NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F067470

Metagenome Family F067470

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F067470
Family Type Metagenome
Number of Sequences 125
Average Sequence Length 59 residues
Representative Sequence HHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDAREACIEMEILIDKQLGRH
Number of Associated Samples 109
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.80 %
% of genes near scaffold ends (potentially truncated) 92.80 %
% of genes from short scaffolds (< 2000 bps) 94.40 %
Associated GOLD sequencing projects 98
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(16.800 % of family members)
Environment Ontology (ENVO) Unclassified
(42.400 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.800 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 55.95%    β-sheet: 0.00%    Coil/Unstructured: 44.05%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF00144Beta-lactamase 4.80
PF13414TPR_11 0.80
PF00675Peptidase_M16 0.80
PF13181TPR_8 0.80
PF04439Adenyl_transf 0.80
PF14534DUF4440 0.80
PF07366SnoaL 0.80
PF04235DUF418 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 4.80
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 4.80
COG2367Beta-lactamase class ADefense mechanisms [V] 4.80
COG2311Uncharacterized membrane protein YeiBFunction unknown [S] 0.80

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000881|JGI10215J12807_1137513All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales996Open in IMG/M
3300000891|JGI10214J12806_10104979All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1128Open in IMG/M
3300001538|A10PFW1_11893911All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1150Open in IMG/M
3300004047|Ga0055499_10040714All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes713Open in IMG/M
3300004463|Ga0063356_100779540All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1330Open in IMG/M
3300005168|Ga0066809_10186098All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium555Open in IMG/M
3300005295|Ga0065707_10887963All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes570Open in IMG/M
3300005334|Ga0068869_101691550All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium565Open in IMG/M
3300005338|Ga0068868_101307837All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes674Open in IMG/M
3300005340|Ga0070689_101702600All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes574Open in IMG/M
3300005345|Ga0070692_11105547All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium560Open in IMG/M
3300005354|Ga0070675_101223173All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium692Open in IMG/M
3300005354|Ga0070675_101489959All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium624Open in IMG/M
3300005356|Ga0070674_100718730All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes855Open in IMG/M
3300005441|Ga0070700_100894686All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Pedobacter → Pedobacter heparinus → Pedobacter heparinus DSM 2366722Open in IMG/M
3300005459|Ga0068867_100845273All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes820Open in IMG/M
3300005471|Ga0070698_100220139All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cyclobacteriaceae → Indibacter → Indibacter alkaliphilus1832Open in IMG/M
3300005543|Ga0070672_101027469All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Pedobacter → Pedobacter heparinus → Pedobacter heparinus DSM 2366731Open in IMG/M
3300005564|Ga0070664_101403587All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium660Open in IMG/M
3300005569|Ga0066705_10730070All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium595Open in IMG/M
3300005576|Ga0066708_10509990All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium775Open in IMG/M
3300005577|Ga0068857_102546943All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium502Open in IMG/M
3300005615|Ga0070702_100751891All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes749Open in IMG/M
3300005718|Ga0068866_10423729All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium864Open in IMG/M
3300005841|Ga0068863_100004282All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes14058Open in IMG/M
3300005841|Ga0068863_100051881All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium → Flavobacterium limnosediminis3887Open in IMG/M
3300005843|Ga0068860_101579270All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes678Open in IMG/M
3300005844|Ga0068862_101777124All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes626Open in IMG/M
3300006031|Ga0066651_10833520All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium502Open in IMG/M
3300006876|Ga0079217_10090181All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1351Open in IMG/M
3300006876|Ga0079217_10168624All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae1083Open in IMG/M
3300006881|Ga0068865_101022378All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium725Open in IMG/M
3300006954|Ga0079219_11518981All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300007004|Ga0079218_11432542All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes741Open in IMG/M
3300009094|Ga0111539_10317141All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1814Open in IMG/M
3300009100|Ga0075418_10635267All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1150Open in IMG/M
3300009100|Ga0075418_12609591All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium552Open in IMG/M
3300009148|Ga0105243_12409104All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes565Open in IMG/M
3300009553|Ga0105249_12173133All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes628Open in IMG/M
3300010036|Ga0126305_10589072All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium747Open in IMG/M
3300010041|Ga0126312_11481513All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium503Open in IMG/M
3300010391|Ga0136847_12373389All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium592Open in IMG/M
3300010398|Ga0126383_10753766All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1054Open in IMG/M
3300010403|Ga0134123_12429158All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium589Open in IMG/M
3300010403|Ga0134123_12605553All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes573Open in IMG/M
3300011399|Ga0137466_1020079All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium888Open in IMG/M
3300011400|Ga0137312_1049296All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes692Open in IMG/M
3300011428|Ga0137456_1230331All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes503Open in IMG/M
3300012040|Ga0137461_1060105All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1047Open in IMG/M
3300012353|Ga0137367_10598805All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium772Open in IMG/M
3300012517|Ga0157354_1037154All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium648Open in IMG/M
3300012532|Ga0137373_10399147All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1068Open in IMG/M
3300012892|Ga0157294_10013456All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1477Open in IMG/M
3300012892|Ga0157294_10077792All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium811Open in IMG/M
3300012892|Ga0157294_10218473All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes570Open in IMG/M
3300012900|Ga0157292_10114491All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium820Open in IMG/M
3300012903|Ga0157289_10307297All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium563Open in IMG/M
3300012905|Ga0157296_10083526All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium835Open in IMG/M
3300012906|Ga0157295_10109183All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes772Open in IMG/M
3300012907|Ga0157283_10022568All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1212Open in IMG/M
3300012908|Ga0157286_10418109All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium525Open in IMG/M
3300012910|Ga0157308_10021750All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1448Open in IMG/M
3300012914|Ga0157297_10104627All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium856Open in IMG/M
3300012984|Ga0164309_10682583All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium813Open in IMG/M
3300013297|Ga0157378_13249652All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium505Open in IMG/M
3300013306|Ga0163162_10212466All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes2065Open in IMG/M
3300013306|Ga0163162_10697165All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1137Open in IMG/M
3300013306|Ga0163162_11336689All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes815Open in IMG/M
3300014325|Ga0163163_11684254All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium695Open in IMG/M
3300014326|Ga0157380_10606593All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1084Open in IMG/M
3300014969|Ga0157376_10700484All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1018Open in IMG/M
3300015200|Ga0173480_10285160All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium915Open in IMG/M
3300015200|Ga0173480_10502749All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium726Open in IMG/M
3300015200|Ga0173480_10943479All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium564Open in IMG/M
3300015201|Ga0173478_10245225All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes780Open in IMG/M
3300015371|Ga0132258_12988661All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1172Open in IMG/M
3300015373|Ga0132257_100617939All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1340Open in IMG/M
3300015374|Ga0132255_103439125All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes674Open in IMG/M
3300017792|Ga0163161_10593239All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium912Open in IMG/M
3300017965|Ga0190266_10980173All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium564Open in IMG/M
3300018073|Ga0184624_10162236All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium987Open in IMG/M
3300018083|Ga0184628_10129452All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1308Open in IMG/M
3300018469|Ga0190270_11643747All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes695Open in IMG/M
3300018476|Ga0190274_13453956All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium533Open in IMG/M
3300018481|Ga0190271_13075600All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium560Open in IMG/M
3300021080|Ga0210382_10513197All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium531Open in IMG/M
3300021082|Ga0210380_10154961All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1029Open in IMG/M
3300021082|Ga0210380_10311685All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium717Open in IMG/M
3300021412|Ga0193736_1052646All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300021560|Ga0126371_10607075All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1243Open in IMG/M
3300023064|Ga0247801_1036233All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium720Open in IMG/M
3300023066|Ga0247793_1069703All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium586Open in IMG/M
3300024055|Ga0247794_10124285All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium787Open in IMG/M
3300025918|Ga0207662_10558084All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium794Open in IMG/M
3300025926|Ga0207659_11338364All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes615Open in IMG/M
3300025926|Ga0207659_11739149All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium530Open in IMG/M
3300025937|Ga0207669_10803976All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium780Open in IMG/M
3300025937|Ga0207669_11589992All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium558Open in IMG/M
3300025940|Ga0207691_11483876All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium555Open in IMG/M
3300025942|Ga0207689_11197156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium640Open in IMG/M
3300025961|Ga0207712_11743301All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes558Open in IMG/M
3300026023|Ga0207677_11117097All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes719Open in IMG/M
3300026078|Ga0207702_12198528All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium540Open in IMG/M
3300026116|Ga0207674_12195741All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium515Open in IMG/M
3300026118|Ga0207675_101076700All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium823Open in IMG/M
3300026118|Ga0207675_101804536All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes631Open in IMG/M
3300026142|Ga0207698_11488338All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes692Open in IMG/M
3300026319|Ga0209647_1026216All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales3497Open in IMG/M
3300027639|Ga0209387_1144840All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes618Open in IMG/M
3300027691|Ga0209485_1179829All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes649Open in IMG/M
3300027778|Ga0209464_10003187All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae5081Open in IMG/M
3300027886|Ga0209486_10009174All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Flavobacterium4392Open in IMG/M
3300027903|Ga0209488_10635796All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes771Open in IMG/M
3300028381|Ga0268264_11451655All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes697Open in IMG/M
(restricted) 3300031197|Ga0255310_10016073All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium IBVUCB21922Open in IMG/M
3300031834|Ga0315290_10064230All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium IBVUCB23017Open in IMG/M
3300031847|Ga0310907_10183766All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes987Open in IMG/M
3300031854|Ga0310904_10427085All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium874Open in IMG/M
3300031908|Ga0310900_11906629All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium507Open in IMG/M
3300032012|Ga0310902_10712304All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium677Open in IMG/M
3300032012|Ga0310902_11257185All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium523Open in IMG/M
3300032075|Ga0310890_10445806All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes972Open in IMG/M
3300032122|Ga0310895_10076209All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1307Open in IMG/M
3300032143|Ga0315292_10401333All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium IBVUCB21151Open in IMG/M
3300034115|Ga0364945_0103240All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes835Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere7.20%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil5.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere5.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere5.60%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.00%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.20%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.20%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.20%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.20%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment2.40%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.40%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.40%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere2.40%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.40%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.60%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.60%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.60%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.60%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.60%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.60%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.60%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.60%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.80%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.80%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.80%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.80%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.80%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.80%
Sandy SoilEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil0.80%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.80%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.80%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.80%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300004047Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011399Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT842_2EnvironmentalOpen in IMG/M
3300011400Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT133_2EnvironmentalOpen in IMG/M
3300011428Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012517Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610EnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012914Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015201Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021412Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026319Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes)EnvironmentalOpen in IMG/M
3300027639Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control (SPAdes)EnvironmentalOpen in IMG/M
3300027691Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes)EnvironmentalOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300031197 (restricted)Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1EnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031847Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI10215J12807_113751333300000881SoilSGNDAVIFRNNMGAALTLRLERLKRSLDAFRDARIACVEMENLILKQLRK*
JGI10214J12806_1010497933300000891SoilYSDPLKMEKIASHHDVLSGNDAVIFRNNMGAALTLRLERLKRSLDAFRDARIACVEMENLILKQLRK*
A10PFW1_1189391123300001538PermafrostTGNDAATFRHDMGAALMLRLERLRRSLDAYIDARSKCIEMKQLILKQL*
Ga0055499_1004071413300004047Natural And Restored WetlandsSFKMEKIANHHDILSGSDAITFRNNMGAALTLRLERLRRSLDAFSEAKKSCIEMEKLIMKQLGETSAY*
Ga0063356_10077954013300004463Arabidopsis Thaliana RhizosphereKMEKITRHRDMLSGNEAVIFRRDMGAALTLRLERLRRSLDAYEDARKACVDMEALIQKQLKIKE*
Ga0066809_1018609823300005168SoilINLDTSNHSDIFKMEKLAHHHDVLSGNDAVAFRHDMGAALALRLERLRRSMDAYKDGRDACIDMEELIKKQLGEPDQ*
Ga0065707_1088796313300005295Switchgrass RhizosphereSGNDAVLFRNNMGAALTLRLERLKRSLDAFRDARIVCVEMEDLIKKQLGQH*
Ga0068869_10169155013300005334Miscanthus RhizosphereDVLSGNDAAVFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH*
Ga0068868_10130783713300005338Miscanthus RhizosphereNLDTSNHSDPVKMEKLANHHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDARESCAEMEILINKQLGPH*
Ga0070689_10170260013300005340Switchgrass RhizosphereCQLNLDTSNHSDPVKIEKLANHHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDAREACAEMEILINKQLGRH*
Ga0070692_1110554723300005345Corn, Switchgrass And Miscanthus RhizosphereVFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH*
Ga0070675_10122317313300005354Miscanthus RhizosphereTHHDMLSGNDAVLFRNNLGAALTLRLERLKRSVDAFRDARIACVEMEKLISKQLEK*
Ga0070675_10148995923300005354Miscanthus RhizosphereDPVKMEKLADHHDVLSGNEANAFRHDMGAALTLRLERLRRSLDAFRDAREACIEMEKLIDKQLGRP*
Ga0070674_10071873023300005356Miscanthus RhizosphereLARHHDVLSGDDAVVFRHDMGAALALRLERLRRSMDAYKDGRAACVDMEKLIKKQLGKSINE*
Ga0070700_10089468613300005441Corn, Switchgrass And Miscanthus RhizosphereNEATGFRNNMGAALTLRLERLRRSLDAFRDAKKACIEMEELINKRLN*
Ga0068867_10084527323300005459Miscanthus RhizosphereLDTSNHSDIFKMEKLAHHHDVLSGNDAVVFRHDMGAALALRLERLRRSLDAYRDAKDACIEMEGLIRKQLGEPD*
Ga0070698_10022013933300005471Corn, Switchgrass And Miscanthus RhizosphereRSDPFKVEKIVKHNDILSGNEAIQFRNDMGAALNLRIERLKRSLDAFRDARAACVEMEQLIMEKLRN*
Ga0070672_10102746913300005543Miscanthus RhizosphereDVLTGNEATEFRNNMGAALTLRLERLRRSLDAFRDAKKSCVEMEELINKRLN*
Ga0070664_10140358713300005564Corn RhizosphereLANHHDVLNGNDATVFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH*
Ga0066705_1073007023300005569SoilMEKITHHHDVLSGNDAAIFRHDMGAALTLRLERLRRSLDAYKDAKNVCVEMEKLIREKL*
Ga0066708_1050999023300005576SoilDTSNHSDKFKMQKVANHHDVLSGNDAAVFRHDMGAALTLRLERLRRSLDAYRDARAACVKMENLINEKL*
Ga0068857_10254694323300005577Corn RhizosphereVFRHDMGAALMLRLERLRRSLDAFRDARAACVEMEQLITNKLGRTSKE*
Ga0070702_10075189123300005615Corn, Switchgrass And Miscanthus RhizosphereHDVLTGNDAAVFRHDMGAALTLLLERLRRSLDAFRDARESCAEMEILINKQLGPH*
Ga0068866_1042372923300005718Miscanthus RhizosphereVKIEKLANHHDVLSGNDAAIFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH*
Ga0068863_100004282173300005841Switchgrass RhizosphereDAAVFRHDMGAALTLRLERLRRSLDAFRDAREACAEMEILINKQLGRH*
Ga0068863_10005188163300005841Switchgrass RhizosphereNHHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFSDAREACAEMEILINKQLGPH*
Ga0068860_10157927023300005843Switchgrass RhizosphereSDPVKIEKLANHHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDAREACAEMEILINKQLGRH*
Ga0068862_10177712423300005844Switchgrass RhizosphereANHHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDARESCAEMEILINKQLGPH*
Ga0066651_1083352013300006031SoilLTLRLERLRRSLDAFRDAREACIEMESLIDKQLGRH*
Ga0079217_1009018133300006876Agricultural SoilDIYKMEKIAGHHDVLSGNDAMVFRNSMGAALTLRLERLRRSLDAFRDARMACVDMEKLILGQLEN*
Ga0079217_1016862433300006876Agricultural SoilDTSNHSKPDLMKKADHHHDVLRGNDAAIFRHDMGAALMLRLERLRRSRDAFINARSACVRMEELINKQLGEH*
Ga0068865_10102237813300006881Miscanthus RhizosphereMGAALTLRLERLRRSLDAFRDAREACIEMESLIDKQLGRH*
Ga0079219_1151898123300006954Agricultural SoilDVLTGNDATEFRNNMGAALTLRLERLRRSLDAFRDAKRSCVEMEELINKRLN*
Ga0079218_1143254213300007004Agricultural SoilLANHHDVLTGNDAVVFRHDMGAALTLRLERLRRSLDAFRDARVACVEMEILIKKQLDLH*
Ga0111539_1031714113300009094Populus RhizosphereHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH*
Ga0075418_1063526713300009100Populus RhizosphereAVIFRNNMGAALTLRLERLKRSLDAFRDARVACVEMEILIEKQLNQH*
Ga0075418_1260959123300009100Populus RhizosphereGNDAAVFRHDMGAALTLRLERLRRSLDAFRDARTACVEMENLIDKQLNRQ*
Ga0105243_1240910423300009148Miscanthus RhizosphereRHDMGAALTLRLERLRRSLDAFRDARESCAEMEILINKQLGPH*
Ga0105249_1217313313300009553Switchgrass RhizosphereVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDAREACAEMEILINKQLGRH*
Ga0126305_1058907213300010036Serpentine SoilDSVKIEKLANHHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDARTACIEMESLIDKQLGRH*
Ga0126312_1148151313300010041Serpentine SoilHNDVLSSNDAAIFRHDMGAALTLRLERVKRSLDAFRDARAACVEMEKSILEKL*
Ga0136847_1237338913300010391Freshwater SedimentDMGAALTLRLERLRRSLDAFRDARVACVEMEQLIMKQLGQAMK*
Ga0126383_1075376613300010398Tropical Forest SoilHDVLSGNDAAVFRHDMGAALTLRLERLRRSMDAYRDAKAACLKMEALIEKKLE*
Ga0134123_1242915813300010403Terrestrial SoilDAAVFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH*
Ga0134123_1260555313300010403Terrestrial SoilTSNHSDTFKMEKLARHHDVLSGDDAVVFRHDMGAALALRLERLRRSMDAYKDGRAACVDMEKLIKKQLGKSINE*
Ga0137466_102007923300011399SoilDTSNHSDPVKIEKLANHHDVLSGNDATVFRHDMGAALTLRLERLRRSLDAFRDARTACVEMEILIKEQLDLH*
Ga0137312_104929623300011400SoilEKLANHHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDARVACVEMEILIKKQLDLH*
Ga0137456_123033113300011428SoilIMEKAAQHQDILTGNDAAVFRHDMGAALMLRLERLRRSRDAFTYARAACVEMEQLINKQLGNH*
Ga0137461_106010523300012040SoilLTGNDAAVFRHDMGAALMLRLERLRRSRDAFTYARAACVEMEQLINKQLGNH*
Ga0137367_1059880523300012353Vadose Zone SoilMEKIARHQDVITGKDAIQFRNNMGAALTLRLERIKRSLDAFRDARSACIEMEKLIDKQS*
Ga0157354_103715413300012517Unplanted SoilVAHHHDVLSGNDAAIFRHDMGAALTLRLERLRRSMDAYIDARIACVEMEELIKKQLGEAHE*
Ga0137373_1039914713300012532Vadose Zone SoilCQLSLDTSNHSDKTKMEKIANHHDVLNGNDAAVFRHDMGAALTLRLERLRRSLDAYKDARDICAKMEQHILKQL*
Ga0157294_1001345633300012892SoilGNDAAVFRHDMGAALTLRLERLRRSLDAFRDAREACAEMEILINKQLGQH*
Ga0157294_1007779223300012892SoilGNDAAVFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH*
Ga0157294_1021847323300012892SoilTLRLERLRRSLDAFTDAREACIEMEILIDKQLGRH*
Ga0157292_1011449113300012900SoilEKLASHRDVLSGNDAAVFRHDMGAALTLRLERLRRSLDAFRDAREACVEMENLIDKQLNRH*
Ga0157289_1030729723300012903SoilEKIAGHIDKLSGNDAAVFRHDMGAALTLRLERLKRSLDAFRDARAACIEMQKLITEKLRIKPNE*
Ga0157296_1008352613300012905SoilEKLANHRDVLNGNDATVFRHDMGTALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH*
Ga0157295_1010918313300012906SoilDPVKIEKLANHHDVLNGNDAAVFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLRRH*
Ga0157283_1002256813300012907SoilHHDVLTGNDAVVFRHDMGAALTLRLERLRRSLDAFRDAREACIEMEILIDKQLGRH*
Ga0157286_1041810923300012908SoilHHDVLSGNDASIFRHDMGAALTLRLERLRRSLDAFRDARTACVEMENLIDKQLNRH*
Ga0157308_1002175033300012910SoilANHQDVLSGNDAAVFRHDMGAALTLRLERLRRSLDAFRDARAACVEMENLIDKQLGRH*
Ga0157297_1010462713300012914SoilMEKIARHHDVLSGNDAALFRNTMGAALTLRLERLKRSLDAYVDARKACVEMEKLILKQL
Ga0164309_1068258313300012984SoilDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH*
Ga0157378_1324965213300013297Miscanthus RhizosphereKLANHHDVLSGNDATVFRHDMGAALTLRLERLRRSLDAYKDAKAACIEMQDLIRKQLGEKIND*
Ga0163162_1021246623300013306Switchgrass RhizosphereMEKLARHHDVLSGNDAVVFRHDMGAALALRLERLRRSLDAYRDAKDACIEMEGLIRKQLGEPD*
Ga0163162_1069716533300013306Switchgrass RhizosphereVFRHDMGAALTLRLERLRRSLDAFRDAREACAEMENLIDKQLGGH*
Ga0163162_1133668913300013306Switchgrass RhizospherePVKMEKLANHHDVLGGNDAAVFRHDMGAALTLRLERLRRSLDAFRDARAACVEMENLIDKQLGRH*
Ga0163163_1168425413300014325Switchgrass RhizosphereDAAVFRHDMGAALTLRLERLRRSLDAFTDARKACIEMESLIDKQLGRH*
Ga0157380_1060659313300014326Switchgrass RhizosphereMEKLANHHDVLSGNDVAVFRHDMGAALTLRLERLRRSLDAFRDARAACVEMENLIDKQLGRH*
Ga0157376_1070048423300014969Miscanthus RhizosphereNDAAVFRHDMGAALTLRLERLRRSLDAFRDAREACAEMENLIDKQLGWH*
Ga0173480_1028516023300015200SoilVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDARTACVEMENLIDKQLNRH*
Ga0173480_1050274923300015200SoilHHDVLSGNDAAIFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH*
Ga0173480_1094347913300015200SoilANHHDVLSGNDASIFRHDMGAALTLRLERLRRSLDAFRDARTACIEMEILIKKQLDLH*
Ga0173478_1024522513300015201SoilALTLRLERLRRSLDAFTDAREACIEMESLIDKQLRRH*
Ga0132258_1298866113300015371Arabidopsis RhizosphereSNHSDKMKMEKVASHHDVLSGNDAAVFRHDMGAALTLRLERLRRSLDAYKDARNACAKMEQDILEQLK*
Ga0132257_10061793933300015373Arabidopsis RhizosphereIGNDAAVFRHDMGAALTLRLERLRRSLDAYKDAKDACVEMEGLIKKQLRN*
Ga0132255_10343912513300015374Arabidopsis RhizosphereNNIGAALTLRLERLRRSLDAFRDAKAACIEMEDLIEKQLGQH*
Ga0163161_1059323913300017792Switchgrass RhizosphereLTCQLNLDTSNHSDPVKTEKLANHHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDAREACAEMEILINKQLGQH
Ga0190266_1098017313300017965SoilTCQLNLDTSNHSDPVKIEKLANHHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDARTACVEMENLIDKQLNRH
Ga0184624_1016223613300018073Groundwater SedimentVFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDRQLGRH
Ga0184628_1012945213300018083Groundwater SedimentHHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDAREACIEMEILIDKQLGRH
Ga0190270_1164374713300018469SoilSNHSDSRKMAIITQHHDVLKGNDATIFRHDMGAALTLRLERLRRSLDAFRDARIACMEMEKLIMAKLGNRQTDD
Ga0190274_1345395613300018476SoilTSNHSDPVKIEKLAGHHDVLSGNDAAVFRHDMGAALTLRLERLRRSLDAFRDAREACIEMEALIKKQLDLH
Ga0190271_1307560023300018481SoilSGNDAVLFRDNTGAALTLRLERLKRSLDAFRDARIACVEMEKLILKQLEK
Ga0210382_1051319713300021080Groundwater SedimentDVLSGNDAAIFRHDMGAALTLRLERLRRSLDAFKDARIVCVEMEALIMKKLGIKSND
Ga0210380_1015496113300021082Groundwater SedimentHDVLSGNDAAIFRHDMGAALTLRLERLRRSLDAFRDARTACVEMENLIDKQLNRH
Ga0210380_1031168523300021082Groundwater SedimentLTCQLNLDTSNHSDPIKKEKLANHHDVLSGNDAAVFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH
Ga0193736_105264613300021412SoilHSDAFKMKKVADHHDVLSGTDAIAFRNNIGAALTLRLERLRRSLDAFRDARMACVDMEKLILKQLKN
Ga0126371_1060707513300021560Tropical Forest SoilHSDKEKMKKVQDHHDVLSGHDAAVFRHDMGAALTLRLERLRRSMDAYRDAKAACLKMETLIEKKLE
Ga0247801_103623323300023064SoilGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH
Ga0247793_106970323300023066SoilSNHSDPVKMEKLAGHRDVVTGNNAAVFRHEMGAALTLRLERLRRSLDAFRDAREACIEMENLIDKQLGRH
Ga0247794_1012428523300024055SoilTSNHSDPVKKEKLANHHDVLSGNDAAVFRHDMGAALTLRLERLRRSLDAFRDAREACAEMEILINKQLGQH
Ga0207662_1055808423300025918Switchgrass RhizosphereHDMGAALTLRLERLRRSLDAFRDAKEACAEMEILINKQLGQH
Ga0207659_1133836423300025926Miscanthus RhizosphereKMKKIVEHHDVVNGNDAAVFRHDMGAALTLRLERLRRSLDAFKDARQACEDMDQLILKEL
Ga0207659_1173914913300025926Miscanthus RhizosphereVLSGNDAEVFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH
Ga0207669_1080397613300025937Miscanthus RhizosphereLTLRLERLRRSLDAFTDAREACIEMENLIDKQLGRH
Ga0207669_1158999213300025937Miscanthus RhizosphereHDVLNGNDAAVFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH
Ga0207691_1148387613300025940Miscanthus RhizosphereHHDVLSGNDAAVFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH
Ga0207689_1119715623300025942Miscanthus RhizosphereKKEKLANHHDVLSGNDAAVFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH
Ga0207712_1174330113300025961Switchgrass RhizosphereVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDAREACAEMEILINKQLGRH
Ga0207677_1111709723300026023Miscanthus RhizosphereLACQLNLDTSNHSDPVKMEKLANHHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDARESCAEMEILINKQLGPH
Ga0207702_1219852823300026078Corn RhizosphereMEKLARHHDVLSGNDAVVFRHDMGAALALRLERLRRSMDAYKDGRAACVDMEKLIKKQLGKSINE
Ga0207674_1219574123300026116Corn RhizosphereNDAAVFRHDMGAALMLRLERLRRSLDAFRDARAACVEMEQLITNKLGRTSKE
Ga0207675_10107670023300026118Switchgrass RhizosphereFQHDMGAALTLRLERLRRSLDAFTDARDACIEMESLIDKQLGRH
Ga0207675_10180453613300026118Switchgrass RhizosphereDVLSGDDAVVFRHDMGAALALRLERLRRSMDAYKDGRAACVDMEKLIKKQLGKSI
Ga0207698_1148833823300026142Corn RhizosphereIEKLANHHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDARESCAEMEILINKQLGPH
Ga0209647_102621633300026319Grasslands SoilMMEKIVHHHDVLTGNEAAIFRHDMGAALMLRLERLRRSRDAFIDARAACIEMEKLINKQLGEPSSK
Ga0209387_114484023300027639Agricultural SoilTSNYSDPVKMEKITRHRDVLSGNDAVIFRRDMGAALTLRLERLRRSLDAYIDARQACVDMETLIKKQLKIKE
Ga0209485_117982913300027691Agricultural SoilDVLSGNDAVIFRRDMGAALTLRLERLRRSLDAYIDARQACVDMETLIKKQLKIKE
Ga0209464_1000318773300027778Wetland SedimentFKMKKIADHHDVLSGNDAAVFRNNMGAALTLRLERLRRSLDAFRDAKEACVEMQALIGKQLGQH
Ga0209486_1000917413300027886Agricultural SoilLANHHDVLTGNDAVVFRHDMGAALTLRLERLRRSLDAFRDARVACVEMEILIKKQLDLH
Ga0209488_1063579623300027903Vadose Zone SoilNPAMMQKLALHHDVLTGNEAAIFRHDVGAALMLRLERLRRSRDAFIDARSACIEMEKLIKKQLGEASGK
Ga0268264_1145165523300028381Switchgrass RhizosphereVLTGNDAVVFRHDMGAALTLRLERLRRSLDAFRDAREACAEMEILINKQLGRH
(restricted) Ga0255310_1001607343300031197Sandy SoilDAIQFRNNMGAALTLRLERIKRSLDAFRDAKAACTEMEQLILKQLGQNKE
Ga0315290_1006423053300031834SedimentRHDIGAALTLRLERLRRSLDAFRDARNACVEMEKLIMKKLGVTQPTN
Ga0310907_1018376613300031847SoilIEKMATHHDVLTGNDAVVFRHDMGAALTLRLERLRRSLDAFRDAREACIEMESLIDKQLGRH
Ga0310904_1042708523300031854SoilLDTSNHSDPVKKEKLTSHHDVLNGNDAAVFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRQ
Ga0310900_1190662913300031908SoilTVFRHDMGAALTLRLERLRRSLDAFRDARAACVEMESLIRKQLDLH
Ga0310902_1071230413300032012SoilNLDTSNHSDPVKIEKLSTHHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFTDAREACIEMESLIDKQLGRH
Ga0310902_1125718523300032012SoilCQLNLDTSNHSDPVKIEKLADHHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDARTACIEMESLIKKQLDLH
Ga0310890_1044580613300032075SoilARHYDILNGNEAVLFRNNMGAALTLRLERLKRSLDAFRDARMACVEMENLIKKQLDLH
Ga0310895_1007620933300032122SoilGNDAVVFRHDMGAALTLRLERLRRSLDAFRDAREACIEMEILIDKQLGRH
Ga0315292_1040133313300032143SedimentNLDTSNLSDPVKMEKMKTHRDVLTGNDAAVFRHDIGAALTLRLERLRRSLDAFRDARNACVEMEKLIMKKLGVTQPTN
Ga0364945_0103240_1_2193300034115SedimentDTSNHSDPVKIEKLANHHDVLTGNDAAVFRHDMGAALTLRLERLRRSLDAFRDARAACIEMESLIKKQLGQH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.