| Basic Information | |
|---|---|
| Family ID | F067583 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MRLDINLASQPYEDARQFWMRWGTAVGAVALLTLVLL |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 39.02 % |
| % of genes near scaffold ends (potentially truncated) | 98.40 % |
| % of genes from short scaffolds (< 2000 bps) | 86.40 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.400 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (20.800 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.600 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (56.800 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.54% β-sheet: 0.00% Coil/Unstructured: 58.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF00437 | T2SSE | 11.20 |
| PF05157 | T2SSE_N | 2.40 |
| PF00482 | T2SSF | 1.60 |
| PF11104 | PilM_2 | 0.80 |
| PF00005 | ABC_tran | 0.80 |
| PF03548 | LolA | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG2834 | Outer membrane lipoprotein-sorting protein | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.40 % |
| Unclassified | root | N/A | 1.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459013|GO6OHWN02JBBFZ | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300001593|JGI12635J15846_10503493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 714 | Open in IMG/M |
| 3300003219|JGI26341J46601_10156959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 633 | Open in IMG/M |
| 3300004092|Ga0062389_100207002 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1936 | Open in IMG/M |
| 3300004635|Ga0062388_100082480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2239 | Open in IMG/M |
| 3300004635|Ga0062388_101948176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 606 | Open in IMG/M |
| 3300004969|Ga0072327_1220558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
| 3300005445|Ga0070708_101419706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 647 | Open in IMG/M |
| 3300005454|Ga0066687_10760808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 576 | Open in IMG/M |
| 3300005576|Ga0066708_10726973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 627 | Open in IMG/M |
| 3300005591|Ga0070761_10158356 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1329 | Open in IMG/M |
| 3300005602|Ga0070762_10037810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2615 | Open in IMG/M |
| 3300005712|Ga0070764_11090800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300005921|Ga0070766_10108923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1651 | Open in IMG/M |
| 3300006794|Ga0066658_10333316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 810 | Open in IMG/M |
| 3300006845|Ga0075421_102286111 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| 3300009012|Ga0066710_100320283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2280 | Open in IMG/M |
| 3300009036|Ga0105244_10496367 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300009093|Ga0105240_10475906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1393 | Open in IMG/M |
| 3300009143|Ga0099792_10066019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1811 | Open in IMG/M |
| 3300009522|Ga0116218_1069516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1602 | Open in IMG/M |
| 3300010048|Ga0126373_12833741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300010358|Ga0126370_12003693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300010361|Ga0126378_11183497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300010379|Ga0136449_102500998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300010379|Ga0136449_104125837 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300011269|Ga0137392_10598192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 915 | Open in IMG/M |
| 3300012683|Ga0137398_10279999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1117 | Open in IMG/M |
| 3300012927|Ga0137416_10244799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1462 | Open in IMG/M |
| 3300012986|Ga0164304_10898506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 692 | Open in IMG/M |
| 3300013100|Ga0157373_10212128 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1365 | Open in IMG/M |
| 3300014168|Ga0181534_10137456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1245 | Open in IMG/M |
| 3300016294|Ga0182041_10351177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1239 | Open in IMG/M |
| 3300016702|Ga0181511_1130386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300017936|Ga0187821_10146210 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300017943|Ga0187819_10152676 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1375 | Open in IMG/M |
| 3300017955|Ga0187817_10222848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1202 | Open in IMG/M |
| 3300017955|Ga0187817_10464898 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300018017|Ga0187872_10470265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300018035|Ga0187875_10626042 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300018047|Ga0187859_10441874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300018058|Ga0187766_10326754 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 999 | Open in IMG/M |
| 3300018085|Ga0187772_10136662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1611 | Open in IMG/M |
| 3300018085|Ga0187772_10222112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1275 | Open in IMG/M |
| 3300018085|Ga0187772_10811621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 676 | Open in IMG/M |
| 3300019278|Ga0187800_1185714 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300020582|Ga0210395_10951393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300020583|Ga0210401_10096351 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2779 | Open in IMG/M |
| 3300021171|Ga0210405_10236827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1445 | Open in IMG/M |
| 3300021171|Ga0210405_10965390 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 644 | Open in IMG/M |
| 3300021180|Ga0210396_10917053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300021181|Ga0210388_10027376 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4659 | Open in IMG/M |
| 3300021181|Ga0210388_10051462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3434 | Open in IMG/M |
| 3300021181|Ga0210388_11131753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 667 | Open in IMG/M |
| 3300021403|Ga0210397_10549963 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 878 | Open in IMG/M |
| 3300021403|Ga0210397_11306404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300021404|Ga0210389_10107973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2146 | Open in IMG/M |
| 3300021404|Ga0210389_10147157 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1826 | Open in IMG/M |
| 3300021405|Ga0210387_10135569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2093 | Open in IMG/M |
| 3300021405|Ga0210387_10776269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300021405|Ga0210387_11354025 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 613 | Open in IMG/M |
| 3300021406|Ga0210386_10732272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 852 | Open in IMG/M |
| 3300021407|Ga0210383_10446574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1116 | Open in IMG/M |
| 3300021420|Ga0210394_10034796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4492 | Open in IMG/M |
| 3300021420|Ga0210394_11750134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300021420|Ga0210394_11778337 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300021420|Ga0210394_11782751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 513 | Open in IMG/M |
| 3300021479|Ga0210410_10209647 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1746 | Open in IMG/M |
| 3300021479|Ga0210410_11031551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 712 | Open in IMG/M |
| 3300021479|Ga0210410_11223629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300021861|Ga0213853_10058075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1638 | Open in IMG/M |
| 3300021861|Ga0213853_10288021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300021861|Ga0213853_10639162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300022726|Ga0242654_10303274 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300022873|Ga0224550_1009752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1350 | Open in IMG/M |
| 3300025612|Ga0208691_1020925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1551 | Open in IMG/M |
| 3300025911|Ga0207654_10434007 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 919 | Open in IMG/M |
| 3300025915|Ga0207693_10873896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 691 | Open in IMG/M |
| 3300025928|Ga0207700_11152419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300025929|Ga0207664_10197160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1736 | Open in IMG/M |
| 3300026291|Ga0209890_10191755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300027439|Ga0209332_1049654 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300027521|Ga0209524_1043012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 951 | Open in IMG/M |
| 3300027745|Ga0209908_10006698 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1782 | Open in IMG/M |
| 3300027842|Ga0209580_10532496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300027853|Ga0209274_10179430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300027855|Ga0209693_10179954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1042 | Open in IMG/M |
| 3300027855|Ga0209693_10398954 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300027855|Ga0209693_10628713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300027867|Ga0209167_10002847 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9203 | Open in IMG/M |
| 3300027894|Ga0209068_10759438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300028806|Ga0302221_10207399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 858 | Open in IMG/M |
| 3300029636|Ga0222749_10001886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10179 | Open in IMG/M |
| 3300029945|Ga0311330_10012867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10090 | Open in IMG/M |
| 3300030007|Ga0311338_10757800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 973 | Open in IMG/M |
| 3300030007|Ga0311338_11982245 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300030494|Ga0310037_10241057 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 788 | Open in IMG/M |
| 3300031128|Ga0170823_16605134 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300031231|Ga0170824_104212940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 518 | Open in IMG/M |
| 3300031231|Ga0170824_117901122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300031233|Ga0302307_10082441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1690 | Open in IMG/M |
| 3300031236|Ga0302324_101075197 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1085 | Open in IMG/M |
| 3300031247|Ga0265340_10536027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300031715|Ga0307476_10057610 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2664 | Open in IMG/M |
| 3300031715|Ga0307476_10121039 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1863 | Open in IMG/M |
| 3300031720|Ga0307469_12001348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300031753|Ga0307477_10365866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| 3300031753|Ga0307477_10545944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300031823|Ga0307478_10356101 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1206 | Open in IMG/M |
| 3300032121|Ga0316040_118715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300032160|Ga0311301_10913948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1179 | Open in IMG/M |
| 3300032180|Ga0307471_100862241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300032180|Ga0307471_102407676 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300032783|Ga0335079_10053635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4611 | Open in IMG/M |
| 3300032783|Ga0335079_10897408 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
| 3300032828|Ga0335080_10815286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
| 3300032828|Ga0335080_12105433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300032829|Ga0335070_11945176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300032895|Ga0335074_10393202 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1510 | Open in IMG/M |
| 3300032955|Ga0335076_11276484 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300033405|Ga0326727_10631610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300033475|Ga0310811_10246694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 2119 | Open in IMG/M |
| 3300034163|Ga0370515_0152626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 20.80% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.40% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.40% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.60% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.60% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.20% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.20% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.20% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.20% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.20% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.20% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.40% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.40% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.60% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.60% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.80% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.80% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.80% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.80% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.80% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.80% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.80% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.80% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.80% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.80% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.80% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.80% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.80% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.80% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.80% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004969 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 44 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016702 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022873 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14 | Environmental | Open in IMG/M |
| 3300025612 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026291 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300032121 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA3 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N57_02379310 | 2170459013 | Grass Soil | MRLDINLASQPYEDARQFWVRWGTAVGVAGVLTLVLLTLTI |
| JGI12635J15846_105034931 | 3300001593 | Forest Soil | MRLDINLASQPYEDARQFWMRWGTAVGALALLTLLLLALDIVGWINA |
| JGI26341J46601_101569592 | 3300003219 | Bog Forest Soil | MRLDINLASQPYEDARQFWMRWGTALAGASILTLALLAITI |
| Ga0062389_1002070023 | 3300004092 | Bog Forest Soil | MRLDINLASQPYEDARQFWMRWGTALAAAAILTAALLTITISGWFAA |
| Ga0062388_1000824803 | 3300004635 | Bog Forest Soil | MRLDINLASQPYEDARQFWMRWGTALAAAAILTAALLTITISGW |
| Ga0062388_1019481761 | 3300004635 | Bog Forest Soil | MRLDINLASQPYEDARQFWMRWGTAVGAVALLTLILLTLDVTG |
| Ga0072327_12205582 | 3300004969 | Peatlands Soil | MRLDINLASQPYEDARRFWMRWGTAVGAVGIATLVLLTLT |
| Ga0070713_1009587691 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLDINLASQPYEDARQFWIRWGTSVVLVAILTLALLAETAIGWVY |
| Ga0070708_1014197061 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLDINLASQPYEDARQFWIRWGTAVGAVGLLTLVLLAADIT |
| Ga0066687_107608081 | 3300005454 | Soil | MRLDINLASRPYEDARQFWLRWGSALFALSILTLLLLYFTVS |
| Ga0066708_107269731 | 3300005576 | Soil | MRLDINLASRPYEDARQFWLRWGSALFALSVATLLLLYFTVSGLLIAQQDRR |
| Ga0070761_101583561 | 3300005591 | Soil | MRIDINLASQPYEDARQFWMRWGTALAIATIVTLAL |
| Ga0070762_100378103 | 3300005602 | Soil | MRLDINLASQPYEDARQFWMRWGTAVGALALLTLLLLALDIA |
| Ga0070764_110908001 | 3300005712 | Soil | MRLEINLASQPYEDARQFWTRWGTAVGAVGVLTLFLV |
| Ga0070766_101089231 | 3300005921 | Soil | MRLDINLASQAYEDARQFWMRWGTAVGALALLTLVLL |
| Ga0066658_103333162 | 3300006794 | Soil | MRLDINLASRPYEDARQFWMRWGTAVGALGLLTLILMTLVITGFVNAR |
| Ga0075421_1022861111 | 3300006845 | Populus Rhizosphere | MRLDMNLASQPYEDARDFYVRWGTALALVTLISIGLVAFAV |
| Ga0066710_1003202833 | 3300009012 | Grasslands Soil | MRLDINLASQPYEDARQFWRGWGTGLAFLGLLTLVLI |
| Ga0105244_104963672 | 3300009036 | Miscanthus Rhizosphere | MRLDINLASQPYEDARQFWIRWGSAVALIAILTLAL |
| Ga0105240_104759063 | 3300009093 | Corn Rhizosphere | MRLDINLASQPYEDARQFWIRWGSAVALIAILTLALIAETA |
| Ga0099792_100660191 | 3300009143 | Vadose Zone Soil | MRLDINLASQPYQDAREFWLRWGTGLVVTTILTIALLIFTIMS |
| Ga0116218_10695161 | 3300009522 | Peatlands Soil | MRLDINLASQPYEDARQFWMRWGTAVGAVALLTLVLL |
| Ga0116224_100416623 | 3300009683 | Peatlands Soil | MRVDINLASQPYEDARRFWLRWGAALAALGILTLLLLSM |
| Ga0126373_128337412 | 3300010048 | Tropical Forest Soil | MRIDVNLATQPYEDARFFWMRWGTGVALLAILSLALLTET |
| Ga0126370_120036932 | 3300010358 | Tropical Forest Soil | MRIDINLASQPYEDARQFWMRWGTAVGALGLLTLIFLALVV |
| Ga0126378_111834971 | 3300010361 | Tropical Forest Soil | MRLDINLASQPYEDARQFWRRWGMAAGALVLLTLILLAL |
| Ga0136449_1025009982 | 3300010379 | Peatlands Soil | MRVDINLATQPYEDARQFWLRWGSALVALGILTLLLLS |
| Ga0136449_1041258372 | 3300010379 | Peatlands Soil | MRLDINLASQAYEDAREFWLRWGTALAVAAILTLALLTL |
| Ga0137392_105981921 | 3300011269 | Vadose Zone Soil | MRLDINLATQPYEDARQFWLRWGTALAAVAILTLALMTI |
| Ga0137398_102799991 | 3300012683 | Vadose Zone Soil | MRLDINLATQPYEDARQFWLRWGTALIATAVFTLALLAFTIMGWF |
| Ga0137416_102447991 | 3300012927 | Vadose Zone Soil | MRIDINLASQPYEDARQFWLRWGTALAVVAVLTLALL |
| Ga0164304_108985061 | 3300012986 | Soil | MRIDINLASQPYEDARQFWMRWGTALGILGLLTLVLL |
| Ga0157373_102121283 | 3300013100 | Corn Rhizosphere | MRLDINLASRPYEDARQFWMRWGTAVGALGLLTLILMTLV |
| Ga0181534_101374561 | 3300014168 | Bog | MRLDINLASQPYEDARQFWMRWGTAVGAVALLTLIL |
| Ga0182041_103511772 | 3300016294 | Soil | MRLYINLASQPYEDARQFWMRWGTALGVLGLLTLVL |
| Ga0181511_11303861 | 3300016702 | Peatland | MRLDINLASQPYEDAPQFWMRWGTALVVTAIVTLALLA |
| Ga0187821_101462101 | 3300017936 | Freshwater Sediment | MRLDINLASQPYEDARQFWMRWGTAVGLAGVFTLVLLTLTITG |
| Ga0187819_101526763 | 3300017943 | Freshwater Sediment | MRLDINLASQPYEDARQFWMRWGTAVAALGMLTLILLVLDATGYVDA |
| Ga0187817_102228481 | 3300017955 | Freshwater Sediment | MRLDINLASQPYEDARQFWMRWGTAVAVVGLLTFVLLTL |
| Ga0187817_104648981 | 3300017955 | Freshwater Sediment | MRLDINLASQPYEDARQFWMRWGTGLGAAALVTLVLLT |
| Ga0187872_104702651 | 3300018017 | Peatland | MRLDINLATQPYEDARQFWTRWGTALTVVSILTLALLA |
| Ga0187875_106260421 | 3300018035 | Peatland | MRLDINLASQPYEDARQFWMRWGTALVVTAIVTLALL |
| Ga0187859_104418742 | 3300018047 | Peatland | MRLDINLASQPYEDARQFWVRWGTALAAVALVTLAL |
| Ga0187766_103267541 | 3300018058 | Tropical Peatland | MRLDINLASQPFEDARSFWLRWGSAVALSAILTLALLSLAVSG |
| Ga0187772_101366621 | 3300018085 | Tropical Peatland | VTVMRLDINLASEPYEDARRFWMRWGTAGIVMALLTLLLLTMTVRGW |
| Ga0187772_102221121 | 3300018085 | Tropical Peatland | MRLDINLASQPYEDAQRFWLSWGMATAAVGVVTLILLTLTIS |
| Ga0187772_108116211 | 3300018085 | Tropical Peatland | MRLDINLASQPYEDARQFWLRWGTALTLVAVLTLVLLTLT |
| Ga0187800_11857141 | 3300019278 | Peatland | MRVDINLATQPYQDARQFWLRWGSAIVLLTVATVLLFWV |
| Ga0210395_109513931 | 3300020582 | Soil | MRLDINLASQPYEDARQFWMRWGSAVGAVALLTLILLTLDVT |
| Ga0210401_100963513 | 3300020583 | Soil | MRLDINLASQPYEDARQFWMRWGTAVGAVALLTLVLLTLD |
| Ga0210405_102368273 | 3300021171 | Soil | MRHDINLASQPYEDARQFWMRWGTALAVAAILTLALLTVTVTDW |
| Ga0210405_109653901 | 3300021171 | Soil | MRLDINLASQPYEDARQFWMRWGTAVGALALLTLLLLALDIAGW |
| Ga0210396_109170532 | 3300021180 | Soil | MRLDINLASQPYEDARQFWMRWGTAVGAVALLTMVLLTL |
| Ga0210388_100273765 | 3300021181 | Soil | MRLDINLASQPYQDAREFWLRWGTALAAACILSLALLVS |
| Ga0210388_100514624 | 3300021181 | Soil | MRLDINLASQPYLDAREFWLRWGTALAAACILSLALLVSTVTG |
| Ga0210388_111317531 | 3300021181 | Soil | MRLDINLASQPYEDARQFWMRWGTAVGAVAVLTLVLLALD |
| Ga0210397_105499631 | 3300021403 | Soil | MRLDINLASQPYEDARQFWMRWGTAVGALALLTLLLLALDIAGWIN |
| Ga0210397_113064042 | 3300021403 | Soil | MRLDINLASQPYEDARQFWMRWGTALGAVAILTLALLAITVSGWFAA |
| Ga0210389_101079731 | 3300021404 | Soil | MRLEINLASQPYEDARQFWLRWGTGLTIATIITLALIA |
| Ga0210389_101471571 | 3300021404 | Soil | MRLDINLASQPYEDARQFWTRWGTAVGAVALLTLILLALDITGWVN |
| Ga0210387_101355691 | 3300021405 | Soil | MRLDINLASQPYEDARQFWMRWGTAVGALALFTLLLLALDI |
| Ga0210387_107762691 | 3300021405 | Soil | MRLDINLASQPYEDARQFWLRWGTAVGAVALLTLVLLALD |
| Ga0210387_113540251 | 3300021405 | Soil | MRLDINLASQPYEDARQFWTRWGTAVGAVALLTLILLALDITGWVNAR |
| Ga0210386_107322722 | 3300021406 | Soil | MRLDINLASQPYEDARQFWMRWGTAVGAVALLTLVLLTLDVTGW |
| Ga0210383_104465741 | 3300021407 | Soil | MRVDINLASQPYEDARQFWLRWGGGLVALGILTLLL |
| Ga0210394_100347961 | 3300021420 | Soil | MRLDINLASQPYEDARQFWMRWGTAVGALALLTLLLLA |
| Ga0210394_117501342 | 3300021420 | Soil | MRVDINLASQPYEDARQFWMRWGGGLVALGVLTLL |
| Ga0210394_117783371 | 3300021420 | Soil | MRLDINLASQPYEDARQFWMRWGTAVGAVALLTLVLLTLDV |
| Ga0210394_117827511 | 3300021420 | Soil | MRLDINLASQPYEDAQQFWTRWGTVVAAVALLTLVLV |
| Ga0210410_102096473 | 3300021479 | Soil | MRLDINLASEPYEDARQFWMRWGTALGAVAILTLALLAITVSGWF |
| Ga0210410_110315511 | 3300021479 | Soil | MRLNINLASQPYQDARQFWLRWGTGLVAAAILTLA |
| Ga0210410_112236291 | 3300021479 | Soil | MRIDINLASQPYEDARQYWMRWGTALGILGLLTLVLLVLDI |
| Ga0213853_100580753 | 3300021861 | Watersheds | MRLDINLASQPYEDARQFWMRWGTGLGAVAVITLVLLT |
| Ga0213853_102880212 | 3300021861 | Watersheds | MRLDINLASQPYEDARQFWMRWGTAAVALGIVTLVLLALTITGWVNA |
| Ga0213853_106391621 | 3300021861 | Watersheds | MRLDINLASQPYEDARQFWMRWGTGLGAAAVVTLVL |
| Ga0242654_103032741 | 3300022726 | Soil | MRLDITLASQPYEDARQFWLRWGTAVGAVALLTLVLLA |
| Ga0224550_10097522 | 3300022873 | Soil | MRLDINLASQPYEDARQFWLRWGTALAVAAILTLA |
| Ga0208691_10209253 | 3300025612 | Peatland | MRLDINLATQPYEDARQFWTRWGTALTVVSILTLA |
| Ga0207654_104340072 | 3300025911 | Corn Rhizosphere | MRLDINLASQPYEDARQFWIRWGSAVALIAILTLALIAET |
| Ga0207693_108738961 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLDINLASRPYEDARQFWMRWGTAVGALGLLTLILMTLVITGFVN |
| Ga0207700_111524191 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MRLDINLASQPYEDAKQFWMRWGTAVGAVGLLTLVLLALTIT |
| Ga0207664_101971603 | 3300025929 | Agricultural Soil | MRLDINLASQPYEDARQFWMRWGTAVGTLGLLTLIL |
| Ga0209890_101917552 | 3300026291 | Soil | MRLDINLASQPYEDARQFWMRWGTAVGTVALLTLVL |
| Ga0209332_10496542 | 3300027439 | Forest Soil | MRLDINLASQPYEDARQFWLRWGTALVVTGILTVALLIF |
| Ga0209524_10430122 | 3300027521 | Forest Soil | MRIDINLASRRYEDARQFWLRWGTALAAVAVLTLALLAG |
| Ga0209908_100066981 | 3300027745 | Thawing Permafrost | MTIIKTMRLDINLASQPYEDARQFWLRWGTALAVAAILTLALL |
| Ga0209580_105324961 | 3300027842 | Surface Soil | MRLDINLASHPYEDARQFWLRWGTALVVAAIVTIALLMITVSGW |
| Ga0209274_101794301 | 3300027853 | Soil | MRLDINLASQPYLDAREFWLRWGTALAAACILSLA |
| Ga0209693_101799542 | 3300027855 | Soil | MRLDINLASQPYEDARQFWLRWGTALVVAAILTLAL |
| Ga0209693_103989542 | 3300027855 | Soil | MRLDINLASQPYEDARQFWMRWGSAMGAVGILTLALLALT |
| Ga0209693_106287132 | 3300027855 | Soil | MRLDINLATRPYEDARQFWMRWGTGVGVLAVIALTLL |
| Ga0209167_100028471 | 3300027867 | Surface Soil | MRLDINLASQPYEDARQYWMRWGTAVGAVGVLTLV |
| Ga0209068_107594382 | 3300027894 | Watersheds | MRTRINLATQPYEDSRKFWLRWGPALALAGVVTLGLMIAAILAWKD |
| Ga0302221_102073991 | 3300028806 | Palsa | MRLDINLASQPYEDARQFWLRWGTALAVAAILTLALLTFTI |
| Ga0222749_100018861 | 3300029636 | Soil | MRLDINLASQPYEDARQFWMRWGTAVGAVALLTLVLLTLDVTGWVNAR |
| Ga0311330_1001286711 | 3300029945 | Bog | MRLNINLASQPYEDARQFWMRWGTALAIAVIVTLALLTYTIS |
| Ga0311338_107578001 | 3300030007 | Palsa | MRLDINLASQPYEDARQFWLRWGPAMAAMGIVTLVVLSV |
| Ga0311338_119822451 | 3300030007 | Palsa | MRLDINLASQPYEDARQFWLHWGTALAVAAILTLALLTFTVSDWFA |
| Ga0310037_102410571 | 3300030494 | Peatlands Soil | MRLDINLASQPYEDARQFWMRWGAAVGAVALLTLVLLALDVTGW |
| Ga0170823_166051342 | 3300031128 | Forest Soil | MRLDINLASQPYEDARQFWMRWGSAVGAVALLTLILLTLDVTGWV |
| Ga0170824_1042129401 | 3300031231 | Forest Soil | MLLDINLASQPYEDARQFWMRWGTAVGAVGLLTLVLLA |
| Ga0170824_1179011221 | 3300031231 | Forest Soil | MRLDINLASQPYEDARQFWMRWGTAVGAVGLLTLVLLALDVTGW |
| Ga0302307_100824413 | 3300031233 | Palsa | MRLDINLASQPYEDARQFWLRWGTALAVAAILTLALLTFTIS |
| Ga0302324_1010751971 | 3300031236 | Palsa | MRLDINLASQPYEDARQFWLRWGTALGAVAVLTLALMTLT |
| Ga0265340_105360271 | 3300031247 | Rhizosphere | MRLDINLASQPYEDAQQFWMRWGTVVGAVALLTLVLITLD |
| Ga0307476_100576101 | 3300031715 | Hardwood Forest Soil | MRLDINLASRPYEDARQFWMRWGTALGVAALLTLVLLTMTVTGW |
| Ga0307476_101210393 | 3300031715 | Hardwood Forest Soil | MRLDINLASQPYEDSRQFWLRWGTALVVTGILTVALLIFT |
| Ga0307469_120013482 | 3300031720 | Hardwood Forest Soil | MRLDINLASQPYEDARQFWLRWGTALVAGAVLTLALLAIT |
| Ga0307477_103658661 | 3300031753 | Hardwood Forest Soil | MRLDINLASHPYEDARQFWLRWGTALAVAAIVTIAL |
| Ga0307477_105459441 | 3300031753 | Hardwood Forest Soil | MRLDINLASQPYEDARQFWMRWGTALAVVSILTLALL |
| Ga0307478_103561012 | 3300031823 | Hardwood Forest Soil | MRLDINLASQPYEDARQFWIRWGTAVCAVAVLTLVL |
| Ga0316040_1187151 | 3300032121 | Soil | MRLNINLASRPYEDARQFWLRWGTGLATAAILTLAL |
| Ga0311301_109139482 | 3300032160 | Peatlands Soil | MRLDINLASQAYEDAREFWLRWGTALAAAAILTLALLTLTITDW |
| Ga0307471_1008622412 | 3300032180 | Hardwood Forest Soil | MRIDINLASQQYEDARQFWMRWGTAVGALGLLTLILLAFV |
| Ga0307471_1024076761 | 3300032180 | Hardwood Forest Soil | MRIDINLASQPYEDARQFWMRWGTAVGALGLLTLILLA |
| Ga0335079_100536351 | 3300032783 | Soil | MRLDINLASQPYEDARQFWARWGAGVGAVAVLTLILLTLTIT |
| Ga0335079_108974081 | 3300032783 | Soil | MRIDINLASQPYEDARQFWMRWGTAVGALGLLTLILLALDITGWLTAR |
| Ga0335080_108152862 | 3300032828 | Soil | MRLDINLASQPYQDARRFWVLWGLAVAGAVIVTGALVAYTASGFLQAR |
| Ga0335080_121054331 | 3300032828 | Soil | MRIDINLASQPYEDARQFWMRWGTAVGALGLLTLILLALDI |
| Ga0335070_119451762 | 3300032829 | Soil | MRLDINLASQPYEDARQFWIRWGTGLGVAGLLTLIL |
| Ga0335074_103932021 | 3300032895 | Soil | MRIDINLATQPYEDARQFWLRWGTALGLASVLTLALVIMTI |
| Ga0335076_112764842 | 3300032955 | Soil | MRLDINLASRPYEDARQFWTRWGTALGAAALFTLVLLSLTITGW |
| Ga0326727_106316102 | 3300033405 | Peat Soil | MRLDINLASQPYEDARQFWMRWGTAVVAVGLLTLILLTLDVTGWINA |
| Ga0310811_102466943 | 3300033475 | Soil | MRLDINLASRPYEDARQFWMRWGTAVGALGLLTLILMTLVITGFVNA |
| Ga0370515_0152626_2_121 | 3300034163 | Untreated Peat Soil | MRLNINLASQPYEDARQFWLRWGTALAIAVIVTLALLTYT |
| ⦗Top⦘ |