| Basic Information | |
|---|---|
| Family ID | F067594 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 38 residues |
| Representative Sequence | AALAYELLYLRPLRPVPVGPPETGIEEPRPGDAAVS |
| Number of Associated Samples | 111 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.64 % |
| % of genes near scaffold ends (potentially truncated) | 96.00 % |
| % of genes from short scaffolds (< 2000 bps) | 92.00 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (84.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (21.600 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF01380 | SIS | 8.00 |
| PF02230 | Abhydrolase_2 | 7.20 |
| PF00034 | Cytochrom_C | 5.60 |
| PF13442 | Cytochrome_CBB3 | 4.80 |
| PF00127 | Copper-bind | 4.00 |
| PF04185 | Phosphoesterase | 4.00 |
| PF14742 | GDE_N_bis | 3.20 |
| PF03358 | FMN_red | 3.20 |
| PF02566 | OsmC | 2.40 |
| PF00300 | His_Phos_1 | 2.40 |
| PF00881 | Nitroreductase | 1.60 |
| PF00561 | Abhydrolase_1 | 1.60 |
| PF13231 | PMT_2 | 1.60 |
| PF08359 | TetR_C_4 | 1.60 |
| PF13522 | GATase_6 | 1.60 |
| PF07504 | FTP | 1.60 |
| PF00293 | NUDIX | 1.60 |
| PF05235 | CHAD | 0.80 |
| PF13701 | DDE_Tnp_1_4 | 0.80 |
| PF02880 | PGM_PMM_III | 0.80 |
| PF00005 | ABC_tran | 0.80 |
| PF04945 | YHS | 0.80 |
| PF01904 | DUF72 | 0.80 |
| PF00082 | Peptidase_S8 | 0.80 |
| PF12760 | Zn_Tnp_IS1595 | 0.80 |
| PF00572 | Ribosomal_L13 | 0.80 |
| PF07883 | Cupin_2 | 0.80 |
| PF02769 | AIRS_C | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 4.00 |
| COG1764 | Organic hydroperoxide reductase OsmC/OhrA | Defense mechanisms [V] | 2.40 |
| COG1765 | Uncharacterized OsmC-related protein | General function prediction only [R] | 2.40 |
| COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 1.60 |
| COG3227 | Zn-dependent metalloprotease (Neutral protease B) | Posttranslational modification, protein turnover, chaperones [O] | 1.60 |
| COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.80 |
| COG0102 | Ribosomal protein L13 | Translation, ribosomal structure and biogenesis [J] | 0.80 |
| COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.80 |
| COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.80 |
| COG3025 | Inorganic triphosphatase YgiF, contains CYTH and CHAD domains | Inorganic ion transport and metabolism [P] | 0.80 |
| COG5607 | CHAD domain, binds inorganic polyphosphates | Function unknown [S] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 84.00 % |
| Unclassified | root | N/A | 16.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001205|C688J13580_1030352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 683 | Open in IMG/M |
| 3300001537|A2065W1_10674469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1217 | Open in IMG/M |
| 3300001686|C688J18823_10020287 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 4471 | Open in IMG/M |
| 3300001686|C688J18823_10382008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 913 | Open in IMG/M |
| 3300001991|JGI24743J22301_10135964 | Not Available | 545 | Open in IMG/M |
| 3300004157|Ga0062590_101341338 | Not Available | 707 | Open in IMG/M |
| 3300005093|Ga0062594_102546328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 563 | Open in IMG/M |
| 3300005526|Ga0073909_10451013 | Not Available | 614 | Open in IMG/M |
| 3300005529|Ga0070741_10300683 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300005529|Ga0070741_10532991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1057 | Open in IMG/M |
| 3300005529|Ga0070741_11682617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300005549|Ga0070704_101254590 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
| 3300005556|Ga0066707_10471468 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 815 | Open in IMG/M |
| 3300005560|Ga0066670_10880476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300005561|Ga0066699_10790998 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005563|Ga0068855_101552348 | Not Available | 678 | Open in IMG/M |
| 3300005566|Ga0066693_10363491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300005578|Ga0068854_101829005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300005614|Ga0068856_100386806 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300006046|Ga0066652_101889365 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300006791|Ga0066653_10614719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300006847|Ga0075431_101376695 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300006852|Ga0075433_11976767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300006854|Ga0075425_101520605 | Not Available | 756 | Open in IMG/M |
| 3300006954|Ga0079219_10768351 | Not Available | 749 | Open in IMG/M |
| 3300007076|Ga0075435_100312296 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300007790|Ga0105679_10020960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1443 | Open in IMG/M |
| 3300009012|Ga0066710_100431569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1971 | Open in IMG/M |
| 3300009012|Ga0066710_104754533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 508 | Open in IMG/M |
| 3300009089|Ga0099828_10054230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 3340 | Open in IMG/M |
| 3300009090|Ga0099827_10035516 | All Organisms → cellular organisms → Bacteria | 3642 | Open in IMG/M |
| 3300009094|Ga0111539_10882667 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300009137|Ga0066709_100502568 | All Organisms → cellular organisms → Bacteria | 1708 | Open in IMG/M |
| 3300009148|Ga0105243_10412892 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300009174|Ga0105241_11309068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
| 3300009792|Ga0126374_10255233 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
| 3300009823|Ga0105078_1012066 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300009836|Ga0105068_1097435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300009840|Ga0126313_10525945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 949 | Open in IMG/M |
| 3300009840|Ga0126313_11304825 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300010036|Ga0126305_10458185 | Not Available | 847 | Open in IMG/M |
| 3300010039|Ga0126309_11111536 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300010046|Ga0126384_11129523 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300010303|Ga0134082_10301298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 672 | Open in IMG/M |
| 3300010303|Ga0134082_10441648 | Not Available | 561 | Open in IMG/M |
| 3300010337|Ga0134062_10366423 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300010358|Ga0126370_12077859 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300010403|Ga0134123_10694813 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300012011|Ga0120152_1138744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 652 | Open in IMG/M |
| 3300012204|Ga0137374_11037818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 589 | Open in IMG/M |
| 3300012206|Ga0137380_10666293 | Not Available | 905 | Open in IMG/M |
| 3300012208|Ga0137376_10587572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 964 | Open in IMG/M |
| 3300012211|Ga0137377_10013427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6991 | Open in IMG/M |
| 3300012354|Ga0137366_10210376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1450 | Open in IMG/M |
| 3300012490|Ga0157322_1035679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300012530|Ga0136635_10051082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1252 | Open in IMG/M |
| 3300012892|Ga0157294_10051923 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300012899|Ga0157299_10009063 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300012960|Ga0164301_11820720 | Not Available | 512 | Open in IMG/M |
| 3300012964|Ga0153916_12801807 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300012977|Ga0134087_10606922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 567 | Open in IMG/M |
| 3300012985|Ga0164308_12041556 | Not Available | 534 | Open in IMG/M |
| 3300012987|Ga0164307_11683285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 537 | Open in IMG/M |
| 3300012989|Ga0164305_11506864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 597 | Open in IMG/M |
| 3300013100|Ga0157373_11021853 | Not Available | 618 | Open in IMG/M |
| 3300013100|Ga0157373_11282925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 554 | Open in IMG/M |
| 3300013501|Ga0120154_1058249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 912 | Open in IMG/M |
| 3300014166|Ga0134079_10341490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 678 | Open in IMG/M |
| 3300014488|Ga0182001_10656887 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 514 | Open in IMG/M |
| 3300015358|Ga0134089_10409100 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300015371|Ga0132258_10680097 | All Organisms → cellular organisms → Bacteria | 2590 | Open in IMG/M |
| 3300016387|Ga0182040_11344808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 604 | Open in IMG/M |
| 3300017974|Ga0187777_11103439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
| 3300017974|Ga0187777_11269099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 540 | Open in IMG/M |
| 3300018028|Ga0184608_10361360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
| 3300018061|Ga0184619_10132974 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300018081|Ga0184625_10379267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 732 | Open in IMG/M |
| 3300018422|Ga0190265_11678974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 745 | Open in IMG/M |
| 3300018431|Ga0066655_10436415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Thermoleophilales → Thermoleophilaceae → unclassified Thermoleophilaceae → Thermoleophilaceae bacterium | 864 | Open in IMG/M |
| 3300018433|Ga0066667_10211312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1436 | Open in IMG/M |
| 3300018433|Ga0066667_11798920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 554 | Open in IMG/M |
| 3300019279|Ga0184642_1158912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300020070|Ga0206356_10092701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 684 | Open in IMG/M |
| 3300021078|Ga0210381_10163567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 761 | Open in IMG/M |
| 3300021080|Ga0210382_10118698 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1115 | Open in IMG/M |
| 3300021412|Ga0193736_1015957 | All Organisms → cellular organisms → Bacteria | 968 | Open in IMG/M |
| 3300021445|Ga0182009_10460709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 665 | Open in IMG/M |
| 3300022694|Ga0222623_10411662 | Not Available | 513 | Open in IMG/M |
| 3300023057|Ga0247797_1003685 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
| 3300025915|Ga0207693_11355193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300025917|Ga0207660_10953230 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 700 | Open in IMG/M |
| 3300025981|Ga0207640_11177258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
| 3300025981|Ga0207640_11666058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
| 3300026023|Ga0207677_12141553 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300026078|Ga0207702_11648529 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300026089|Ga0207648_11306002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
| 3300026118|Ga0207675_100011342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8339 | Open in IMG/M |
| 3300026275|Ga0209901_1047740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 956 | Open in IMG/M |
| 3300027866|Ga0209813_10246695 | Not Available | 677 | Open in IMG/M |
| 3300027875|Ga0209283_10236595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1212 | Open in IMG/M |
| 3300028709|Ga0307279_10056240 | Not Available | 654 | Open in IMG/M |
| 3300028711|Ga0307293_10055983 | Not Available | 1228 | Open in IMG/M |
| 3300028711|Ga0307293_10136697 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
| 3300028715|Ga0307313_10277438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
| 3300028720|Ga0307317_10182417 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300028721|Ga0307315_10233944 | Not Available | 574 | Open in IMG/M |
| 3300028722|Ga0307319_10070906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1103 | Open in IMG/M |
| 3300028722|Ga0307319_10296937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300028744|Ga0307318_10159794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 775 | Open in IMG/M |
| 3300028768|Ga0307280_10087670 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300028784|Ga0307282_10378214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 685 | Open in IMG/M |
| 3300028796|Ga0307287_10016509 | All Organisms → cellular organisms → Bacteria | 2535 | Open in IMG/M |
| 3300028814|Ga0307302_10580696 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300028824|Ga0307310_10369833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 707 | Open in IMG/M |
| 3300028824|Ga0307310_10444666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300028881|Ga0307277_10584611 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300028885|Ga0307304_10153243 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300031366|Ga0307506_10183264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 758 | Open in IMG/M |
| 3300031421|Ga0308194_10253208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 591 | Open in IMG/M |
| 3300031938|Ga0308175_101473187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
| 3300032159|Ga0268251_10421474 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300032892|Ga0335081_11981602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 622 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 21.60% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.40% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.20% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 3.20% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.20% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 2.40% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.40% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.60% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.60% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.60% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.60% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.60% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.80% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.80% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.80% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.80% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.80% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.80% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.80% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.80% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.80% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.80% |
| Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001205 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007790 | Microbial communities of desert soil contaminated with blood from dead anthrax infected zebra in Etosha National Park, Namibia. Combined Assembly of 14 sequencing projects | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Host-Associated | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014488 | Bulk soil microbial communities from Mexico - San Felipe (SF) metaG | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019279 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021412 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300023057 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S136-409B-6 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026275 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058 (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031366 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300032159 | Agave microbial communities from Guanajuato, Mexico - As.Ma.e (v2) | Host-Associated | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J13580_10303521 | 3300001205 | Soil | LAYEFFYLHPVSPEPVGPPETGLDEPRPGEAAAR* |
| A2065W1_106744692 | 3300001537 | Permafrost | LVGGALAALLYEWLYLRPLAPVPVGPAETGVREPRPGDAAASS* |
| C688J18823_100202871 | 3300001686 | Soil | TLATLAYEYLYLRPPRPLPVGPPDTGVIEPRPGDAAVS* |
| C688J18823_103820081 | 3300001686 | Soil | AAVVYDRLYLRPVSPEPVGPPETGLDEPRPGDAAAI* |
| JGI24743J22301_101359642 | 3300001991 | Corn, Switchgrass And Miscanthus Rhizosphere | LAYEYLYLRPPRPIPVGPPDTGVDEPRPGDAAVS* |
| Ga0062590_1013413382 | 3300004157 | Soil | LLGAGIAALAYEHLYLRTLSLEPPGPPETGLEEPRPGDAASI* |
| Ga0062594_1025463281 | 3300005093 | Soil | PVVGGAIAAVLYEWLYLRPLAPVPVGPAESGVREPRPGDAAAS* |
| Ga0073909_104510131 | 3300005526 | Surface Soil | ATLAALAYEYLYLRPPRPIPVGPPDTGVDEPRPGDAAVS* |
| Ga0070741_103006831 | 3300005529 | Surface Soil | FAAVLYELLYLRPSPRPTPVGPAGAGLEEPGPGDLAAF* |
| Ga0070741_105329911 | 3300005529 | Surface Soil | AAVGYDWLYLRPLAPPVVGTPESGVAEPRPGDAAQS* |
| Ga0070741_116826171 | 3300005529 | Surface Soil | AVVYELLYLRPSARPAPVGPPETELEEPRPGDTALS* |
| Ga0070704_1012545901 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | GAGLAALAYEHLYLRPLSPEPVGPPETGLEEPGAGDPAAI* |
| Ga0066707_104714682 | 3300005556 | Soil | LAALVYDTLYLRTPRPLLPVGPPDSGVIEPRPGDTSVS* |
| Ga0066670_108804761 | 3300005560 | Soil | ALVYEALYLGPPKPEPVGPPETGVEATAPGTAALE* |
| Ga0066699_107909981 | 3300005561 | Soil | AALGYEWLYLRPLAPPVVGTPESGVAEPRPGDAAES* |
| Ga0068855_1015523481 | 3300005563 | Corn Rhizosphere | GGLAALAYDRLYLRPASPEPVGPPETGLDEPGAGEAATL* |
| Ga0066693_103634911 | 3300005566 | Soil | IAASLYELLYLRPAGPEPVGPPETGVLEEAPGEAATG* |
| Ga0068854_1018290052 | 3300005578 | Corn Rhizosphere | SLYELLYLRPARPEPVGPPETGVEEPGAGEAAIS* |
| Ga0068856_1003868061 | 3300005614 | Corn Rhizosphere | LIGAGLAALAYEHLYLRPLSPEPVGPPETGLEEPGAGDPAAI* |
| Ga0066652_1018893652 | 3300006046 | Soil | GGLAALAYELLYLRPVRPVPVGPPETGIEEPRPGDAAVS* |
| Ga0066653_106147191 | 3300006791 | Soil | VGLNEWLYLRPLAPIPVGPPETGVRDPRPGETAVS* |
| Ga0075431_1013766952 | 3300006847 | Populus Rhizosphere | AALAYEWLYLRPPAPMPVGPPETGVIEPRPGDTAVS* |
| Ga0075433_119767672 | 3300006852 | Populus Rhizosphere | AALLYEYLYLRRLGPEPVGPPETGLDEPAPGEAAGV* |
| Ga0075425_1015206052 | 3300006854 | Populus Rhizosphere | GGAIAALVYEALYLGPPRPEPVGPPETGVEEIAPGTAASE* |
| Ga0079219_107683512 | 3300006954 | Agricultural Soil | VGGAVAALAYEWLYLRPPAPMPVGPPETGVIEPRPSDTAVS* |
| Ga0075435_1003122961 | 3300007076 | Populus Rhizosphere | IVGGAAAALAYEWLYLRPPAPVPVGPPETGVIEPRPGDTAVS* |
| Ga0105679_100209604 | 3300007790 | Soil | ALAALAYEYLYLRPLAPIPVGPPETGVAEPRPGDTAAS* |
| Ga0066710_1004315691 | 3300009012 | Grasslands Soil | VAALAYEYLYLRPLSPVPVGPSETGVREPRPGDTAAS |
| Ga0066710_1047545331 | 3300009012 | Grasslands Soil | AVIAAVMYELLYLRPPRPVPVGPPESGLEEPRPGDAALE |
| Ga0099828_100542303 | 3300009089 | Vadose Zone Soil | LAGGAVAALAYEWLYLRTLRPEPVGPPETGVREPRPGDAAAP* |
| Ga0099827_100355164 | 3300009090 | Vadose Zone Soil | GGSLAALVYDTLYLRTRRPLSPVGTPETGVIEPRPGDAALS* |
| Ga0111539_108826671 | 3300009094 | Populus Rhizosphere | GGILGALAYEWLYLRPLKPPVVGPPETGVVEPRPGDTALS* |
| Ga0066709_1005025684 | 3300009137 | Grasslands Soil | VAAAPAAALAYDWLYPRTLRPQPVGPAETGVREPRPGDAAAS* |
| Ga0105243_104128921 | 3300009148 | Miscanthus Rhizosphere | AALAYDRLYLRPASPEPVGPPETGLDEPGAGEAATL* |
| Ga0105241_113090681 | 3300009174 | Corn Rhizosphere | VIAASLYELLYLRPGAEVEPVGPPETGLEEPRPGDAAAS* |
| Ga0126374_102552331 | 3300009792 | Tropical Forest Soil | GAGIAALAYDHLYLRTLTPVEPPGPPETGLDEPRPGDAASI* |
| Ga0105078_10120662 | 3300009823 | Groundwater Sand | GGGLAALAYDALYLRPLRPLVVGPLETGIEEPRPGDVAA* |
| Ga0105068_10974352 | 3300009836 | Groundwater Sand | ALAYELLYLRPLRPVPVGPPETGIEEPRPGDVAA* |
| Ga0126313_105259451 | 3300009840 | Serpentine Soil | LVGGGAAALLYDLLYLRPPRPVPVGPPETGVEEPGPGDTVVS* |
| Ga0126313_113048252 | 3300009840 | Serpentine Soil | ALAYEWLYLHPTRPVTVVGPPETGVIEPRPGDTAVS* |
| Ga0126305_104581851 | 3300010036 | Serpentine Soil | LAALLYEYLYLRPLAPVPVGHPESGVDEPRPGDSVVS* |
| Ga0126309_111115362 | 3300010039 | Serpentine Soil | VIAAVLYELLYLRPTRPVPVGPPETGLEEPRPGDAALD* |
| Ga0126384_111295231 | 3300010046 | Tropical Forest Soil | ALAYEYVYLRPPAPLPVGPPETGVIEPRPGDSAVS* |
| Ga0134082_103012983 | 3300010303 | Grasslands Soil | AAALLYEYLYLRPVEPAPVGPPETGLEEPRPGETAAS* |
| Ga0134082_104416481 | 3300010303 | Grasslands Soil | ALAYDWLYLRPPRPLPVGPPETGVIEPRPGETAVT* |
| Ga0134062_103664232 | 3300010337 | Grasslands Soil | FAGGALAALAYDYLYLRPPRPEPVGPPETGVIEPRPGDAATS* |
| Ga0126370_120778592 | 3300010358 | Tropical Forest Soil | AALLYEYLYLRPVSPEPVGPPETGLDEPVPGDAAAM* |
| Ga0134123_106948133 | 3300010403 | Terrestrial Soil | ALLFNWLYLRPVDQVPVVGTAESGVLEPRPGDAATD* |
| Ga0134123_127966412 | 3300010403 | Terrestrial Soil | GGAVAAVVYEVLYLRPTQPAPVGTVESELDEPRPGDAALS* |
| Ga0120152_11387441 | 3300012011 | Permafrost | SLYELLYLRPSRPEPVGPPETGVEEPGAGEATTA* |
| Ga0137374_110378181 | 3300012204 | Vadose Zone Soil | VGPAAGAVVAALLYEFLFLHEPPTPVGPPETGVLEPRPGDLASS* |
| Ga0137380_106662931 | 3300012206 | Vadose Zone Soil | ALAYEWLYLRPPRPVPVGPPDTGVIEPRPGNTAVS* |
| Ga0137376_105875721 | 3300012208 | Vadose Zone Soil | PVLGAVAAALAYEWLYLRPLAPVPVGPGETGVREPRPGDAAAS* |
| Ga0137377_100134277 | 3300012211 | Vadose Zone Soil | LAYDTLYLRTPRPLLPVGPPDSGVIEPRPGDTAAS* |
| Ga0137366_102103761 | 3300012354 | Vadose Zone Soil | AGAVVAALAYEWLYLRPLGPTPVGPAETGVLEPRPGDAAAS* |
| Ga0150984_1189974692 | 3300012469 | Avena Fatua Rhizosphere | YLGPFAGGAIAAVLYELLFLRPTQPAVVGTVESELDEPRPGDAALS* |
| Ga0157322_10356791 | 3300012490 | Arabidopsis Rhizosphere | LVGGALAALLYEHVYLRPVSPEPVGPPETGLEEPRPGDAAAT* |
| Ga0136635_100510821 | 3300012530 | Polar Desert Sand | AALAYEFLYLRPLAPVPVGPPETGLEEPRPGETAAS* |
| Ga0157294_100519233 | 3300012892 | Soil | LLYEYLYLRPVSPEPVGPPETGLEEPRPGDAAAM* |
| Ga0157299_100090631 | 3300012899 | Soil | GGALAALLYEYLYLRPVSPEPVGPPETGLEEPRPGDAAAM* |
| Ga0126375_119534162 | 3300012948 | Tropical Forest Soil | GPIVGALVAALGYDYLYLRPAKPPVVGPPETGVEEPGPGETAVS* |
| Ga0164301_118207202 | 3300012960 | Soil | AIAALVYEALYRGPTRPEPVGPPETGVEEIAPGTAAFE* |
| Ga0153916_128018071 | 3300012964 | Freshwater Wetlands | VGGAIAALLYEWLYLRPSARPVPVGPPESGVQEPRPGDLASS* |
| Ga0134087_106069222 | 3300012977 | Grasslands Soil | ALAYEWLYLRPLGPEPVGPPETGVVEPRPGETAVS* |
| Ga0164308_120415563 | 3300012985 | Soil | GLAALVYDRLYLRPVSPEPVGPPETGLDEPRPGDAAAL* |
| Ga0164307_116832852 | 3300012987 | Soil | AAALYELLYLRPGKLIEPVGPPETGVDEPRAGDAALS* |
| Ga0164305_115068641 | 3300012989 | Soil | AASLYELLYLRPERPDPVGPHESGVEEPGVGKAALS* |
| Ga0157373_110218532 | 3300013100 | Corn Rhizosphere | AALAYEYLYLRPPRPLPVGPPDTGVIEPRPGDAAVS* |
| Ga0157373_112829252 | 3300013100 | Corn Rhizosphere | ASVYELLYLRPDRPAPVGPPESGVEEPGAGEAALS* |
| Ga0120154_10582492 | 3300013501 | Permafrost | AALAYEFLYLRPLAPVPVGPPETGLEEPRPGETALS* |
| Ga0134079_103414902 | 3300014166 | Grasslands Soil | VAALAYEWLYLRPPAPLPVGPPETGVIEPRPGDSAVS* |
| Ga0182001_106568872 | 3300014488 | Soil | LAYEHLYLRPLRPVPVGPPETGVEEPRPGDAAVS* |
| Ga0134089_104091001 | 3300015358 | Grasslands Soil | GGALAALAYDYLYLRPPKPEPVGPPETGVIEPGPGEAATS* |
| Ga0132258_106800973 | 3300015371 | Arabidopsis Rhizosphere | IAALAYEWLYLRPAAPLPVGPPETGVIEPRPGDAAVS* |
| Ga0182040_113448082 | 3300016387 | Soil | EAAAALGYEYLYLRPLKPPVVGPPETGVEEPGPGETATS |
| Ga0187777_111034391 | 3300017974 | Tropical Peatland | VFEDALLVAALAYELLYLRPRARPEPAGPSETGVREPRPGDAAAS |
| Ga0187777_112690991 | 3300017974 | Tropical Peatland | LVAALAYEYLYLRPLQPTPVGPPESGVEEPRPGDAAAS |
| Ga0184608_103613602 | 3300018028 | Groundwater Sediment | GGVLAALAYEYLYLRSPGPLPVGPPDSGVIEPRPGDTAVS |
| Ga0184619_101329743 | 3300018061 | Groundwater Sediment | AVLYEWLYLRPPRPIPVGPPETGVIEPRPGETAVS |
| Ga0184625_103792671 | 3300018081 | Groundwater Sediment | GALAALAYDTLYLRALRPLLPVGPPDSGVIEPRPGDSAVS |
| Ga0190265_116789741 | 3300018422 | Soil | GVAALAYELLYLRPLAPAVVGPPETGLEEPRPGEAAVS |
| Ga0066655_104364153 | 3300018431 | Grasslands Soil | AGIAALAYEWLYLRPLAPEPVGPPETGVREPRPGDAAAS |
| Ga0066667_102113123 | 3300018433 | Grasslands Soil | AAAAAGVYELLYLRPGRPEPVGTPESGVDEPRAGEPI |
| Ga0066667_117989201 | 3300018433 | Grasslands Soil | LAALAYDRLYLRRLPPLPVGPPETGVIEPRPGDAAVS |
| Ga0184642_11589122 | 3300019279 | Groundwater Sediment | AVAALLYDWLYLRPAAPVPVGTPESGVLEPRPGDAAA |
| Ga0206356_100927012 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | AASVYELLYLRPARPVPVGQPESGVDEPRPGDAALS |
| Ga0210381_101635672 | 3300021078 | Groundwater Sediment | GLAAFAYDKLYLRPLSPEPVGPPETGLDEPRPGDAAAM |
| Ga0210382_101186983 | 3300021080 | Groundwater Sediment | ALAALAYDTLYLRALRPLLPVGPPDSGVIEPRPGDSAVS |
| Ga0193736_10159572 | 3300021412 | Soil | GAGAISYEWLYLRPLRPPVVGPPETGVVEPRPGDAALS |
| Ga0182009_104607091 | 3300021445 | Soil | ALLYEYLYLRPLEPMPVGPPETGLEEPGPGETALS |
| Ga0222623_104116621 | 3300022694 | Groundwater Sediment | ALGALTYEWLYLRPPAPMPVGPPETGVIEPRPGDTAVS |
| Ga0247797_10036853 | 3300023057 | Soil | AALLYEYLYLRPVSPEPVGPPETGLEEPRPGDAAAM |
| Ga0207693_113551932 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | IAAALYELLYLRPGKLVEPVGAPETGIDEPRPGDAALS |
| Ga0207660_109532301 | 3300025917 | Corn Rhizosphere | ACAYELLYLRPERPEPVGTPESGVEEPGAGKAALS |
| Ga0207640_111772582 | 3300025981 | Corn Rhizosphere | VIAASLYEILYLRPSRPEPVGPPETGVEEPGAGDAALS |
| Ga0207640_116660581 | 3300025981 | Corn Rhizosphere | AVIAASLYELLYLRPARPEPVGPPETGVEEPGAGEAAIS |
| Ga0207677_121415532 | 3300026023 | Miscanthus Rhizosphere | ALTYDWLYLRMRTPVEPVGPPKTGVIEPRPGDTALS |
| Ga0207702_116485291 | 3300026078 | Corn Rhizosphere | VVGAAVAAALYEMLYLRPLAPEPVGPEETGVLEPRPGDTASS |
| Ga0207648_113060023 | 3300026089 | Miscanthus Rhizosphere | ALAYEHLYLRPLSPEPVGPPETGLEEPGAGDPAAI |
| Ga0207675_1000113421 | 3300026118 | Switchgrass Rhizosphere | ALVYEYLYLRPVSPEPVGPPETGLEEPGAGETATA |
| Ga0209901_10477403 | 3300026275 | Permafrost Soil | AAATYELLYLRPAQPVPVGPPETGVDEARPGDAAVS |
| Ga0209813_102466952 | 3300027866 | Populus Endosphere | VGGAVAALAYEWLYLRPPAPMPVGPPETGVIEPRPGDTAVS |
| Ga0209283_102365951 | 3300027875 | Vadose Zone Soil | LAGGAVAALAYEWLYLRTLRPEPVGPPETGVREPRPGDAAAP |
| Ga0307279_100562401 | 3300028709 | Soil | GATLAALVYEYLYLRPPRPIPVGPPDTGVIEPRPGDAAVS |
| Ga0307293_100559832 | 3300028711 | Soil | AGGALGALTYEWLYLRPPAPLPVGPPESGVIEPRPGDTAVS |
| Ga0307293_101366971 | 3300028711 | Soil | IGAALAALVYDTLYLRVQRPLLPVGPPDSGVIEPRPGDTAVS |
| Ga0307313_102774382 | 3300028715 | Soil | VAALLYEWLYLRPLGPIPVGPAETGVREPRPGDAAAS |
| Ga0307317_101824171 | 3300028720 | Soil | AALAYELLYLRPLRPVPVGPPETGIEEPRPGDAAVS |
| Ga0307315_102339441 | 3300028721 | Soil | VGGTIAALLYEWLYLRPLAPVPVGPAETGVLEPRPGDAAAS |
| Ga0307319_100709063 | 3300028722 | Soil | ALAYDTLYLRALRPLLPVGPPDSGVIEPRPGDSAVS |
| Ga0307319_102969371 | 3300028722 | Soil | GGGAAALAYELLYLRPLRPAPVGPPETGIEEPRPGDAAVS |
| Ga0307318_101597941 | 3300028744 | Soil | IGAALAALVYDTLYLRVQRPLLPVGPPDSGVIEPRPGDTAIS |
| Ga0307280_100876703 | 3300028768 | Soil | LAALAYEYLYLRSPRPLPVGPPDSGVIEPRPGDTALS |
| Ga0307282_103782142 | 3300028784 | Soil | VGGVLAALAYEYLYLRSPRPLPVGPPDSGVIEPRPGDAALS |
| Ga0307287_100165091 | 3300028796 | Soil | GGGLAALAYELLYLRPLRPVPVGPPETGIEEPRPGDTAVS |
| Ga0307302_105806961 | 3300028814 | Soil | VLAALAYELLYLRPPRPLPVGPPETGVIEPGPGDAAVS |
| Ga0307310_103698332 | 3300028824 | Soil | ALAYEFLYLRPLAPVPVGPPETGLEEPRPGETAVS |
| Ga0307310_104446662 | 3300028824 | Soil | GGVAALAYELLYLRPLRPVPVGPPETGIEEPRPGDAAVS |
| Ga0307277_105846111 | 3300028881 | Soil | VGAALAAVTYEWLYLRPPRPLPVGTPETGVLEPRPGDTAVS |
| Ga0307304_101532431 | 3300028885 | Soil | GVAALAYELLYLRPLRPVPVGPPETGIEEPRPGDAAVS |
| Ga0307506_101832641 | 3300031366 | Soil | ALLYEMLYLRPLAPEPVGPEETGVVEPRPGDAATS |
| Ga0308194_102532081 | 3300031421 | Soil | LAAALAYEWLYLRPTEPEPVGPPETGVEEPGAGRTAAG |
| Ga0308175_1014731872 | 3300031938 | Soil | VAAAWLYEWLYLRPLAPVPVGPPETGVRAPRPGETAVS |
| Ga0268251_104214742 | 3300032159 | Agave | AALAYDGLYLRPLAPVPVGPPETGVIEPRPGDAAVS |
| Ga0335081_119816021 | 3300032892 | Soil | AIAAALYELLYLRPAGPEPVGPPETGVEEPGPGDAALS |
| ⦗Top⦘ |