| Basic Information | |
|---|---|
| Family ID | F067625 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MDEVERTCPACGDAIEDGEALVFFDGEMYHVACAPGAQPWPPPPRQPRWD |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.40 % |
| % of genes near scaffold ends (potentially truncated) | 32.80 % |
| % of genes from short scaffolds (< 2000 bps) | 74.40 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.600 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (16.800 % of family members) |
| Environment Ontology (ENVO) | Unclassified (37.600 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 15.38% Coil/Unstructured: 84.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF01812 | 5-FTHF_cyc-lig | 22.40 |
| PF03641 | Lysine_decarbox | 13.60 |
| PF00487 | FA_desaturase | 8.00 |
| PF00512 | HisKA | 4.00 |
| PF14791 | DNA_pol_B_thumb | 3.20 |
| PF07519 | Tannase | 3.20 |
| PF01678 | DAP_epimerase | 2.40 |
| PF05494 | MlaC | 2.40 |
| PF13185 | GAF_2 | 2.40 |
| PF12706 | Lactamase_B_2 | 1.60 |
| PF02469 | Fasciclin | 1.60 |
| PF05721 | PhyH | 0.80 |
| PF01435 | Peptidase_M48 | 0.80 |
| PF11249 | DUF3047 | 0.80 |
| PF01408 | GFO_IDH_MocA | 0.80 |
| PF01258 | zf-dskA_traR | 0.80 |
| PF02811 | PHP | 0.80 |
| PF01894 | UPF0047 | 0.80 |
| PF13502 | AsmA_2 | 0.80 |
| PF13492 | GAF_3 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG0212 | 5-formyltetrahydrofolate cyclo-ligase | Coenzyme transport and metabolism [H] | 22.40 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 13.60 |
| COG1398 | Fatty-acid desaturase | Lipid transport and metabolism [I] | 8.00 |
| COG3239 | Fatty acid desaturase | Lipid transport and metabolism [I] | 8.00 |
| COG0253 | Diaminopimelate epimerase | Amino acid transport and metabolism [E] | 2.40 |
| COG2854 | Periplasmic subunit MlaC of the ABC-type intermembrane phospholipid transporter Mla | Cell wall/membrane/envelope biogenesis [M] | 2.40 |
| COG2335 | Uncaracterized surface protein containing fasciclin (FAS1) repeats | General function prediction only [R] | 1.60 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.80 |
| COG1734 | RNA polymerase-binding transcription factor DksA | Transcription [K] | 0.80 |
| COG5285 | Ectoine hydroxylase-related dioxygenase, phytanoyl-CoA dioxygenase (PhyH) family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.60 % |
| Unclassified | root | N/A | 22.40 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10048073 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
| 3300002561|JGI25384J37096_10008513 | All Organisms → cellular organisms → Bacteria | 3849 | Open in IMG/M |
| 3300002562|JGI25382J37095_10000825 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 8576 | Open in IMG/M |
| 3300002908|JGI25382J43887_10479746 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300002912|JGI25386J43895_10012246 | All Organisms → cellular organisms → Bacteria | 2461 | Open in IMG/M |
| 3300003267|soilL1_10027528 | All Organisms → cellular organisms → Bacteria | 7021 | Open in IMG/M |
| 3300003996|Ga0055467_10019673 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
| 3300004156|Ga0062589_100547209 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300004480|Ga0062592_100620877 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300004643|Ga0062591_100203215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1457 | Open in IMG/M |
| 3300005166|Ga0066674_10074210 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
| 3300005171|Ga0066677_10020437 | Not Available | 3054 | Open in IMG/M |
| 3300005171|Ga0066677_10252379 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| 3300005172|Ga0066683_10009906 | All Organisms → cellular organisms → Bacteria | 4957 | Open in IMG/M |
| 3300005174|Ga0066680_10875157 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300005175|Ga0066673_10074294 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
| 3300005175|Ga0066673_10080469 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1711 | Open in IMG/M |
| 3300005176|Ga0066679_10354260 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 959 | Open in IMG/M |
| 3300005178|Ga0066688_10021901 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3404 | Open in IMG/M |
| 3300005184|Ga0066671_10158734 | Not Available | 1326 | Open in IMG/M |
| 3300005186|Ga0066676_10253628 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300005445|Ga0070708_100229739 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300005446|Ga0066686_10006491 | All Organisms → cellular organisms → Bacteria | 5718 | Open in IMG/M |
| 3300005451|Ga0066681_10554588 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300005467|Ga0070706_101816435 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 554 | Open in IMG/M |
| 3300005529|Ga0070741_10032964 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7102 | Open in IMG/M |
| 3300005536|Ga0070697_100683916 | Not Available | 905 | Open in IMG/M |
| 3300005546|Ga0070696_100755295 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300005557|Ga0066704_10038872 | All Organisms → cellular organisms → Bacteria | 2952 | Open in IMG/M |
| 3300005568|Ga0066703_10692900 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 587 | Open in IMG/M |
| 3300005586|Ga0066691_10218092 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1115 | Open in IMG/M |
| 3300005713|Ga0066905_100604600 | All Organisms → cellular organisms → Bacteria | 929 | Open in IMG/M |
| 3300006049|Ga0075417_10005214 | All Organisms → cellular organisms → Bacteria | 4399 | Open in IMG/M |
| 3300006755|Ga0079222_10123140 | All Organisms → cellular organisms → Bacteria | 1417 | Open in IMG/M |
| 3300006755|Ga0079222_10618928 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300006755|Ga0079222_12327600 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
| 3300006794|Ga0066658_10157832 | Not Available | 1158 | Open in IMG/M |
| 3300006804|Ga0079221_10204467 | Not Available | 1085 | Open in IMG/M |
| 3300006844|Ga0075428_100082621 | All Organisms → cellular organisms → Bacteria | 3505 | Open in IMG/M |
| 3300006845|Ga0075421_100042231 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5780 | Open in IMG/M |
| 3300006845|Ga0075421_100368478 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1732 | Open in IMG/M |
| 3300006852|Ga0075433_11469101 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
| 3300006876|Ga0079217_10175842 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1067 | Open in IMG/M |
| 3300006894|Ga0079215_10224387 | Not Available | 973 | Open in IMG/M |
| 3300006914|Ga0075436_101096359 | Not Available | 599 | Open in IMG/M |
| 3300006954|Ga0079219_10203734 | Not Available | 1125 | Open in IMG/M |
| 3300006954|Ga0079219_11192722 | Not Available | 658 | Open in IMG/M |
| 3300007255|Ga0099791_10069133 | All Organisms → cellular organisms → Bacteria | 1600 | Open in IMG/M |
| 3300007265|Ga0099794_10050084 | All Organisms → cellular organisms → Bacteria | 2009 | Open in IMG/M |
| 3300007265|Ga0099794_10484442 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 650 | Open in IMG/M |
| 3300009100|Ga0075418_10001372 | All Organisms → cellular organisms → Bacteria | 27473 | Open in IMG/M |
| 3300009100|Ga0075418_10005398 | All Organisms → cellular organisms → Bacteria | 14475 | Open in IMG/M |
| 3300009147|Ga0114129_10695068 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300009156|Ga0111538_12926723 | Not Available | 597 | Open in IMG/M |
| 3300010102|Ga0127453_1033976 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 508 | Open in IMG/M |
| 3300010303|Ga0134082_10244833 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300010320|Ga0134109_10350818 | Not Available | 580 | Open in IMG/M |
| 3300010325|Ga0134064_10079577 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300010326|Ga0134065_10334267 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 590 | Open in IMG/M |
| 3300010335|Ga0134063_10014720 | All Organisms → cellular organisms → Bacteria | 3138 | Open in IMG/M |
| 3300011269|Ga0137392_10878181 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300011271|Ga0137393_10283673 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300012203|Ga0137399_10229404 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
| 3300012203|Ga0137399_10449144 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1078 | Open in IMG/M |
| 3300012205|Ga0137362_10152468 | Not Available | 1977 | Open in IMG/M |
| 3300012397|Ga0134056_1122223 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 680 | Open in IMG/M |
| 3300012401|Ga0134055_1366937 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 544 | Open in IMG/M |
| 3300012685|Ga0137397_10061684 | All Organisms → cellular organisms → Bacteria | 2705 | Open in IMG/M |
| 3300012918|Ga0137396_10381193 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1045 | Open in IMG/M |
| 3300012922|Ga0137394_10195160 | All Organisms → cellular organisms → Bacteria | 1728 | Open in IMG/M |
| 3300012929|Ga0137404_10116700 | Not Available | 2176 | Open in IMG/M |
| 3300012929|Ga0137404_11161292 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300012930|Ga0137407_10000829 | All Organisms → cellular organisms → Bacteria | 20313 | Open in IMG/M |
| 3300014157|Ga0134078_10076073 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300014166|Ga0134079_10695655 | Not Available | 518 | Open in IMG/M |
| 3300014263|Ga0075324_1022579 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300014302|Ga0075310_1053190 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 792 | Open in IMG/M |
| 3300015241|Ga0137418_10015458 | All Organisms → cellular organisms → Bacteria | 7049 | Open in IMG/M |
| 3300015259|Ga0180085_1030534 | All Organisms → cellular organisms → Bacteria | 1515 | Open in IMG/M |
| 3300015371|Ga0132258_10197138 | All Organisms → cellular organisms → Bacteria | 4882 | Open in IMG/M |
| 3300018431|Ga0066655_10000903 | All Organisms → cellular organisms → Bacteria | 10312 | Open in IMG/M |
| 3300018431|Ga0066655_10192126 | Not Available | 1254 | Open in IMG/M |
| 3300018433|Ga0066667_10001774 | All Organisms → cellular organisms → Bacteria | 8281 | Open in IMG/M |
| 3300018433|Ga0066667_10065401 | All Organisms → cellular organisms → Bacteria | 2272 | Open in IMG/M |
| 3300018468|Ga0066662_10004449 | All Organisms → cellular organisms → Bacteria | 6808 | Open in IMG/M |
| 3300018482|Ga0066669_10553467 | Not Available | 1003 | Open in IMG/M |
| 3300018482|Ga0066669_12444785 | Not Available | 502 | Open in IMG/M |
| 3300020170|Ga0179594_10066638 | All Organisms → cellular organisms → Bacteria | 1247 | Open in IMG/M |
| 3300020170|Ga0179594_10214147 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 723 | Open in IMG/M |
| 3300025559|Ga0210087_1031972 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
| 3300026297|Ga0209237_1024812 | All Organisms → cellular organisms → Bacteria | 3358 | Open in IMG/M |
| 3300026297|Ga0209237_1051414 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2069 | Open in IMG/M |
| 3300026300|Ga0209027_1109552 | Not Available | 978 | Open in IMG/M |
| 3300026312|Ga0209153_1037493 | Not Available | 1681 | Open in IMG/M |
| 3300026313|Ga0209761_1220787 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300026327|Ga0209266_1050848 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
| 3300026330|Ga0209473_1225474 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
| 3300026540|Ga0209376_1314330 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300026542|Ga0209805_1132486 | Not Available | 1167 | Open in IMG/M |
| 3300026547|Ga0209156_10283720 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300026548|Ga0209161_10207467 | Not Available | 1075 | Open in IMG/M |
| 3300027637|Ga0209818_1059572 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
| 3300027637|Ga0209818_1292802 | Not Available | 502 | Open in IMG/M |
| 3300027671|Ga0209588_1161485 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300027678|Ga0209011_1177799 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 589 | Open in IMG/M |
| 3300027682|Ga0209971_1062233 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 904 | Open in IMG/M |
| 3300027691|Ga0209485_1297692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 533 | Open in IMG/M |
| 3300027717|Ga0209998_10209476 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300027748|Ga0209689_1347363 | Not Available | 568 | Open in IMG/M |
| 3300027886|Ga0209486_10054275 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2015 | Open in IMG/M |
| 3300027909|Ga0209382_10226998 | All Organisms → cellular organisms → Bacteria | 2129 | Open in IMG/M |
| 3300027909|Ga0209382_10887474 | Not Available | 940 | Open in IMG/M |
| 3300028536|Ga0137415_10235741 | All Organisms → cellular organisms → Bacteria | 1641 | Open in IMG/M |
| 3300031548|Ga0307408_100017595 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4785 | Open in IMG/M |
| 3300031548|Ga0307408_100132622 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1945 | Open in IMG/M |
| 3300031548|Ga0307408_101753549 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 593 | Open in IMG/M |
| 3300031716|Ga0310813_10627964 | Not Available | 953 | Open in IMG/M |
| 3300031720|Ga0307469_11730868 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 603 | Open in IMG/M |
| 3300031820|Ga0307473_10382379 | Not Available | 916 | Open in IMG/M |
| 3300031852|Ga0307410_11416549 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 610 | Open in IMG/M |
| 3300031901|Ga0307406_11642097 | Not Available | 568 | Open in IMG/M |
| 3300031911|Ga0307412_10665456 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 890 | Open in IMG/M |
| 3300032005|Ga0307411_10260652 | All Organisms → cellular organisms → Bacteria | 1369 | Open in IMG/M |
| 3300033550|Ga0247829_11518743 | Not Available | 553 | Open in IMG/M |
| 3300033815|Ga0364946_044700 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 909 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 16.80% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.20% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 12.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 9.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 8.00% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.60% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.40% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.60% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.60% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.60% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.60% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.80% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.80% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.80% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010102 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012397 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012401 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014263 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014302 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027691 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_100480732 | 3300002558 | Grasslands Soil | MDERERTCPACGGVIDDGETLVFFDGEMYHVACAPGATSWPPPPRQPRWD* |
| JGI25384J37096_100085133 | 3300002561 | Grasslands Soil | MDEQERTCPACGGVIEDGETLVFFDGEMYHVACAPGATSWPPPLRQPRWD* |
| JGI25382J37095_100008253 | 3300002562 | Grasslands Soil | MDEQERTCPACGGVIDDGETLVFFDGEMYHVACAPGATSWPPPPRQPRWD* |
| JGI25382J43887_104797462 | 3300002908 | Grasslands Soil | MDEPERTCPACGGTIESDDAVVFFDGEMYHVACAPGAESLPREPRY* |
| JGI25386J43895_100122462 | 3300002912 | Grasslands Soil | MDEQERTCPACGGVIEDGETLVFFDGEMYHVACAPGATSWPPLRQPRWD* |
| soilL1_1002752812 | 3300003267 | Sugarcane Root And Bulk Soil | MDGPERTCPACGDRIEDGETVVFFGGEMFHLDCAPGALPWPPPPREPRF* |
| Ga0055467_100196732 | 3300003996 | Natural And Restored Wetlands | MDVTERRCPACGERIEDGETVVFFGGEMYHLECAPGARLWPPRPREPRF* |
| Ga0062589_1005472092 | 3300004156 | Soil | MDGVERTCPACGDRIEDGETVVFFGGEMFHLDCAPGAVAWPPPPREPRF* |
| Ga0062592_1006208773 | 3300004480 | Soil | MDGPERTCPACGDRIEDGETVVFFGGEMFHLDCAPGAVPWPPPPREPRF* |
| Ga0062591_1002032152 | 3300004643 | Soil | MDGPERTCPTCGDRIEDGETVVFFGGEMFHLDCAPGAIPWPPPPREPRF* |
| Ga0066674_100742103 | 3300005166 | Soil | MDDVERTCPACGSAIEDDDASVFFDGEMYHVDCAPGAQPWPPPPRQPRWD* |
| Ga0066677_100204374 | 3300005171 | Soil | MDDVERTCPACGSGIEDDDASVFFDGEMYHVDCAPGAQPWPPPPRQPRWD* |
| Ga0066677_102523792 | 3300005171 | Soil | MEEERTCPACGEAIEDGEALVFFDSEMYHVKCAPGAQPWPPPPRQPRWD* |
| Ga0066683_100099064 | 3300005172 | Soil | MDDVELTCPACGSAIEDDDASVFFDGEMYHVDCAPGAQPWPPPPRQPRWD* |
| Ga0066680_108751572 | 3300005174 | Soil | MDEVERTCPACGGALEDNDPSVFFGGEMYHVGCAPGAPSWPPPPRQPRRD* |
| Ga0066673_100742944 | 3300005175 | Soil | GEAIEDGEALVFFDSEMYHVKCAPGAQPWPPPPRQPRWD* |
| Ga0066673_100804693 | 3300005175 | Soil | MEEERTCPACGEAIEDGEALVFFDGEMYHVKCAPGASPWPPPPRQPRWD* |
| Ga0066679_103542602 | 3300005176 | Soil | MEEERTCPACGEAIEDGETLVFFDSEMYHVKCAPGAQPWPPPPRQPRWD* |
| Ga0066688_100219012 | 3300005178 | Soil | MDDVERTCPACGSAIEDDDASVFFDGEMYHVACAPGATSWPPPPRQPRWD* |
| Ga0066671_101587342 | 3300005184 | Soil | MDDGERTCPSCGGAIEDDDASVFFDGEMYHVACAPGAQPWPPPPRQPRWD* |
| Ga0066676_102536281 | 3300005186 | Soil | MDDVERTCPACGSAIEDDDASVFFDGEMYHVGCAPGAQPWPPPPRQPRWD* |
| Ga0070708_1002297391 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEERTCPACGEAIEDGEALVFFDSEMYHVKCAPGAQPWPPPPRQPRWD* |
| Ga0066686_100064913 | 3300005446 | Soil | MDDLERTCPACGSAIEDDDASVFFDGEMYHVGCAPGAQPWPPPPRQPRWD* |
| Ga0066681_105545882 | 3300005451 | Soil | TCPACGEAIEDGEALVFFDSEMYHVKCAPGAQPWPPPPRQPRWD* |
| Ga0070706_1018164352 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEERTCPACGEAIEDGETLVFFDSEMYHVNCAPGAQPWPPPPRQPRWD* |
| Ga0070741_100329647 | 3300005529 | Surface Soil | MNEPERTCPTCGDRIDDGETVVFFGGEMYHLDCAPGALPWPPPPREPRF* |
| Ga0070697_1006839161 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MDEERTCPACGEAIEDGEALVFFDSEMYHVKCAPGAQPWPPPPRQ |
| Ga0070696_1007552952 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MQERERTCPACDGAIETGETVVFFEGEMYHVRCAPGATPPPRTPRFD* |
| Ga0066704_100388724 | 3300005557 | Soil | MDEVERTCPACGGALEDNDASVFFGGEMYHVGCAPGAPSWPPPPRQPRWD* |
| Ga0066703_106929001 | 3300005568 | Soil | MDEVERTCPACGGALEDNDPSVFFGGEMYHVGCAPGAPSWPPPPRQPR |
| Ga0066691_102180921 | 3300005586 | Soil | MDEVERTCPACGGALEDNDASVFFGGEMYHVGCAPGAPSWPPP |
| Ga0066905_1006046002 | 3300005713 | Tropical Forest Soil | MDALERTCPACGAAIEDDDASVFFDGEMYHVACAPGAPQWPPPPRQPRWD* |
| Ga0075417_100052147 | 3300006049 | Populus Rhizosphere | MDDLERTCLACGRAIEEDDASVFFAGDMYHVDCAPGASPWPPPPRQPRWD* |
| Ga0079222_101231402 | 3300006755 | Agricultural Soil | MEDLERTCPTCGGTIEDDDASVFFAGEMYHVNCAPGAQPWPPPPRQPRWD* |
| Ga0079222_106189282 | 3300006755 | Agricultural Soil | MDGPERTCPTCGDGIEDGETVVFFGGEMFHLDCAPGAIPWPPPPREPRF* |
| Ga0079222_123276002 | 3300006755 | Agricultural Soil | MDEVPRLCPACGDAIEDDDASVFFAGEMYHVACAPGASPWPPPPRQPRWD* |
| Ga0066658_101578323 | 3300006794 | Soil | AAIEDDDASVFFDGEMYHVDCAPGAQPWPPPPRQPRWD* |
| Ga0079221_102044671 | 3300006804 | Agricultural Soil | MEDLERTCPTCGGAIEDDDASVFFAGEMYHVNCAPGAQPWPPPPRQPRWD* |
| Ga0075428_1000826212 | 3300006844 | Populus Rhizosphere | MDRVERTCPTCGDRIEDGETVVFFGGEMYHLDCAPGALPWPPPPREPRF* |
| Ga0075421_1000422317 | 3300006845 | Populus Rhizosphere | MDGPERTCPACGDRIEDGETVVFFGGEMFHLDCAPGAVAWPPPPREPRF* |
| Ga0075421_1003684782 | 3300006845 | Populus Rhizosphere | MEGTERTCPACGDRIEDGETVVFFGGEMYHLDCAPGALSWPPPPREPRF* |
| Ga0075433_114691012 | 3300006852 | Populus Rhizosphere | MDDPERTCPSCGGAIEEDDASVFFDGEMYHVACAPGAQPWPPPPRQPRWD* |
| Ga0079217_101758422 | 3300006876 | Agricultural Soil | MDGTERTCPACGDRIEDGETVVFFGGEMFHLDCAPGAVAWPPPPREPRF* |
| Ga0079215_102243872 | 3300006894 | Agricultural Soil | CGDRIEDGETVVFFGGEMFHLDCAPGAVAWPPPPREPRF* |
| Ga0075436_1010963592 | 3300006914 | Populus Rhizosphere | MDEPERICPACGVAIEEDETLVFFDGEMYHVACAPGAEAWPPPPR |
| Ga0079219_102037342 | 3300006954 | Agricultural Soil | MDDLERTCPTCGGAIEDDDASVFFAGEMYHVNCAPGAQPWPPPPRQPRWD* |
| Ga0079219_111927221 | 3300006954 | Agricultural Soil | RIDDGETVVFFGGEMYHLDCAPGALPWPPPPREPRF* |
| Ga0099791_100691332 | 3300007255 | Vadose Zone Soil | MAEERTCPACGEAIEDGETLVFFDSEMYHVKCAPGAQPWPPPPRQPRWD* |
| Ga0099794_100500844 | 3300007265 | Vadose Zone Soil | AEERTCPACGEAIEDGETLVFFDSEMYHVKCAPGAQPWPPPPRQPRWD* |
| Ga0099794_104844422 | 3300007265 | Vadose Zone Soil | ERICPACGVAIEEDETLVFFDDEMYHVACAPGAEPWPPPPRQPRF* |
| Ga0075418_100013721 | 3300009100 | Populus Rhizosphere | TCGGPIEDDDASVFFDGEMYHVGCAPGAPSWPPPPRQPRWD* |
| Ga0075418_100053981 | 3300009100 | Populus Rhizosphere | AIEEDDASVFFAGDMYHVDCAPGASPWPPPPRQPRWD* |
| Ga0114129_106950682 | 3300009147 | Populus Rhizosphere | MDGPERTCPACGDRIEDGETVVFFGGEMFHLDCAPGAVPWPPPP |
| Ga0111538_129267232 | 3300009156 | Populus Rhizosphere | DRVERTCPTCGDRIEDGETVVFFGGEMYHLDCAPGALPWPPPPREPRF* |
| Ga0127453_10339762 | 3300010102 | Grasslands Soil | DDGETLVFFDGEMYHVACAPGATSWPPPPRQPRWD* |
| Ga0134082_102448332 | 3300010303 | Grasslands Soil | ACGEAIEDGEALVFFDGEMYHVKCAPGASPWPPPPRQPRWD* |
| Ga0134109_103508181 | 3300010320 | Grasslands Soil | MDDVDRTCLACGSAIEDDDASVFFDGEMYHVDCAPGAQPWPPPPRQPRWD* |
| Ga0134064_100795771 | 3300010325 | Grasslands Soil | MEEERTCPACGEAIEDGEALVFFDGEMYHVDCAPGAQPWPPPPRQPRWD* |
| Ga0134065_103342672 | 3300010326 | Grasslands Soil | EEERTCPACGEAIEDGEALVFFDSEMYHVKCAPGAQPWPPPPRQPRWD* |
| Ga0134063_100147201 | 3300010335 | Grasslands Soil | ACGSAIEDDDASVFFDGEMYHVDCAPGAQPWPPPPRQPRWD* |
| Ga0137392_108781811 | 3300011269 | Vadose Zone Soil | AIEDGETLVFFDSEMYHVKCAPGAQPWPPPPRQPRWD* |
| Ga0137393_102836731 | 3300011271 | Vadose Zone Soil | EERTCPACGEAIEDGETLVFFDSEMYHVNCAPGAQPWPPPPRQPRWD* |
| Ga0137399_102294042 | 3300012203 | Vadose Zone Soil | MDEQERTCPACGGVIEDDAALVFFDGEMYHVACAPGAQAWPPPPRQPRWD* |
| Ga0137399_104491442 | 3300012203 | Vadose Zone Soil | MDEPERICPACGVAIEEDETLVFFDGEMYHVACAPGAEPWPPPPRQPRF* |
| Ga0137362_101524682 | 3300012205 | Vadose Zone Soil | MAEERTCPACGEAIEDGEALVFFDSEMYHVKCAPGAQPWPPPPRQPRWD* |
| Ga0134056_11222231 | 3300012397 | Grasslands Soil | TGCMDERERTCPACGGVIDDGETLVFFDGEMYHVACAPGATSWPPPPRQPRWD* |
| Ga0134055_13669371 | 3300012401 | Grasslands Soil | RTCPACGGVIDDGETLVFFDGEMYHVACAPGATSWPPPPRQPRWD* |
| Ga0137397_100616841 | 3300012685 | Vadose Zone Soil | MDEQERTCPACGDAIEDGEALVFFDGEMYHVACAPGAQPWPPPPRQPRWD* |
| Ga0137396_103811932 | 3300012918 | Vadose Zone Soil | MDEQERTCPTCGGVIEDGETLVFFDGEMYHVACAPGAASWPPPPRQPRWD* |
| Ga0137394_101951602 | 3300012922 | Vadose Zone Soil | MDESERICPACGVAIEEDETLVFFDGEMYHVACAPGAEPWPPPPRQPRF* |
| Ga0137404_101167002 | 3300012929 | Vadose Zone Soil | MDEVERTCPACGDAIEDGEALVFFDGEMYHVACAPGAQPWPPPPRQPRWD* |
| Ga0137404_111612922 | 3300012929 | Vadose Zone Soil | EAIEDGEALVFFDSEMYHVKCAPGAQPWPPPPRQPRWD* |
| Ga0137407_1000082921 | 3300012930 | Vadose Zone Soil | MDEQERACPACGDAIEDGEALVFFDGEMYHVACAPGAQPWPPPPRQPRWD* |
| Ga0134078_100760731 | 3300014157 | Grasslands Soil | PACGSAIEDDDASVFFDGEMYHVDCAPGAQPWPPPPRQPRWD* |
| Ga0134079_106956551 | 3300014166 | Grasslands Soil | MEEERTCPACGEAIEDGEALVFFDSEMYHVKCAPGAQPWP |
| Ga0075324_10225793 | 3300014263 | Natural And Restored Wetlands | ACGERIEDGETVVFFGGEMYHLECAPGARLWPPRPREPRF* |
| Ga0075310_10531902 | 3300014302 | Natural And Restored Wetlands | MDVTERRCPACGERIEDGETVVFFGGEMYHLECAPGARLWPPRP |
| Ga0137418_100154589 | 3300015241 | Vadose Zone Soil | MEEERTCPACGEAIEEGETLVFFDSEMYHVKCAPGASPWPPPPRQPRWD* |
| Ga0180085_10305342 | 3300015259 | Soil | MEGTERNCPACGDLIEDGETVVFFGGEMYHLDCAPGALPWPPPPREPRF* |
| Ga0132258_101971386 | 3300015371 | Arabidopsis Rhizosphere | MDEARRFCPACGDAIEDDDASVFFASEMYHVACAPGASPWPPPPRQPRWD* |
| Ga0066655_100009039 | 3300018431 | Grasslands Soil | MDERERTCPACGGVIDDGETLVFFDGEMYHVACAPGATSWPPPPRQPRWD |
| Ga0066655_101921262 | 3300018431 | Grasslands Soil | MDDVERTCPACGSAIEDDDASVFFDGEMYHVDCAPGAQPWPPPPRQPRWD |
| Ga0066667_100017743 | 3300018433 | Grasslands Soil | MDARERTCPACGGVIDDGETLVFFDGEMYHVACAPGATSWPPPPRQPRWD |
| Ga0066667_100654013 | 3300018433 | Grasslands Soil | MEEERTCPACGEAIEDGEALVFFDSEMYHVKCAPGAQPWPPPPRQPRWD |
| Ga0066662_100044497 | 3300018468 | Grasslands Soil | MDERERTCPACGGVIDDGETLVFFDGEMYHDACAPGATSWPPPPRQPRWD |
| Ga0066669_105534674 | 3300018482 | Grasslands Soil | ACGEAIEDGEALVFFDSEMYHVKCAPGAQPWPPPPRQPRWD |
| Ga0066669_124447851 | 3300018482 | Grasslands Soil | MEEERTCPACGEAIEDGEALVFFDGEMYHVKCAPGASPWPPPPRQPRWD |
| Ga0179594_100666382 | 3300020170 | Vadose Zone Soil | MDDLERTCPACGSAIEDDDASVFFDGEMYHVGCAPGAQPWPPPPRQPRWD |
| Ga0179594_102141471 | 3300020170 | Vadose Zone Soil | MAEERTCPACGEAIEDGETLVFFDSEMYHVKCAPGAQPWPPPPRQPRWD |
| Ga0210087_10319722 | 3300025559 | Natural And Restored Wetlands | MDVTERRCPACGERIEDGETVVFFGGEMYHLECAPGARLWPPRPREPRF |
| Ga0209237_10248124 | 3300026297 | Grasslands Soil | MDEQERTCPACGGVIEDGETLVFFDGEMYHVACAPGATSWPPPLRQPRWD |
| Ga0209237_10514142 | 3300026297 | Grasslands Soil | MDEPERTCPACGGTIESDDAVVFFDGEMYHVACAPGAESLPREPRY |
| Ga0209027_11095521 | 3300026300 | Grasslands Soil | MEEERTCPACGEAIEDGETLVFFDSEMYHVKCAPGAQPWPPPPRQPRWD |
| Ga0209153_10374932 | 3300026312 | Soil | MDDGERTCPSCGGAIEDDDASVFFDGEMYHVACAPGAQPWPPPPRQPRWD |
| Ga0209761_12207872 | 3300026313 | Grasslands Soil | CPACGSAIEDDDASVFFDGEMYHVGCAPGAQPWPPPPRQPRWD |
| Ga0209266_10508483 | 3300026327 | Soil | MDDVELTCPACGSAIEDDDASVFFDGEMYHVDCAPGAQPWPPPPRQPRWD |
| Ga0209473_12254741 | 3300026330 | Soil | TGHMEEERTCPACGEAIEDGEALVFFDSEMYHVKCAPGAQPWPPPPRQPRWD |
| Ga0209376_13143302 | 3300026540 | Soil | MDDVDRTCLACGSAIEDDDASVFFDGEMYHVDCAPGAQPWPPPPRQPRWD |
| Ga0209805_11324863 | 3300026542 | Soil | MEEERTCPACGEAIEDGEALVFFDGEMYHVKCAPGASPWPPPPRQPR |
| Ga0209156_102837202 | 3300026547 | Soil | CGSAIEDDDASVFFDGEMYHVDCAPGAQPWPPPPRQPRWD |
| Ga0209161_102074672 | 3300026548 | Soil | MDDVERTCPACGSGIEDDDASVFFDGEMYHVDCAPGAQPWPPPPRQPRWD |
| Ga0209818_10595722 | 3300027637 | Agricultural Soil | STERTCPACGDRIEDGETVVFFGGEMFHLDCAPGAVAWPPPPREPRF |
| Ga0209818_12928022 | 3300027637 | Agricultural Soil | MDGPERTCPACGDRIEDGETVVFFGGEMFHLDCAPGAVAWPPPPREPRF |
| Ga0209588_11614851 | 3300027671 | Vadose Zone Soil | IEDGETLVFFDSEMYHVKCAPGAQPWPPPPRQPRWD |
| Ga0209011_11777992 | 3300027678 | Forest Soil | MDEERTCPACGEAIEDGETLVFFDSEMYHVKCAPGAQPWPPPPRQPRWD |
| Ga0209971_10622332 | 3300027682 | Arabidopsis Thaliana Rhizosphere | MDGPERTCPACGDRIEDGETVVFFGGEMFHLDCAPGAVPWPPPPREPRF |
| Ga0209485_12976921 | 3300027691 | Agricultural Soil | GPERTCPACGDRIEDGETVVFFGGEMFHLDCAPGAVAWPPPPREPRF |
| Ga0209998_102094762 | 3300027717 | Arabidopsis Thaliana Rhizosphere | PACGDRIEDGETVVFFGGEMFHLDCAPGAVPWPPPPREPRF |
| Ga0209689_13473632 | 3300027748 | Soil | MEEERTCPACGEAIEDDETLVFFDSEMYHVKCAPGAQPWPPPPRQPRWD |
| Ga0209486_100542753 | 3300027886 | Agricultural Soil | MDGTERTCPACGDRIEDGETVVFFGGEMFHLDCAPGAVAWPPPPREPRF |
| Ga0209382_102269982 | 3300027909 | Populus Rhizosphere | MEGTERTCPACGDRIEDGETVVFFGGEMYHLDCAPGALSWPPPPREPRF |
| Ga0209382_108874742 | 3300027909 | Populus Rhizosphere | MDRVERTCPTCGDRIEDGETVVFFGGEMYHLDCAPGALPWPPPPREPRF |
| Ga0137415_102357415 | 3300028536 | Vadose Zone Soil | MEEERTCPACGEAIEEGETLVFFDSEMYHVKCAPGASPWPPPPRQPRWD |
| Ga0307408_1000175952 | 3300031548 | Rhizosphere | MDGPERTCPSCGDRIDDGETVVFFGGEMFHLDCAPGALPWPPPPREPRF |
| Ga0307408_1001326222 | 3300031548 | Rhizosphere | MDGPERACPACGDPIEDGETVVFFGGEMFHLDCAPGAVAWPPPPREPRF |
| Ga0307408_1017535491 | 3300031548 | Rhizosphere | YTLSMDGVERTCPACGDRIEDGETVVFFGGEMFHLDCAPGAVAWPPPPREPRF |
| Ga0310813_106279643 | 3300031716 | Soil | MDEARRLCPACGDAIEDDDASVFFAGEMYHVACAPGALPWPPPPRQPRWD |
| Ga0307469_117308682 | 3300031720 | Hardwood Forest Soil | MDEERTCPACGEAIEDGEALVFFDSEMYHVKCAPGAQPWPPPPRQPRWD |
| Ga0307473_103823792 | 3300031820 | Hardwood Forest Soil | MAEERTCPACGEAIEDGETLVFFDSEMYHVNCAPGAQPWPPPPRQPRWD |
| Ga0307410_114165492 | 3300031852 | Rhizosphere | PGGRLASMDVTERRCPACGERIEDGETVVFFGGEMYHLECAPGAPLWPPRPREPRF |
| Ga0307406_116420972 | 3300031901 | Rhizosphere | MNGPERACPACGEPIEDGETVVFFGGEMFHLDCAPGAVAWPPPPREPRF |
| Ga0307412_106654562 | 3300031911 | Rhizosphere | MDGVERTCPACGDPIEDGETVVFFGGEMFHLDCAPGTLAWPPPPREPRF |
| Ga0307411_102606523 | 3300032005 | Rhizosphere | MDGPERACPACGEPIEDGETVVFFGGEMFHLDCAPGAVAWPPPPREPRF |
| Ga0247829_115187432 | 3300033550 | Soil | MEGTERTCPACGDRIEDGETVVFFGGEMFHLDCAPGAIAWPPPPREPRF |
| Ga0364946_044700_57_206 | 3300033815 | Sediment | MEGTERNCPACGDLIEDGETVVFFGGEMYHLDCAPGALPWPPPPREPRF |
| ⦗Top⦘ |