | All Organisms → cellular organisms → Bacteria | 4576 | Open in IMG/M |
| 3300017755|Ga0181411_1210427 | Not Available | 544 | Open in IMG/M |
| 3300017763|Ga0181410_1166994 | Not Available | 613 | Open in IMG/M |
| 3300017782|Ga0181380_1056832 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1392 | Open in IMG/M |
| 3300017782|Ga0181380_1253533 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 583 | Open in IMG/M |
| 3300017783|Ga0181379_1057030 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1484 | Open in IMG/M |
| 3300017824|Ga0181552_10003990 | All Organisms → cellular organisms → Bacteria | 10406 | Open in IMG/M |
| 3300017950|Ga0181607_10001692 | Not Available | 19681 | Open in IMG/M |
| 3300017971|Ga0180438_10375453 | Not Available | 1081 | Open in IMG/M |
| 3300018424|Ga0181591_10357047 | Not Available | 1099 | Open in IMG/M |
| 3300019751|Ga0194029_1031270 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 842 | Open in IMG/M |
| 3300020055|Ga0181575_10313586 | Not Available | 886 | Open in IMG/M |
| 3300020185|Ga0206131_10192094 | Not Available | 1013 | Open in IMG/M |
| 3300021185|Ga0206682_10044309 | Not Available | 2486 | Open in IMG/M |
| 3300021335|Ga0213867_1017262 | Not Available | 2983 | Open in IMG/M |
| 3300021356|Ga0213858_10000331 | Not Available | 22984 | Open in IMG/M |
| 3300021368|Ga0213860_10463275 | Not Available | 545 | Open in IMG/M |
| 3300021371|Ga0213863_10079399 | All Organisms → Viruses → Predicted Viral | 1614 | Open in IMG/M |
| 3300021373|Ga0213865_10005815 | Not Available | 7248 | Open in IMG/M |
| 3300021373|Ga0213865_10189655 | All Organisms → Viruses → Predicted Viral | 1024 | Open in IMG/M |
| 3300021373|Ga0213865_10365916 | Not Available | 650 | Open in IMG/M |
| 3300021373|Ga0213865_10469059 | Not Available | 543 | Open in IMG/M |
| 3300021375|Ga0213869_10021452 | All Organisms → Viruses → Predicted Viral | 3645 | Open in IMG/M |
| 3300021375|Ga0213869_10194957 | Not Available | 916 | Open in IMG/M |
| 3300021379|Ga0213864_10128044 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1273 | Open in IMG/M |
| 3300021379|Ga0213864_10569106 | Not Available | 563 | Open in IMG/M |
| 3300021389|Ga0213868_10321850 | Not Available | 879 | Open in IMG/M |
| 3300021957|Ga0222717_10245610 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1042 | Open in IMG/M |
| 3300021957|Ga0222717_10690568 | Not Available | 523 | Open in IMG/M |
| 3300021958|Ga0222718_10009279 | All Organisms → cellular organisms → Bacteria | 7492 | Open in IMG/M |
| 3300021958|Ga0222718_10055864 | Not Available | 2481 | Open in IMG/M |
| 3300021960|Ga0222715_10135143 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1548 | Open in IMG/M |
| 3300021960|Ga0222715_10704061 | Not Available | 508 | Open in IMG/M |
| 3300021964|Ga0222719_10164234 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1553 | Open in IMG/M |
| 3300021964|Ga0222719_10400921 | Not Available | 853 | Open in IMG/M |
| 3300022050|Ga0196883_1000194 | Not Available | 6362 | Open in IMG/M |
| 3300022071|Ga0212028_1079058 | Not Available | 615 | Open in IMG/M |
| 3300022923|Ga0255783_10362949 | Not Available | 559 | Open in IMG/M |
| (restricted) 3300023210|Ga0233412_10128097 | All Organisms → Viruses → Predicted Viral | 1078 | Open in IMG/M |
| 3300024346|Ga0244775_10030040 | All Organisms → cellular organisms → Bacteria | 4843 | Open in IMG/M |
| 3300024346|Ga0244775_10165295 | All Organisms → cellular organisms → Bacteria → FCB group | 1864 | Open in IMG/M |
| 3300025070|Ga0208667_1000254 | Not Available | 24808 | Open in IMG/M |
| 3300025070|Ga0208667_1002148 | All Organisms → cellular organisms → Bacteria | 6614 | Open in IMG/M |
| 3300025070|Ga0208667_1003063 | All Organisms → cellular organisms → Bacteria | 5200 | Open in IMG/M |
| 3300025070|Ga0208667_1003263 | All Organisms → Viruses → Predicted Viral | 4990 | Open in IMG/M |
| 3300025070|Ga0208667_1047293 | Not Available | 707 | Open in IMG/M |
| 3300025084|Ga0208298_1006986 | All Organisms → cellular organisms → Bacteria | 3012 | Open in IMG/M |
| 3300025084|Ga0208298_1057671 | Not Available | 748 | Open in IMG/M |
| 3300025151|Ga0209645_1115102 | Not Available | 858 | Open in IMG/M |
| 3300025543|Ga0208303_1031710 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp. | 1400 | Open in IMG/M |
| 3300025543|Ga0208303_1053376 | Not Available | 973 | Open in IMG/M |
| 3300025543|Ga0208303_1073291 | Not Available | 774 | Open in IMG/M |
| 3300025671|Ga0208898_1031567 | Not Available | 2151 | Open in IMG/M |
| 3300025674|Ga0208162_1016398 | All Organisms → cellular organisms → Bacteria | 2954 | Open in IMG/M |
| 3300025674|Ga0208162_1033545 | All Organisms → cellular organisms → Bacteria | 1853 | Open in IMG/M |
| 3300025674|Ga0208162_1065972 | Not Available | 1160 | Open in IMG/M |
| 3300025759|Ga0208899_1021919 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 3171 | Open in IMG/M |
| 3300025816|Ga0209193_1162069 | Not Available | 511 | Open in IMG/M |
| 3300025840|Ga0208917_1104346 | Not Available | 1032 | Open in IMG/M |
| 3300027188|Ga0208921_1052486 | Not Available | 595 | Open in IMG/M |
| 3300027917|Ga0209536_100179870 | All Organisms → Viruses → Predicted Viral | 2662 | Open in IMG/M |
| 3300031851|Ga0315320_10525158 | Not Available | 793 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 20.80% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 19.20% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 10.40% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 7.20% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.40% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 5.60% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 4.80% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 4.00% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.20% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 1.60% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 1.60% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.60% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 1.60% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 1.60% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment | 1.60% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.60% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.80% |
| Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.80% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.80% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.80% |
| Marine Surface Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water | 0.80% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.80% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.80% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.80% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001748 | Saline surface water microbial communities from Etoliko Lagoon, Greece - surface water (0 m) | Environmental | Open in IMG/M |
| 3300001822 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM39, ROCA_DNA108_2.0um_23a | Environmental | Open in IMG/M |
| 3300001827 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM21, ROCA_DNA110_2.0um_23k | Environmental | Open in IMG/M |
| 3300005512 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_water | Environmental | Open in IMG/M |
| 3300005837 | Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18 | Environmental | Open in IMG/M |
| 3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006790 | Marine viral communities from the Gulf of Mexico - 32_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006874 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007558 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009149 | Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
| 3300011127 | Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_5, 0.02 | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017727 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019751 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MG | Environmental | Open in IMG/M |
| 3300020055 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101411CT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300021185 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300021379 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247 | Environmental | Open in IMG/M |
| 3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
| 3300022071 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2) | Environmental | Open in IMG/M |
| 3300022923 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
| 3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025759 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes) | Environmental | Open in IMG/M |
| 3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
| 3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027188 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709 (SPAdes) | Environmental | Open in IMG/M |
| 3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSpr2010_100291165 | 3300000116 | Marine | MIEWILYFIAGVFGLVAIGGLISIVAAIYILNELD* |
| DelMOSpr2010_102156504 | 3300000116 | Marine | MIEWILYFIAGIFGLVAIGGIISVIAAIYIFNELD* |
| DelMOSpr2010_102761351 | 3300000116 | Marine | MLEWILYFIAGVFGLVALGGLISIVAAIYILNELD* |
| DelMOWin2010_100140246 | 3300000117 | Marine | MLDWILYLIGAVFGLVAVGAVISVIAFIWMIKELD* |
| DelMOWin2010_101136724 | 3300000117 | Marine | MIEWILYFIAGIFGLVAIGGLISIVAAIYILXELD* |
| DelMOWin2010_102218622 | 3300000117 | Marine | MVDWILYLIAGIFGLVAIGGLISIVAAIYILNELD* |
| DelMOWin2010_102302163 | 3300000117 | Marine | MIEWILYFIAGIFGLVAIGGLISIVAAIYILNELD* |
| BBAY94_101904872 | 3300000949 | Macroalgal Surface | MLEWILYVITGIFGLVFIGALISVLAFIYMLNELD* |
| BBAY93_101141373 | 3300000973 | Macroalgal Surface | MLEWILYFIAGIFGLVFIGIILSVLAFIYVIRELD* |
| JGI11772J19994_10038472 | 3300001748 | Saline Water And Sediment | MLEWILYFIAGVFGLVFIGAIISVLAFIYIIRELD* |
| ACM39_1103642 | 3300001822 | Marine Plankton | MLDWILYFIAGIFGLVFIGAIISLIAAIYILNELD* |
| ACM21_10032074 | 3300001827 | Marine Plankton | MLDWILYFIAGIFGLVFIGAIISVIAAVYILNELD* |
| Ga0074648_100308320 | 3300005512 | Saline Water And Sediment | MLEWILYFIAAIFGLVFIGAIISVIAAIYILNELD* |
| Ga0078893_101587112 | 3300005837 | Marine Surface Water | MLEWILYFIAGVFGLIFIGIILSVLAFIYVIRELD* |
| Ga0075474_100107105 | 3300006025 | Aqueous | MLEWILYFIAGIFGLVAIGGLISIVAAIYILNELD* |
| Ga0075474_100143442 | 3300006025 | Aqueous | MIEWILYFIGAVFGLVAIGAVISVIAAIYIFNELD* |
| Ga0098038_100085718 | 3300006735 | Marine | MVDWILYIIAGIFGLVAIGGLISILAAIYILRELD* |
| Ga0098048_10263094 | 3300006752 | Marine | MLEWILYFIAGIFGLVFIGGLISVLAFIYMINELD* |
| Ga0098048_11613392 | 3300006752 | Marine | MLEWILYFIAGIFGLVFIGALISVLAFIYMLNELD* |
| Ga0098054_10198696 | 3300006789 | Marine | MLEWILYFIAGIFGLVFIGIILSVLAFIYIIRELD* |
| Ga0098054_11184053 | 3300006789 | Marine | MIDAILYFIATVFGLVFIGGVISLLAFIYIIRELD* |
| Ga0098054_12890792 | 3300006789 | Marine | MLDWILYIIAGIFGLVAIGGVISILAAISILRELD* |
| Ga0098074_11459211 | 3300006790 | Marine | MLEWILYFIAGIFGLVFIGIILSVLAFIYIIKELD* |
| Ga0098055_14040061 | 3300006793 | Marine | TMLEWILYFIAGIFGLVFIGIILSVLAFIYVIRELD* |
| Ga0070749_100766742 | 3300006802 | Aqueous | MLEWILYFIGAVFGLVFLGAIISVLAFIYIINELD* |
| Ga0070749_101209665 | 3300006802 | Aqueous | MLEWILYFIAGVFGLVFIGAIISVIAAIYILNELD* |
| Ga0070749_105589842 | 3300006802 | Aqueous | MLEWILYFIGAVFGLVFIGAIISLIAAIYILNELD* |
| Ga0070749_106099442 | 3300006802 | Aqueous | MLEWILYFIAGVFGLVAIGGLISIVAAIYILNELD* |
| Ga0070754_100415974 | 3300006810 | Aqueous | MIEWILYFIAGIFGLVAIAGIISVIAAIYILNELD* |
| Ga0070754_102430824 | 3300006810 | Aqueous | MLEWILYFIGAVFGLVFIGAIISVLAFIYIINELD* |
| Ga0070754_103068433 | 3300006810 | Aqueous | MLEWILYFIAGVFGLVFIGAIISLIAAIYILNELD* |
| Ga0075475_100483944 | 3300006874 | Aqueous | MLEWILYFIAAVFGLVAIGGIISVIAFIYIIRELD* |
| Ga0070746_102675384 | 3300006919 | Aqueous | MIEWILYFIGAVFGLVAIGAVISVIAAIYILNELD* |
| Ga0098050_10175651 | 3300006925 | Marine | RLKGLILMIDAILYFIATVFGLVFIGGVISLLAFIYIIRELD* |
| Ga0099849_10081672 | 3300007539 | Aqueous | MIEWILYFIAGTFGLVAIGGLISIVAAIYILNELD* |
| Ga0099849_10966874 | 3300007539 | Aqueous | MLEWILYFIAAVFGLVFIGAIISVIAAIYILNELD* |
| Ga0099847_10796302 | 3300007540 | Aqueous | MIEWILYFIAGIFGLVAIGGLISIVAAIYILNNLD* |
| Ga0102822_10239295 | 3300007558 | Estuarine | MIEWILYFIAGIFGLVAIGGVVSVLAAIYIFNELD* |
| Ga0075480_100541335 | 3300008012 | Aqueous | MLEWILYFIAGVFGLVAIGGIISVIAFIYIIRELD* |
| Ga0098052_10413461 | 3300008050 | Marine | GLILMIDAILYFIAAVFGLVAIGGLISILVFIYIVRELD* |
| Ga0102963_10542906 | 3300009001 | Pond Water | MIDWILYFIGAVFGLVAIGAVISVIAAIYILNELD* |
| Ga0102963_10836832 | 3300009001 | Pond Water | MIEWILYFIAGIFGLVAIGGIISVIAAIYILNELD* |
| Ga0102812_102372102 | 3300009086 | Estuarine | MIEWILYFIAGIFGLVAIGGVVSVLAAIYILKELD* |
| Ga0102812_108079332 | 3300009086 | Estuarine | MIEWILYFIAGIFGLVAIGGLISLIVFIYIVRELD* |
| Ga0118687_100320474 | 3300009124 | Sediment | MIDWILYFIAGIFGLVAIAGIISVIAAIYILNKLD* |
| Ga0114918_101795664 | 3300009149 | Deep Subsurface | MIEWILYFIAGIFGLVAIGGLISIVAAIYIFNELD* |
| Ga0114918_103276601 | 3300009149 | Deep Subsurface | MLEWILYFIGAIFGVVAIGAVISVIAAIYIFNELD* |
| Ga0098049_11761372 | 3300010149 | Marine | MLDWILYIIAGIFGLVAIGGLISILAAIYILRELD* |
| Ga0098049_11960952 | 3300010149 | Marine | MLDWILYIIAGLFGLVAIGGLISILAAIYILRELD* |
| Ga0098049_12817632 | 3300010149 | Marine | MLEWLLYFIAAVFGLVLIGGLISVLAFIYVIRELD* |
| Ga0098056_10744341 | 3300010150 | Marine | MIDAILYFIAAVFGLVAIGGLISILVFIYIVRELD* |
| Ga0098059_11909182 | 3300010153 | Marine | MLDWILYLIGAVFGLVAVGAVISVIAFIWMIRELD* |
| Ga0129342_13290192 | 3300010299 | Freshwater To Marine Saline Gradient | MLEWILYFIVGIFGLVFIGAIISLIAAIYILNELD* |
| Ga0129351_10402141 | 3300010300 | Freshwater To Marine Saline Gradient | MIEWILYFIAGIFGLVAVGGIISVIAAIYIFNELD* |
| Ga0136655_11650522 | 3300010316 | Freshwater To Marine Saline Gradient | MLDWILYFIAGVFGLVFIGAIISLIAAIYILNELD* |
| Ga0136655_12200691 | 3300010316 | Freshwater To Marine Saline Gradient | MLDWILYFIAGVFGLVAIGGIISVIAFIYIIRELD* |
| Ga0129324_103076341 | 3300010368 | Freshwater To Marine Saline Gradient | MIEWILYFIAGVFGLVAIGGIISVIAFIYIIRELD* |
| Ga0129324_103744131 | 3300010368 | Freshwater To Marine Saline Gradient | LEWILYFIAGIFGLVFIGIILSVLAFIYIIRELD* |
| Ga0151665_10202533 | 3300011127 | Marine | MLEWILYFIAGIFGLVFIGIILSVLAFIYMIRELD* |
| Ga0181369_10138614 | 3300017708 | Marine | MIDAILYFIAAVFGLVAIGGLISILVFIYIVRELD |
| Ga0181381_10796601 | 3300017726 | Seawater | TMLEWILYFIAGIFGLVLIGIILSVLAFIYVIRELD |
| Ga0181401_10066225 | 3300017727 | Seawater | MLEWILYIIVGIFGLVAIGGVISVLAAIYILKELD |
| Ga0181402_10300044 | 3300017743 | Seawater | MIEWILYIIAGIFGLVAIGGVISVLAAIYILKELD |
| Ga0181392_10050025 | 3300017749 | Seawater | MLEWILYIIAGIFGLVAIGGVISVLAAIYILKELD |
| Ga0181411_12104272 | 3300017755 | Seawater | MLEWILYIIAGIFGLVAIGGVVSVLAAIYILKELD |
| Ga0181410_11669942 | 3300017763 | Seawater | MLEWILYIIAWIFGLVAIGGIVSVLAAIYILKELD |
| Ga0181380_10568322 | 3300017782 | Seawater | MLEWILYFIAGIFGLVLIGIILSVLAFIYVIRELD |
| Ga0181380_12535331 | 3300017782 | Seawater | ILMIEAILYFITGVFGLVVIGGLISLIVFIYIVRELD |
| Ga0181379_10570304 | 3300017783 | Seawater | MIEAILYFITGVFALVVIGGLISLIVFIYIVRELD |
| Ga0181552_1000399017 | 3300017824 | Salt Marsh | MLEWILYFIAGIFGLVFIGIILSVLAFIYIITELD |
| Ga0181607_1000169223 | 3300017950 | Salt Marsh | MLDWILYFIAGIFGLVFIGAIISVIAAVYILNELD |
| Ga0180438_103754532 | 3300017971 | Hypersaline Lake Sediment | MLEWILYFIAAVFGLVFIGAIISVLAFIYIINELD |
| Ga0181591_103570474 | 3300018424 | Salt Marsh | MLDWILYFIAGVFGLVFIGAIISVIAAIYILNELD |
| Ga0194029_10312704 | 3300019751 | Freshwater | MIEWILYFIAGIFGLVAIGGLISIVAAIYILNELD |
| Ga0181575_103135863 | 3300020055 | Salt Marsh | MLDWILYFIAGIFGLVFIGAIISVIAAIYILNELD |
| Ga0206131_101920944 | 3300020185 | Seawater | MIEWILYFIAGVFGLVAIGGLISIVAAIYILNELD |
| Ga0206682_100443096 | 3300021185 | Seawater | MLDWILYLIGAVFGLVAIGALISVIAFIWMIRELD |
| Ga0213867_10172625 | 3300021335 | Seawater | MLEWILYFIAGIFGLVFIGIILSVLAFIYIIKELD |
| Ga0213858_1000033133 | 3300021356 | Seawater | MIEWILYFIAGIFGLVFIGIILSVLAFIYVIRELD |
| Ga0213860_104632752 | 3300021368 | Seawater | MLEWILYFIAGIFGLVFIGIILSVLAFIYVIRELD |
| Ga0213863_100793994 | 3300021371 | Seawater | MLDWILYLIGAVFGLVAVGAVISVIAFIWMIKELD |
| Ga0213865_100058152 | 3300021373 | Seawater | MLDWILYFIAGIFGLVFVGGIISVLAAIYIFNELD |
| Ga0213865_101896554 | 3300021373 | Seawater | MLDWILYLIGAVFGLVAIGAVISVIAFIWMIKELD |
| Ga0213865_103659162 | 3300021373 | Seawater | LITMLEWILYFIAGIFGLVFIGIILSVLAFIYVIRELD |
| Ga0213865_104690591 | 3300021373 | Seawater | GLITMLEWILYFIAGIFGLVFIGIILSVLAFIYVIRELD |
| Ga0213869_1002145213 | 3300021375 | Seawater | MIEWILYFIAGIFGLVAIGGIISVIAAIYILNELD |
| Ga0213869_101949571 | 3300021375 | Seawater | MIEWILYFIAGVFGLVAIGGIISVIAFIYIIRELD |
| Ga0213864_101280444 | 3300021379 | Seawater | MLEWILYFIAGIFGLVFIGAIISVLAFIYMLNELD |
| Ga0213864_105691062 | 3300021379 | Seawater | GLSSMIEWILYFIAGIFGLVFIGIILSVLAFIYVIRELD |
| Ga0213868_103218504 | 3300021389 | Seawater | ISMIEWILYFIAGIFGLVAIGGLISIVAAIYILNELD |
| Ga0222717_102456104 | 3300021957 | Estuarine Water | LMIEWILYFIAGIFGLVAIGGLISIVAAIYILNELD |
| Ga0222717_106905682 | 3300021957 | Estuarine Water | MIEWILYFIAGIFGLVAIAGIISVIAAIYILNELD |
| Ga0222718_100092793 | 3300021958 | Estuarine Water | MLEWILYFIAGIFGLVAIGGLISIVAAIYILNELD |
| Ga0222718_100558644 | 3300021958 | Estuarine Water | MIDWILYFIAGIFGLVAIAGIISVIAAIYILNKLD |
| Ga0222715_101351432 | 3300021960 | Estuarine Water | MLEWILYFIAGVFGLVAIGGLISIVAAIYILNELD |
| Ga0222715_107040613 | 3300021960 | Estuarine Water | MIDWILYFIAGIFGLVAIAGIISVIAAIYILNELD |
| Ga0222719_101642345 | 3300021964 | Estuarine Water | MIEWILYFIAGIFGLVAIGAVISVIAAIYILNELD |
| Ga0222719_104009212 | 3300021964 | Estuarine Water | MLDWILYFIAGVFGLVFIGAIISLIAAIYILNELD |
| Ga0196883_100019411 | 3300022050 | Aqueous | MIEWILYFIGAVFGLVAIGAVISVIAAIYIFNELD |
| Ga0212028_10790581 | 3300022071 | Aqueous | MLEWILYFIAGVFGLVFIGAIISLIAAIYILNELD |
| Ga0255783_103629492 | 3300022923 | Salt Marsh | MPEWILYFIAGIFGLVFIGIILSVLAFIYIITELD |
| (restricted) Ga0233412_101280974 | 3300023210 | Seawater | MIEWILYFIAGVFGLVAIGGLISLIVFIYIVRELD |
| Ga0244775_100300405 | 3300024346 | Estuarine | MIEWILYFIAGIFGLVAIGGIISVIAAIYIFNELD |
| Ga0244775_101652954 | 3300024346 | Estuarine | MLEWILYFIGAVFGLVAIGAVISVIAAIYIFNELD |
| Ga0208667_100025429 | 3300025070 | Marine | MLEWILYFIAGIFGLVFIGGLISVLAFIYMINELD |
| Ga0208667_10021486 | 3300025070 | Marine | MLDWILYIIAGIFGLVAIGGLISVLAAIYILRELD |
| Ga0208667_10030638 | 3300025070 | Marine | MLEWILYFIAGIFGLVFIGIILSVLAFIYIIRELD |
| Ga0208667_100326315 | 3300025070 | Marine | MLDWILYIIAGLFGLVAIGGLISILAAIYILRELD |
| Ga0208667_10472932 | 3300025070 | Marine | MLDWILYIIAGIFGLVAIGGLISILAAIYILRELD |
| Ga0208298_10069865 | 3300025084 | Marine | MIDAILYFIATVFGLVFIGGVISLLAFIYIIRELD |
| Ga0208298_10576712 | 3300025084 | Marine | MVDWILYIIAGIFGLVAIGGLISILAAIYILRELD |
| Ga0209645_11151023 | 3300025151 | Marine | MLEWILYFIAGVFGLIFIGALISVLAFIYVIRELD |
| Ga0208303_10317102 | 3300025543 | Aqueous | MVDWILYLIAGIFGLVAIGGLISIVAAIYILNELD |
| Ga0208303_10533765 | 3300025543 | Aqueous | MLEWILYFIAGVFGLVFIGAIISVIAAIYILNELD |
| Ga0208303_10732912 | 3300025543 | Aqueous | MLEWILYFIAGIFGLVFIGAIISLIAAIYILNELD |
| Ga0208898_10315676 | 3300025671 | Aqueous | MLEWILYFIAAVFGLVFIGAIISLIAAIYILNELD |
| Ga0208162_10163986 | 3300025674 | Aqueous | MIEWILYFIAGTFGLVAIGGLISIVAAIYILNELD |
| Ga0208162_10335451 | 3300025674 | Aqueous | MIEWILYFIAGIFGLVAVGGIISVIAAIYIFNELD |
| Ga0208162_10659722 | 3300025674 | Aqueous | MLEWILYFIAAVFGLVFIGAIISVIAAIYILNELD |
| Ga0208899_10219195 | 3300025759 | Aqueous | MLEWILYFIGAVFGLVFLGAIISVLAFIYIINELD |
| Ga0209193_11620692 | 3300025816 | Pelagic Marine | MIEWILYFIGAVFGLVAIGGIISVIAAIYIFNELD |
| Ga0208917_11043464 | 3300025840 | Aqueous | MLEWILYFIAAVFGLVAIGGIISVIAFIYIIRELD |
| Ga0208921_10524861 | 3300027188 | Estuarine | MIEWILYFIAGIFGLVAIGGVVSVLAAIYILKELD |
| Ga0209536_1001798704 | 3300027917 | Marine Sediment | MLEWILYFIGAVFGLVFIGAIISVIAAIYILNELD |
| Ga0315320_105251584 | 3300031851 | Seawater | MIDAILYFIAGVFGLVAIGGLISLIVFIYIVRELD |
| ⦗Top⦘ |