| Basic Information | |
|---|---|
| Family ID | F067595 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPKPLRPAA |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 75.20 % |
| % of genes near scaffold ends (potentially truncated) | 40.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.20 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (67.200 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (38.400 % of family members) |
| Environment Ontology (ENVO) | Unclassified (71.200 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (75.200 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 18.00% β-sheet: 24.00% Coil/Unstructured: 58.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF01817 | CM_2 | 25.60 |
| PF03255 | ACCA | 10.40 |
| PF01039 | Carboxyl_trans | 8.80 |
| PF01842 | ACT | 8.00 |
| PF01715 | IPPT | 4.80 |
| PF14248 | DUF4345 | 0.80 |
| PF12911 | OppC_N | 0.80 |
| PF08340 | DUF1732 | 0.80 |
| PF00155 | Aminotran_1_2 | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG1605 | Chorismate mutase | Amino acid transport and metabolism [E] | 25.60 |
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 19.20 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 8.80 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 8.80 |
| COG0324 | tRNA A37 N6-isopentenylltransferase MiaA | Translation, ribosomal structure and biogenesis [J] | 4.80 |
| COG1561 | Endoribonuclease YloC, YicC family | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 67.20 % |
| Unclassified | root | N/A | 32.80 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002558|JGI25385J37094_10206950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 524 | Open in IMG/M |
| 3300002560|JGI25383J37093_10106902 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300002561|JGI25384J37096_10163611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 691 | Open in IMG/M |
| 3300005166|Ga0066674_10007637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4350 | Open in IMG/M |
| 3300005166|Ga0066674_10042204 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
| 3300005166|Ga0066674_10233809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 873 | Open in IMG/M |
| 3300005166|Ga0066674_10328470 | Not Available | 718 | Open in IMG/M |
| 3300005171|Ga0066677_10722738 | Not Available | 556 | Open in IMG/M |
| 3300005174|Ga0066680_10177102 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
| 3300005175|Ga0066673_10312052 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 917 | Open in IMG/M |
| 3300005175|Ga0066673_10344141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 870 | Open in IMG/M |
| 3300005176|Ga0066679_10772295 | Not Available | 616 | Open in IMG/M |
| 3300005177|Ga0066690_10399699 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300005177|Ga0066690_10997964 | Not Available | 527 | Open in IMG/M |
| 3300005178|Ga0066688_10166990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1385 | Open in IMG/M |
| 3300005178|Ga0066688_10927859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 535 | Open in IMG/M |
| 3300005181|Ga0066678_10159788 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1415 | Open in IMG/M |
| 3300005181|Ga0066678_10874165 | Not Available | 590 | Open in IMG/M |
| 3300005181|Ga0066678_11029801 | Not Available | 532 | Open in IMG/M |
| 3300005186|Ga0066676_10357121 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 978 | Open in IMG/M |
| 3300005186|Ga0066676_10881465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300005445|Ga0070708_101299364 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005447|Ga0066689_10533634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 741 | Open in IMG/M |
| 3300005450|Ga0066682_10585500 | Not Available | 702 | Open in IMG/M |
| 3300005450|Ga0066682_10618466 | Not Available | 677 | Open in IMG/M |
| 3300005467|Ga0070706_100722229 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 923 | Open in IMG/M |
| 3300005468|Ga0070707_100043886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4280 | Open in IMG/M |
| 3300005468|Ga0070707_100412609 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300005468|Ga0070707_100824523 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 891 | Open in IMG/M |
| 3300005540|Ga0066697_10208517 | Not Available | 1161 | Open in IMG/M |
| 3300005552|Ga0066701_10956394 | Not Available | 507 | Open in IMG/M |
| 3300005554|Ga0066661_10078778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1937 | Open in IMG/M |
| 3300005554|Ga0066661_10597831 | Not Available | 655 | Open in IMG/M |
| 3300005555|Ga0066692_10343107 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 947 | Open in IMG/M |
| 3300005555|Ga0066692_10404152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 866 | Open in IMG/M |
| 3300005556|Ga0066707_10284277 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1082 | Open in IMG/M |
| 3300005556|Ga0066707_10659917 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300005558|Ga0066698_10087465 | All Organisms → cellular organisms → Bacteria | 2039 | Open in IMG/M |
| 3300005576|Ga0066708_10002574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 6991 | Open in IMG/M |
| 3300005576|Ga0066708_10443438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 833 | Open in IMG/M |
| 3300005587|Ga0066654_10209608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1016 | Open in IMG/M |
| 3300006031|Ga0066651_10812803 | Not Available | 508 | Open in IMG/M |
| 3300006034|Ga0066656_10660668 | Not Available | 673 | Open in IMG/M |
| 3300006791|Ga0066653_10540435 | Not Available | 590 | Open in IMG/M |
| 3300006797|Ga0066659_11586705 | Not Available | 549 | Open in IMG/M |
| 3300006914|Ga0075436_101135066 | Not Available | 589 | Open in IMG/M |
| 3300007076|Ga0075435_101626069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 567 | Open in IMG/M |
| 3300007265|Ga0099794_10160811 | Not Available | 1142 | Open in IMG/M |
| 3300009012|Ga0066710_101073237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1245 | Open in IMG/M |
| 3300009012|Ga0066710_102517867 | Not Available | 743 | Open in IMG/M |
| 3300009012|Ga0066710_102648661 | Not Available | 718 | Open in IMG/M |
| 3300009012|Ga0066710_103530488 | Not Available | 591 | Open in IMG/M |
| 3300009012|Ga0066710_103636729 | Not Available | 581 | Open in IMG/M |
| 3300009038|Ga0099829_10146770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1880 | Open in IMG/M |
| 3300009089|Ga0099828_10554841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1035 | Open in IMG/M |
| 3300009137|Ga0066709_101541979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 955 | Open in IMG/M |
| 3300010136|Ga0127447_1101483 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR30 | 666 | Open in IMG/M |
| 3300010304|Ga0134088_10135186 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
| 3300010304|Ga0134088_10620301 | Not Available | 539 | Open in IMG/M |
| 3300010326|Ga0134065_10227313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 687 | Open in IMG/M |
| 3300010329|Ga0134111_10003809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4580 | Open in IMG/M |
| 3300010335|Ga0134063_10234092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 871 | Open in IMG/M |
| 3300010336|Ga0134071_10157920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1106 | Open in IMG/M |
| 3300011269|Ga0137392_10105635 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300011270|Ga0137391_10183373 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300012189|Ga0137388_10212939 | Not Available | 1746 | Open in IMG/M |
| 3300012189|Ga0137388_10234465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1666 | Open in IMG/M |
| 3300012198|Ga0137364_10134279 | All Organisms → cellular organisms → Bacteria | 1776 | Open in IMG/M |
| 3300012200|Ga0137382_10163675 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1515 | Open in IMG/M |
| 3300012201|Ga0137365_11130637 | Not Available | 563 | Open in IMG/M |
| 3300012205|Ga0137362_10959802 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR30 | 729 | Open in IMG/M |
| 3300012205|Ga0137362_11008422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 709 | Open in IMG/M |
| 3300012205|Ga0137362_11521415 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 556 | Open in IMG/M |
| 3300012351|Ga0137386_10081491 | All Organisms → cellular organisms → Bacteria | 2268 | Open in IMG/M |
| 3300012373|Ga0134042_1059139 | Not Available | 513 | Open in IMG/M |
| 3300012407|Ga0134050_1194192 | Not Available | 708 | Open in IMG/M |
| 3300012930|Ga0137407_11842343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 577 | Open in IMG/M |
| 3300012972|Ga0134077_10064598 | Not Available | 1371 | Open in IMG/M |
| 3300012977|Ga0134087_10404401 | Not Available | 666 | Open in IMG/M |
| 3300014150|Ga0134081_10129607 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300014154|Ga0134075_10252128 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300015245|Ga0137409_11207459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300017654|Ga0134069_1177149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 721 | Open in IMG/M |
| 3300017657|Ga0134074_1079077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1122 | Open in IMG/M |
| 3300017657|Ga0134074_1250232 | Not Available | 637 | Open in IMG/M |
| 3300017659|Ga0134083_10255793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 734 | Open in IMG/M |
| 3300017659|Ga0134083_10258042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 731 | Open in IMG/M |
| 3300018431|Ga0066655_10006896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 4718 | Open in IMG/M |
| 3300018431|Ga0066655_10015092 | All Organisms → cellular organisms → Bacteria | 3465 | Open in IMG/M |
| 3300018431|Ga0066655_10779285 | Not Available | 650 | Open in IMG/M |
| 3300018433|Ga0066667_10401745 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1107 | Open in IMG/M |
| 3300018433|Ga0066667_10635957 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 892 | Open in IMG/M |
| 3300018433|Ga0066667_10863270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 776 | Open in IMG/M |
| 3300018433|Ga0066667_11664868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 571 | Open in IMG/M |
| 3300018482|Ga0066669_12428153 | Not Available | 503 | Open in IMG/M |
| 3300020583|Ga0210401_10829720 | Not Available | 784 | Open in IMG/M |
| 3300021432|Ga0210384_11239790 | Not Available | 650 | Open in IMG/M |
| 3300025910|Ga0207684_10288449 | Not Available | 1415 | Open in IMG/M |
| 3300025910|Ga0207684_11376879 | Not Available | 578 | Open in IMG/M |
| 3300025922|Ga0207646_10097598 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2633 | Open in IMG/M |
| 3300026277|Ga0209350_1025088 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
| 3300026277|Ga0209350_1057483 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1118 | Open in IMG/M |
| 3300026296|Ga0209235_1190078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 743 | Open in IMG/M |
| 3300026297|Ga0209237_1023291 | All Organisms → cellular organisms → Bacteria | 3493 | Open in IMG/M |
| 3300026301|Ga0209238_1173529 | Not Available | 636 | Open in IMG/M |
| 3300026307|Ga0209469_1014102 | All Organisms → cellular organisms → Bacteria | 2917 | Open in IMG/M |
| 3300026313|Ga0209761_1298076 | Not Available | 563 | Open in IMG/M |
| 3300026324|Ga0209470_1121926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1157 | Open in IMG/M |
| 3300026325|Ga0209152_10394434 | Not Available | 541 | Open in IMG/M |
| 3300026326|Ga0209801_1122900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1112 | Open in IMG/M |
| 3300026327|Ga0209266_1001735 | All Organisms → cellular organisms → Bacteria | 14156 | Open in IMG/M |
| 3300026333|Ga0209158_1359577 | Not Available | 507 | Open in IMG/M |
| 3300026334|Ga0209377_1025221 | All Organisms → cellular organisms → Bacteria | 2933 | Open in IMG/M |
| 3300026334|Ga0209377_1080079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1389 | Open in IMG/M |
| 3300026342|Ga0209057_1184491 | Not Available | 599 | Open in IMG/M |
| 3300026523|Ga0209808_1000197 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 31801 | Open in IMG/M |
| 3300026528|Ga0209378_1056931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1862 | Open in IMG/M |
| 3300026528|Ga0209378_1184684 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 733 | Open in IMG/M |
| 3300026530|Ga0209807_1280885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300026550|Ga0209474_10498738 | Not Available | 617 | Open in IMG/M |
| 3300026557|Ga0179587_10819798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 614 | Open in IMG/M |
| 3300027875|Ga0209283_10116635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1756 | Open in IMG/M |
| 3300031820|Ga0307473_10480248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 834 | Open in IMG/M |
| 3300031962|Ga0307479_10292182 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1611 | Open in IMG/M |
| 3300032180|Ga0307471_100433373 | All Organisms → cellular organisms → Bacteria | 1450 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 38.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 18.40% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 14.40% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.40% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.60% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.60% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300010136 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25385J37094_102069502 | 3300002558 | Grasslands Soil | MNVELALLAPLVWGLGGLVAVLVLVRDRHASWEGPIRIETTGPKPLRPAA* |
| JGI25383J37093_101069022 | 3300002560 | Grasslands Soil | MNVELALLAPLVWGLGGLVAVLVLVRDRHASWEGPIRIETTGPKPLRPA |
| JGI25384J37096_101636111 | 3300002561 | Grasslands Soil | MNVELALLAPLVWGLGGLVAVLVLVRDRHASWEGPIRIETTEPKPLRPAA* |
| Ga0066674_100076374 | 3300005166 | Soil | MSVELASLAPLLWGLGGLVAAYVLTRDRHASSEGPIRIETTGPRPLRPAA* |
| Ga0066674_100422041 | 3300005166 | Soil | MNVELASLAPLVWGLGGLVAVLVLARDRHASSEGPVRIETTPPEPLRPAA* |
| Ga0066674_102338091 | 3300005166 | Soil | MNVELASLAPLVWGLGGLVAVLVLARDPHASSEGPTRIETTGPKPLRPAA* |
| Ga0066674_103284701 | 3300005166 | Soil | MNVELAVLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPKPLRPAA* |
| Ga0066677_107227381 | 3300005171 | Soil | MNVELASLAPLVWGLGGLVAVLVLARDPHASSEGPTRVETTGPKPLRPAA* |
| Ga0066680_101771023 | 3300005174 | Soil | LAPLVWGLGGLVAVLVLARDRHASSEGPVRIETTPPEPLRPAA* |
| Ga0066673_103120521 | 3300005175 | Soil | MNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPKPLRPAA* |
| Ga0066673_103441411 | 3300005175 | Soil | MNVELASLAPLLWGLGGLVAVLVLARDRHASSEGPTRVETTGPKPLRPAA* |
| Ga0066679_107722951 | 3300005176 | Soil | MNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETPGPKPLRPAA* |
| Ga0066690_103996992 | 3300005177 | Soil | MSVELASLAPLLWALGGLVAVYVLTRDRHASSEGPIRIETTGPKPLRPAA* |
| Ga0066690_109979641 | 3300005177 | Soil | MNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPIRIET |
| Ga0066688_101669901 | 3300005178 | Soil | APLVWGLGGLVAVLVLARDRHASSEGPVRIETTPPEPLRPAA* |
| Ga0066688_109278591 | 3300005178 | Soil | MSVELASLAPLLWALGGLVAVYVLTRDRHASSEGPIRIETTGPPLRPAA* |
| Ga0066678_101597883 | 3300005181 | Soil | KEGDTMNVELASLAPLVWGLGGLVAVLVLARDRHASSEGPVRIETTPPEPLRPAA* |
| Ga0066678_108741651 | 3300005181 | Soil | MNVELAMLAPLVWGLGGLVAVLVLVRDRHASWEGPIRIETTEPKPLRPAA* |
| Ga0066678_110298012 | 3300005181 | Soil | MNVELASLAPLLWGLGGLVAVLVLARDPHASSEGPTRIETTGPKPLRPAA* |
| Ga0066676_103571212 | 3300005186 | Soil | MNVELLVLAPLVWGLCGLVAVLVLARDPHASSEGPIRIETTGPKPLRPAA* |
| Ga0066676_108814652 | 3300005186 | Soil | MNVELAMLAPLVWGLGGLVAVLVLVRDRHASSEGPFRIETTGPKPLRPAA* |
| Ga0070708_1012993641 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | DTMNVELAMLAPLVWGFGGLIAVLVLVRDRHASSEGPIRIETAKPLRPAA* |
| Ga0066689_105336341 | 3300005447 | Soil | MNVELASLAPLVWGLGGLVAVLVLVRDRHASREGPIRTETTGPKPLRPAA* |
| Ga0066682_105855002 | 3300005450 | Soil | MNVELAVLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPKPL |
| Ga0066682_106184662 | 3300005450 | Soil | MNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPKPL |
| Ga0070706_1007222292 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVELAMLAPLVWGLAGLIAVLVLVRDRHSSSEGPIRIETGATRPLRPAA* |
| Ga0070707_1000438865 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVELAMLAPLVWGFGGLIAVLVLVRDRHASSEGPIRIETAKPLRPAA* |
| Ga0070707_1004126093 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVELASLAPLVWGLGGLVAMLFLARDRHASSEGPVRIETTPPEPLRPAA* |
| Ga0070707_1008245231 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVEFAVLAPLVWGLGGLVAVLVLVRDRHASWEGPIRIETTGPKPLRPAA* |
| Ga0066697_102085171 | 3300005540 | Soil | MSVELASLAPLLWGLGGLVAAYVLTRDRHASSEGPIRIETTGP |
| Ga0066701_109563941 | 3300005552 | Soil | MSVELASLAPLLWSLGGLVAVYVLTRDRHASSEGPIRIETTGPPLRPAA* |
| Ga0066661_100787783 | 3300005554 | Soil | MNVELALVAPLVWGLGGLVAVLVLVRDRHASWKGPIRIETTGPKPL |
| Ga0066661_105978312 | 3300005554 | Soil | WKEGDTMNVELASLAPLVWGLGGLVAVLVLARDRHASSEGPVRIETTPPEPLRPAA* |
| Ga0066692_103431071 | 3300005555 | Soil | MNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPLRIETTGPKPLRPAA* |
| Ga0066692_104041522 | 3300005555 | Soil | MNVELALVAPLVWGLGGLVAVLVLVRDRHASWEGPIRIETTEPKPLRPAA* |
| Ga0066707_102842772 | 3300005556 | Soil | MNVELALLAPLVWGLGGLVAVLVLVRDRHASSEGPIRIETGAPKPLRPAA* |
| Ga0066707_106599172 | 3300005556 | Soil | MNVELASLAPLVWGLGGLVAVLVLARDRHASSEGPTRIETTGPKPLRPAA* |
| Ga0066698_100874651 | 3300005558 | Soil | GLVAAYVLTRDRHASSEGPIRIETTGPRPLRPAA* |
| Ga0066708_100025743 | 3300005576 | Soil | MNVELASLAPLVWGLGGLVAVLVLARDRHASLEGPVRIETTPPEPLRPAA* |
| Ga0066708_104434381 | 3300005576 | Soil | MSVELASLAPLLWALGGLVAVYVLTRDRHASSEGPIRIETTGP |
| Ga0066654_102096081 | 3300005587 | Soil | APLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPKPLRPAA* |
| Ga0066651_108128032 | 3300006031 | Soil | LAPLVWGLGGLVAVLVLVRDRHASSEGPIRIETGAPKPLRPAA* |
| Ga0066656_106606681 | 3300006034 | Soil | MNVELALLAPLVWALGGLVAVLVLARDPHASSEGPIRIET |
| Ga0066653_105404351 | 3300006791 | Soil | MNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPIRI |
| Ga0066659_115867053 | 3300006797 | Soil | RWKEGDTMNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETPGPKPLRPAA* |
| Ga0075436_1011350661 | 3300006914 | Populus Rhizosphere | LAPLVWGLGGLVALLVLVRDRHAASERPVRIEVTRPVRPAA* |
| Ga0075435_1016260692 | 3300007076 | Populus Rhizosphere | MNVDLAMLAPLVWGLGGLVALLVLVRDRHAASEGPVRIEVTRPVRPAA* |
| Ga0099794_101608111 | 3300007265 | Vadose Zone Soil | MNVEFALLAPLVWGLGGLVAVLLLARDPHASSEGPIRIETTGPKPLRPAA* |
| Ga0066710_1010732372 | 3300009012 | Grasslands Soil | MNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETPGPKPLRPAA |
| Ga0066710_1025178671 | 3300009012 | Grasslands Soil | MNVELAVLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPKPLR |
| Ga0066710_1026486611 | 3300009012 | Grasslands Soil | MNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPKPLR |
| Ga0066710_1035304882 | 3300009012 | Grasslands Soil | MNVELALLAPLVWALGGLVAVLLLARDRHASAEGPIRIEVTAPKPLRPAA |
| Ga0066710_1036367292 | 3300009012 | Grasslands Soil | MNVELALLAPLVWALGGLVALLLLARDRHASAEGPIRIEVTAPKPLRPAA |
| Ga0099829_101467702 | 3300009038 | Vadose Zone Soil | MNVELAVLAPLVWGLCGLVAVLVLARDPHASSEGPIRIETRAHRPLRPAA* |
| Ga0099828_105548411 | 3300009089 | Vadose Zone Soil | MNVEVAMLAPLVWGLAGLIAVLVLVRDRHSSSEGPIRIDTGAARPLRPAA* |
| Ga0066709_1015419792 | 3300009137 | Grasslands Soil | MNVELAVLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPEPLRPAA* |
| Ga0127447_11014831 | 3300010136 | Grasslands Soil | WGLGGLVAVLVLARDRHASSEGPVRIETTPPEPLRPAA* |
| Ga0134088_101351861 | 3300010304 | Grasslands Soil | NVELASLAPLVWGLGGLVAVLVLARDRHASSEGPVRIETTPPEPLRPAA* |
| Ga0134088_106203012 | 3300010304 | Grasslands Soil | MNVELLAMLAPLVWGLGGLVAVLVLVRDRHASSEGPFRIETTGSKPLRPAA* |
| Ga0134065_102273132 | 3300010326 | Grasslands Soil | LAPLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPKPLRPAA* |
| Ga0134111_100038095 | 3300010329 | Grasslands Soil | GGLVAVLVLARDRHASSEGPVRIETTPPEPLRPAA* |
| Ga0134063_102340921 | 3300010335 | Grasslands Soil | MNVELAVLAPLVWGLGGLVAVLLLARDPHASSEGPIRIETTGPKPLRPAA* |
| Ga0134071_101579201 | 3300010336 | Grasslands Soil | AMLAPLVWGLGGLVAVLVLVRDRHASSEGPFRIETTGSKPLRPAA* |
| Ga0137392_101056353 | 3300011269 | Vadose Zone Soil | MNVELALLAPLVWGLGGRGAVLDLARDPHASSEGPIRIETRAHKPLRPAA* |
| Ga0137391_101833732 | 3300011270 | Vadose Zone Soil | MNVELALLAPLVWALGGLVAVLVLARDPHASSEGPIRIEASAPKPLRPAA* |
| Ga0137388_102129393 | 3300012189 | Vadose Zone Soil | MNVEVAMLAPLVWGLAGLIAVLVLVRDRHPSSEGPIRIDTGAARPLRPAA* |
| Ga0137388_102344652 | 3300012189 | Vadose Zone Soil | MNVELALLAPLVWGLGGLVAVLVLVRDRHASGEGPIRIETTGPKPLRPAA* |
| Ga0137364_101342791 | 3300012198 | Vadose Zone Soil | MNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPEPLRPAA* |
| Ga0137382_101636752 | 3300012200 | Vadose Zone Soil | MNVELAVLAPLVWGLGGLVAVLVLARDPHASSEGPIWIETTGPKPLRPAA* |
| Ga0137365_111306371 | 3300012201 | Vadose Zone Soil | MNVELAVLAPLVWGLGGLVAVLLLARDPHASSEGPIRI |
| Ga0137362_109598021 | 3300012205 | Vadose Zone Soil | TMNVEFALLAPLVWGLGGLVAVLVLARDRHASSEGPVRIETTPPEPLRPAA* |
| Ga0137362_110084221 | 3300012205 | Vadose Zone Soil | MNVELALLAPLVWGLGGLVAVLLLARDPHASSEGPIRIETTGPKPLRPAA* |
| Ga0137362_115214151 | 3300012205 | Vadose Zone Soil | VWGLGGLVAVLVLVRDRHASWEGPIRIETTGPKPLRPAA* |
| Ga0137386_100814911 | 3300012351 | Vadose Zone Soil | LAVLAPLVWGLGGLVAVLLLARDPHASSEGPIRIETTGPKPLRPAA* |
| Ga0134042_10591392 | 3300012373 | Grasslands Soil | VWGLGGIVAVLVLARDRHASSEGPVRIETTPPEPLRPAA* |
| Ga0134050_11941922 | 3300012407 | Grasslands Soil | DTMNVELASLAPLVWGLGGLVAVLVLARDRHASSEGPVRIETTPPEPLRPAA* |
| Ga0137407_118423432 | 3300012930 | Vadose Zone Soil | ALESWKEGDTMNVELALLAPLVWGLGGLVAVLVLVRDRHASWEGPIRIETTGPKPLRPAA |
| Ga0134077_100645982 | 3300012972 | Grasslands Soil | MNVELAMLAPLVWGLGGLVAVLVLVRDRHASSEGPFRIETTGSKPLRPAA* |
| Ga0134087_104044011 | 3300012977 | Grasslands Soil | MSVELASLAPLLWALGGLVAVYVLTRDRHASSEGPIRIETT |
| Ga0134081_101296072 | 3300014150 | Grasslands Soil | MNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETT |
| Ga0134075_102521282 | 3300014154 | Grasslands Soil | MNVELLAMLAPLVWGLGGLVAVLVLVRDRHASSEGPVRIETTPPEPLRPAA* |
| Ga0137409_112074592 | 3300015245 | Vadose Zone Soil | EGDTMNVELAVLAPLVWGLGGLVAVLLIARAPHASSEGPIRIETTGPKPLRPAA* |
| Ga0134069_11771492 | 3300017654 | Grasslands Soil | VELAVLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPKPLRPAA |
| Ga0134074_10790771 | 3300017657 | Grasslands Soil | LAPLVWGLGGLVAVLVLARDRHASSEGPVRIETTPPEPLRPAA |
| Ga0134074_12502322 | 3300017657 | Grasslands Soil | MNVELASLAPLVWGLGGLVAVLVLARDRHASSEGPVRIETTPPEPL |
| Ga0134083_102557931 | 3300017659 | Grasslands Soil | NVELASLAPLLWGLGGLVAVLVLARDPHASSEGPIRIETTGPKPLRPAA |
| Ga0134083_102580421 | 3300017659 | Grasslands Soil | MNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETRAHKPLRPAA |
| Ga0066655_100068965 | 3300018431 | Grasslands Soil | MNVELASLAPLVWGLGGLVAVLVLARDRHASSEGPVRIETTPPEPLRPAA |
| Ga0066655_100150924 | 3300018431 | Grasslands Soil | MSVELASLAPLLWGLGGLVAAYVLTRDRHASSEGPIRIETTGPPLRPAA |
| Ga0066655_107792852 | 3300018431 | Grasslands Soil | MNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPKPLRPAA |
| Ga0066667_104017451 | 3300018433 | Grasslands Soil | MNVELALLAPLVWGLGGLVAVLVLVRDRHASSEGPIRIETGAPKPLRPAA |
| Ga0066667_106359571 | 3300018433 | Grasslands Soil | APLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPKPLRPAA |
| Ga0066667_108632702 | 3300018433 | Grasslands Soil | MSVELASLAPLLWALGGLVAVYVLTRDRHASSEGPIRIETTGPPLRPAA |
| Ga0066667_116648682 | 3300018433 | Grasslands Soil | MNVELASLAPLVWGLGGLVAVLVLARDPHASSEGPTRIETTGPKPLRPAA |
| Ga0066669_124281531 | 3300018482 | Grasslands Soil | MNVELASLAPLLWGLGGLVAVLVLARDRHASSEGPTRVETTGPKPLRPAA |
| Ga0210401_108297202 | 3300020583 | Soil | MSVIELAMLAPLAWGLGGLVAVFVLTRDRDASAEGPIRIEATRPLRPVA |
| Ga0210384_112397901 | 3300021432 | Soil | MNVIELAMLAPLAWGLGGLVAVFVLTRDRDASAEGPIRIEATRP |
| Ga0207684_102884492 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVELAMLAPLVWGLAGLIAVLVLVRDRHSSSEGPIRIETGATRPLRPAA |
| Ga0207684_113768792 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVELAMLAPLVWGFGGLIAVLVLVRDRHASSEGPIRIETAKPLRPAA |
| Ga0207646_100975982 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MNVELASLAPLVWGLGGLVAMLFLARDRHASSEGPVRIETTPPEPLRPAA |
| Ga0209350_10250882 | 3300026277 | Grasslands Soil | MNVELASLAPLLWGLGGLVAVLVLARDPHASSEGPTRVETTGPKPLRPAA |
| Ga0209350_10574833 | 3300026277 | Grasslands Soil | VELASLAPLVWGLGGLVAVLVLARDRHASSEGPVRIETTPPEPLRPAA |
| Ga0209235_11900782 | 3300026296 | Grasslands Soil | MNVELALLAPLVWGLGGLVAVLVLVRDRHASWEGPIRIETTGPKPLRPAA |
| Ga0209237_10232914 | 3300026297 | Grasslands Soil | MNVELALLAPLVWGLGGLVAVLVLVRDRHASWEGPIRIETTEPKPLRPAA |
| Ga0209238_11735292 | 3300026301 | Grasslands Soil | MNVELALLAPLVWGLGGLVAVLVLVRDRHVSWEGPIRIETTGPKPLRPAA |
| Ga0209469_10141024 | 3300026307 | Soil | MNVELAVLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPKPLRPAA |
| Ga0209761_12980761 | 3300026313 | Grasslands Soil | MNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPLR |
| Ga0209470_11219262 | 3300026324 | Soil | MNVELAMLAPLVWGLGGLVAVLVLVRDRHASSEGPFRIETTGPKPLRPAA |
| Ga0209152_103944341 | 3300026325 | Soil | MNVELASLAPLVWGLGGLVAVLVLARDRHASSEGPV |
| Ga0209801_11229001 | 3300026326 | Soil | WKEGDTMNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPIRIETTGPKPLRPAA |
| Ga0209266_10017354 | 3300026327 | Soil | MSVELASLAPLLWGLGGLVAAYVLTRDRHASSEGPIRIETTGPRPLRPAA |
| Ga0209158_13595772 | 3300026333 | Soil | MSVELASLAPLLWALGGLVAVYVLTRDRHASSEGPIRIETPGPKPLRPAA |
| Ga0209377_10252212 | 3300026334 | Soil | MNVELALVAPLVWGLGGLVAVLVLVRDRHASWEGPIRIETTEPKPLRPAA |
| Ga0209377_10800792 | 3300026334 | Soil | MNVELALLAPLVWGLGGLVAVLVLARDPHASSEGPLRIETTGPKPLRPAA |
| Ga0209057_11844912 | 3300026342 | Soil | MNVELASLAPLVWGLGGLVAVLVLVRDRHASREGPIRTETTGPKPLRPAA |
| Ga0209808_100019723 | 3300026523 | Soil | MNVELASLAPLVWGLGGLVAVLVLARDRHASLEGPVRIETTPPEPLRPAA |
| Ga0209378_10569313 | 3300026528 | Soil | MNVELASLAPLVWGLGGLVAVLVLARDRHASSEGPTRIETTGPKPLRPAA |
| Ga0209378_11846841 | 3300026528 | Soil | IVPGSGKEGDTMSVELASLAPLLWALGGLVAVYVLTRDRHASSEGPIRIETTGPPLRPAA |
| Ga0209807_12808853 | 3300026530 | Soil | LGGLVAVLVLVRDRHASWEGPIRIETTEPKPLRPAA |
| Ga0209474_104987382 | 3300026550 | Soil | MSVELASLAPLLWALGGLVAIYVLTRDRHASSEGPIRIETTGPPLRPAA |
| Ga0179587_108197982 | 3300026557 | Vadose Zone Soil | MNVELALLAPLVWGLGGLVVVLVLVRDRHASWEGPIRIETTGPKPLRPAA |
| Ga0209283_101166352 | 3300027875 | Vadose Zone Soil | MNVELAVLAPLVWGLCGLVAVLVLARDPHASSEGPIRIETRAHRPLRPAA |
| Ga0307473_104802482 | 3300031820 | Hardwood Forest Soil | MNVEPPLVWGLGGLVAVLVLVRDRHASWEGPIRIETTGPKPLRPAA |
| Ga0307479_102921822 | 3300031962 | Hardwood Forest Soil | MNEIELAALAPLVWALGGLVAVLVLARDPHASSEGPIRIETTGPKPLRPAA |
| Ga0307471_1004333731 | 3300032180 | Hardwood Forest Soil | MNVELALLAPLVWGLGGLVAVLVLVRDRHASWEGPIRIETTGPKPLRPAP |
| ⦗Top⦘ |