 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F067439 |
| Family Type | Metagenome |
| Number of Sequences | 125 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PWGRVLQVLNVLRLLNLIPSFEDETQALASFRPLGHFAKP |
| Number of Associated Samples | 85 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 16.67 % |
| % of genes near scaffold ends (potentially truncated) | 4.00 % |
| % of genes from short scaffolds (< 2000 bps) | 4.00 % |
| Associated GOLD sequencing projects | 79 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (96.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (27.200 % of family members) |
| Environment Ontology (ENVO) | Unclassified (49.600 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.400 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.47% β-sheet: 0.00% Coil/Unstructured: 73.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF13646 | HEAT_2 | 3.20 |
| PF00196 | GerE | 2.40 |
| PF13581 | HATPase_c_2 | 2.40 |
| PF07702 | UTRA | 2.40 |
| PF05598 | DUF772 | 1.60 |
| PF01740 | STAS | 1.60 |
| PF06778 | Chlor_dismutase | 1.60 |
| PF04072 | LCM | 0.80 |
| PF07366 | SnoaL | 0.80 |
| PF11160 | Hva1_TUDOR | 0.80 |
| PF02537 | CRCB | 0.80 |
| PF13468 | Glyoxalase_3 | 0.80 |
| PF02563 | Poly_export | 0.80 |
| PF00076 | RRM_1 | 0.80 |
| PF02517 | Rce1-like | 0.80 |
| PF08592 | Anthrone_oxy | 0.80 |
| PF00069 | Pkinase | 0.80 |
| PF00462 | Glutaredoxin | 0.80 |
| PF02687 | FtsX | 0.80 |
| PF01548 | DEDD_Tnp_IS110 | 0.80 |
| PF12844 | HTH_19 | 0.80 |
| PF12146 | Hydrolase_4 | 0.80 |
| PF04389 | Peptidase_M28 | 0.80 |
| PF05163 | DinB | 0.80 |
| PF04986 | Y2_Tnp | 0.80 |
| PF02371 | Transposase_20 | 0.80 |
| PF07238 | PilZ | 0.80 |
| PF01609 | DDE_Tnp_1 | 0.80 |
| PF00194 | Carb_anhydrase | 0.80 |
| PF14659 | Phage_int_SAM_3 | 0.80 |
| PF00491 | Arginase | 0.80 |
| PF13474 | SnoaL_3 | 0.80 |
| PF03551 | PadR | 0.80 |
| PF13432 | TPR_16 | 0.80 |
| PF00072 | Response_reg | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.20 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 1.60 |
| COG3253 | Coproheme decarboxylase/chlorite dismutase | Coenzyme transport and metabolism [H] | 1.60 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.80 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.80 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.80 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.80 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.80 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.80 |
| COG3338 | Carbonic anhydrase | Inorganic ion transport and metabolism [P] | 0.80 |
| COG3315 | O-Methyltransferase involved in polyketide biosynthesis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.80 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.80 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.80 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.80 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.80 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.80 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.80 |
| COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 0.80 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.80 |
| COG0239 | Fluoride ion exporter CrcB/FEX, affects chromosome condensation | Cell cycle control, cell division, chromosome partitioning [D] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 96.00 % |
| All Organisms | root | All Organisms | 4.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005471|Ga0070698_101102878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300012202|Ga0137363_10072530 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2539 | Open in IMG/M |
| 3300020583|Ga0210401_10413718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1211 | Open in IMG/M |
| 3300026551|Ga0209648_10733383 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 539 | Open in IMG/M |
| 3300027651|Ga0209217_1043738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1368 | Open in IMG/M |
| 3300031719|Ga0306917_10579725 | Not Available | 882 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 27.20% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.40% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 13.60% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.20% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.40% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.60% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.60% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.60% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.80% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.80% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.80% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.80% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.80% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.80% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026692 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 38 (SPAdes) | Environmental | Open in IMG/M |
| 3300026823 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes) | Environmental | Open in IMG/M |
| 3300026896 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 71 (SPAdes) | Environmental | Open in IMG/M |
| 3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
| 3300026910 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 65 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032025 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066388_1082405802 | 3300005332 | Tropical Forest Soil | RSQGGELKLLCPCGRVLEVLTVLRLLQIIPSFEEETQALASFRPLGHFATP* |
| Ga0070698_1011028782 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GGRVLEVLRALHLLEIIPNFEDEIQALASFRPLGYFAKP* |
| Ga0070733_101553484 | 3300005541 | Surface Soil | LLRPEGRVLEVFKELHLLEIIPSFEDQTQAVASFRPQGYFAKP* |
| Ga0066694_100320931 | 3300005574 | Soil | GGDLKMLRPSGHVLEVFRVLRLLGTITSFDDETQALASFRSLGHAASSS* |
| Ga0070764_110621391 | 3300005712 | Soil | LKHRGGDLKLVRPEGRVLEVFNLLHLLEIIPRFEDETQALASFRPQRYFAKP* |
| Ga0066903_1030402481 | 3300005764 | Tropical Forest Soil | LCPCGPVLEVLTAFRLQGIIPSFEDEAQALASFRPLVYFANP* |
| Ga0099794_103346572 | 3300007265 | Vadose Zone Soil | RVLEVFRVLHLLKIIPSFEDETQALASFRPQSYSART* |
| Ga0099830_112839151 | 3300009088 | Vadose Zone Soil | ARGGDLKVLRPGSHVLDAFRVLHLLDIISSFEDETEALASFRPG* |
| Ga0099830_115589702 | 3300009088 | Vadose Zone Soil | GDLKLLCPRGRVLDVLTVLRLLEIIPYFDNETEAVASFRPQSYFARP* |
| Ga0099827_108498601 | 3300009090 | Vadose Zone Soil | RGQGGDLRLLHSGGRVLEVFRVLRLLEIIPNFEDETQALASFRPQGYFAKP* |
| Ga0126374_106430242 | 3300009792 | Tropical Forest Soil | GSVLAVFTALRLIDVIPSFEDETQALASFRPLTNFAKPR* |
| Ga0126373_101193903 | 3300010048 | Tropical Forest Soil | GGHVLEVFKTLHLLRLIPSFEDEMEALASFGQLSCPAKL* |
| Ga0126373_102563193 | 3300010048 | Tropical Forest Soil | LKLLCPWGRVLQVLTVLRLLNLIPSFEDETQALASFRPQGHFAKP* |
| Ga0126373_106542053 | 3300010048 | Tropical Forest Soil | QKGGDLKLLCPWGRVLQVLNVLRLLNLIPSLEDETQALASFRPLGHFAKP* |
| Ga0126373_116077972 | 3300010048 | Tropical Forest Soil | DRVRKVLTLFRLQNIIPSFEDEAQALASFGPLGYFAKS* |
| Ga0126373_121805521 | 3300010048 | Tropical Forest Soil | PCDRVLNVLTVFRLQNVIPSFEDEAQALASFQPLSYFAKS* |
| Ga0126373_126408851 | 3300010048 | Tropical Forest Soil | PWGRVLQVLTVLRLLNLIPSFEDETQALASFRPLGHFAKP* |
| Ga0126370_112518301 | 3300010358 | Tropical Forest Soil | RLLRPSGAVLEVFKVLHLLAIIPSFEDETQALASFESSGHFAKP* |
| Ga0126378_132216621 | 3300010361 | Tropical Forest Soil | HVSLKRQGGGLRLLCVGGHVLEVFRVLHVLQIIPSFDDETQALASFQPVNDFAKP* |
| Ga0126381_1037722211 | 3300010376 | Tropical Forest Soil | GQGGDLKLLHPSGHVLEVFSMLHLQRLIPSFEDEAQALASFRPLR* |
| Ga0126381_1039266552 | 3300010376 | Tropical Forest Soil | DLKLLCPWGRVLQVLNVLRLLNLIPSFEDETQALASFRPLGYFAKP* |
| Ga0126381_1047862621 | 3300010376 | Tropical Forest Soil | LRPCGRVLEVLSVFRLLETIPSFKDEARALASFRPLSYFANP* |
| Ga0126383_108399032 | 3300010398 | Tropical Forest Soil | GDLKLLCPTGHVLAVLTALRLLDVIPSFEDETQAVASFRPLGNFAKPR* |
| Ga0150983_131802433 | 3300011120 | Forest Soil | RVLEVFNLLHLLEIIPSFEDVTQALASFRPQRYFAKP* |
| Ga0137391_109839801 | 3300011270 | Vadose Zone Soil | LKLLRPGGRVLEVFRALHLLEIIPTFKDESQALASFRPLGYFAKP* |
| Ga0137363_100725305 | 3300012202 | Vadose Zone Soil | VIIDTYVSLKDQGGDLKSLCPRGRVREVLRVLRLLEIIPYFENETKALVSFRPQSHFARP |
| Ga0137362_101514091 | 3300012205 | Vadose Zone Soil | DLKLLCPRGRVREVLRVLRLLEIIPYFENETKALVSFRPQSNFARP* |
| Ga0137360_102604311 | 3300012361 | Vadose Zone Soil | VSLKDQGGDLKLLCPRGRVREVLRVLRLLEIIPYFENETKGLVSFRPQSNFARP* |
| Ga0137360_105256951 | 3300012361 | Vadose Zone Soil | VSLKDQGGDLKLLCPRGRVREVLRVLRLLEIIPYFENETKALVSFRPQSNFARP* |
| Ga0137397_107006272 | 3300012685 | Vadose Zone Soil | VLEVFRPLHLLEIIPSFEDEAQALASFRPLGDSAKPGSS* |
| Ga0137359_113296492 | 3300012923 | Vadose Zone Soil | CPRGRVREVLRVLRLLEIISYFENETKALVSFRPQSYFARP* |
| Ga0137416_112027371 | 3300012927 | Vadose Zone Soil | EVLRVLRLLEIIPYFENETKALVSFRPQSDFARP* |
| Ga0182036_102044842 | 3300016270 | Soil | GHVLEVFNMLHLQRLIPSFEDEAQALASFRPQLSCSAKL |
| Ga0182041_101493975 | 3300016294 | Soil | CPWGRVLQVLNVLRLLNLIPSFEDETQALASFRPQGHFAKP |
| Ga0182033_115410422 | 3300016319 | Soil | CGPVLEVLTAFRLQGIIPRFEDEAQALASFRPLAYFANP |
| Ga0182035_101163711 | 3300016341 | Soil | HPSGHVLEVFNMLHLQRLIPSFEDEAQALASFRPQLSCSAKL |
| Ga0182035_101534975 | 3300016341 | Soil | GDLKLLCPWGRVLQVLNVLRLLNLIPSFEDETQALASFRPQGHFAKP |
| Ga0182035_103965292 | 3300016341 | Soil | GDLKLLCPWGRVLQVLNVLRLLNLIPSFEDETQALASFRPLGHFAKP |
| Ga0182034_100845421 | 3300016371 | Soil | GHVLEVFNMLHLQRLIPSFEDEAQALASFRPLLSCSAKP |
| Ga0182034_104247062 | 3300016371 | Soil | CPCGPVLEVLTAFRLQGIIPSFEDEAQALASFRPLVYFANP |
| Ga0182034_115948482 | 3300016371 | Soil | GDLKLLRPSGHVLEVLGVLHLLKLIPSFEDETQALASFLPLSYSAKP |
| Ga0182039_100752813 | 3300016422 | Soil | KLLHPSGHVLEVFNMLHLQRLIPSFEDEAQALASFRPLLSCSAKP |
| Ga0187772_105024971 | 3300018085 | Tropical Peatland | SIIVTNFTFLRDQGGHLKLLSPRGIVREVFTVLRLLEIIPSFEDESEALASFRPLGHFAK |
| Ga0066669_102152181 | 3300018482 | Grasslands Soil | GGDLKMLRPSGHVLEVFRVLRLLGTITSFDDETQALASFRSLGHAASSS |
| Ga0193729_10560061 | 3300019887 | Soil | RRQGGSLKLLCPCGRVRAVLRVVRLPEIIPTFEDETQALASFRPRGYSAGS |
| Ga0210401_104137181 | 3300020583 | Soil | LLRPEGRVLEVFKELHLLEIIPSFEDQTQAVASFRPQGHFAEP |
| Ga0210401_113551331 | 3300020583 | Soil | RVLQVLNVFHLLDTIPSFEDETRALTSFRPLSYSATP |
| Ga0187846_103553641 | 3300021476 | Biofilm | RVLEVLTVLRLLEIIPSFEDETQALASFQPLGYFAKP |
| Ga0210410_1001393613 | 3300021479 | Soil | KLLCPRGRVLEVLTVFRLLDTIPSFEDEAQALASFRPLRYFAKP |
| Ga0126371_110593283 | 3300021560 | Tropical Forest Soil | SLRQKGGDLKLLCPWGRVLQVLNVLRLLNLIPSFEDDTQALASFRPLGHFAKP |
| Ga0126371_122795842 | 3300021560 | Tropical Forest Soil | GGDLKLLCPWGRVLQVLNVLRLLNLIPSFEDETQALASFRPQGHFAKL |
| Ga0126371_124053721 | 3300021560 | Tropical Forest Soil | LCPWGRVLQVLNVLRLLNLIPSFEDETLALASFRPLGHFAKP |
| Ga0126371_124777891 | 3300021560 | Tropical Forest Soil | RPSGHVLEVLGVLHLLKLIPSFEDETQALASFLPLSYSAKP |
| Ga0207646_118565312 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | TRVSLKGRGGDLKLLRPGGHVLDAFRVLHLLDIISSFEDETQALASFRPR |
| Ga0209802_10873403 | 3300026328 | Soil | VLEVFRVLRLLGTITSFDDETQALASFRSLGHAASSS |
| Ga0257164_10110071 | 3300026497 | Soil | LDVFRVLHLLEIIPTFEDETQALASFRPLGYFAKP |
| Ga0257164_10868781 | 3300026497 | Soil | GRVLEVFRVLRLLEIIPNFEDETQALASFRPLGYFAKP |
| Ga0209648_107333833 | 3300026551 | Grasslands Soil | VREVLRVLRLLEIIPYFENETKALVSFRPQSNFARP |
| Ga0207725_1015411 | 3300026692 | Tropical Forest Soil | SPCGRVLEVLIVLRLLEIIPSFDGESEALASFQPLGYVAKP |
| Ga0207759_1110982 | 3300026823 | Tropical Forest Soil | VRKVLTVFRLQNIIPSFEDEAQALASFQPLGYSAKS |
| Ga0207730_10062361 | 3300026896 | Tropical Forest Soil | TQLVPSDRVRKVLTVFRLQNIIPSFEDEAQALASFGPLGYFDAKS |
| Ga0207858_10006621 | 3300026909 | Tropical Forest Soil | CGRVLEVLIVLRLLEIIPSFDCESEALASFQPLGYVAKP |
| Ga0207840_10093241 | 3300026910 | Tropical Forest Soil | PCGRVLEVLIVLRLLEIIPSFDGESEALASFQPLGYVAKP |
| Ga0209217_10437384 | 3300027651 | Forest Soil | RVLEVLRILHLLEMIPSFEDETQALASFRPLSYFAKP |
| Ga0209465_100871752 | 3300027874 | Tropical Forest Soil | QGGDLKLLRPGGHVLDVFKPLHLLDIIPSFEDETQALASFRPVQRQN |
| Ga0209283_102514993 | 3300027875 | Vadose Zone Soil | GDLKLLRPGGHVLEAFRVLHLLEIIPTFEDETQALASFRPW |
| Ga0209590_109257752 | 3300027882 | Vadose Zone Soil | RGQGGDLRLLHSGGRVLEVFRVLRLLEIIPNFEDETQALASFRPQGYFAKP |
| Ga0170820_141085692 | 3300031446 | Forest Soil | LKGRGGDLKLLRPGGHVLDAFRVLHLLDIISSFEDETQALASFRPG |
| Ga0318541_104488911 | 3300031545 | Soil | QWGRVLQVLTVLRLLNLIPSFEDETQALASFRPLGHFAKP |
| Ga0310915_104917101 | 3300031573 | Soil | LQVLNVLRLLNLIPSFEDETQALASFRPLGHFAKP |
| Ga0318542_100899721 | 3300031668 | Soil | GRVLQVLNVLRLLNLIPSFEDETQALASFRPQGHFAKP |
| Ga0318560_106573361 | 3300031682 | Soil | VLEVFKTLHLLKLIPSFEDESEALASFQPLTYSAKP |
| Ga0306917_105797252 | 3300031719 | Soil | SPTDRVRKVLTVFRLQGTIPSFEDEAQALASFQPLGYFAKP |
| Ga0306917_109487272 | 3300031719 | Soil | DLKLLRPSGHVLEVLGVLHLLKLIPSFEDETQALASFLPLSYSAKP |
| Ga0306917_111468212 | 3300031719 | Soil | WGRVLQVLNVLRLLNLIPSFEDETQALASFRPQGHFAKP |
| Ga0307469_120231651 | 3300031720 | Hardwood Forest Soil | KLLCPRGRVLDVLTVLRLLEIIPYFDKETGAVASFRPQSYFARP |
| Ga0306918_105760162 | 3300031744 | Soil | LKLLHPSGHVLEVFNMLHLQRLIPSFEDEAQALASFRPLLSCSAKL |
| Ga0306918_107214161 | 3300031744 | Soil | GPVLEVLTAFRLQGIIPSFEDEAQALASFRSIAYFANP |
| Ga0306918_114503902 | 3300031744 | Soil | LLRPGGHVLDVFKPLHLLDIIPSFEDETQALASFRPVQRQN |
| Ga0307475_102298242 | 3300031754 | Hardwood Forest Soil | GRVREVLRVLRLLEIIPYFENETKALASFRPQTYFASP |
| Ga0318521_110015781 | 3300031770 | Soil | RPSGHVHEVLGVLHLLKLIPSFEDETQALASFLPLSYSAKP |
| Ga0318547_107037172 | 3300031781 | Soil | RVLQVLGVLRLLNLIPSFEDETQALATFRPQGHFAKP |
| Ga0307478_101006581 | 3300031823 | Hardwood Forest Soil | CPRGRVREVLRVFRLLEIIPYFENETKALASFRPQSYFAKP |
| Ga0310917_101099311 | 3300031833 | Soil | VLEVFNMLHLQRLIPSFEDEAQALASFRPLLSCSAKP |
| Ga0318512_103993401 | 3300031846 | Soil | HEVLGVLHLLKLIPSFDDETQALASFLPLSYSAKP |
| Ga0306919_104066292 | 3300031879 | Soil | DLKLLRPGGHVLDVFKPLHLLDIIPSFEDETQALASFRPVQRRN |
| Ga0306919_111683812 | 3300031879 | Soil | DLKLLRPGGHVLDVFKPLHLLDIIPSFEDETQALASFRPVQRQN |
| Ga0306919_112528581 | 3300031879 | Soil | KLLRPGGHVLDVFKPLHLLDIIPSFEDETQALASFRPVQRQN |
| Ga0306925_111907152 | 3300031890 | Soil | LHPSGHVLEVFSILHLQKLIPSFEDEAQALASFRPLLSCAAKP |
| Ga0306925_114200701 | 3300031890 | Soil | PWGRVLQVLTVLRLLNLIPSFEDETQALASFRPQGHFAKP |
| Ga0318551_107548272 | 3300031896 | Soil | VLEVFKALHLLDVISSFEDETQALASFQPQAHFAKP |
| Ga0318520_110407511 | 3300031897 | Soil | EEQGDLKLLCPWGRVLQVLTVLRLLNLIPSFEDETQALASFRPLGHFAKP |
| Ga0306923_103664311 | 3300031910 | Soil | VLEVFNMLHLQRLIPSFEDEAQALASFRPLLSCSAKL |
| Ga0306923_113595051 | 3300031910 | Soil | SVLAVLTALRLLDVIPSFEDETQALASFQPLTSFAKPC |
| Ga0306921_1003192211 | 3300031912 | Soil | DRVLNVLTVFRLQNVIPSFEDEAQALASFQPLGFFAKS |
| Ga0306921_112038491 | 3300031912 | Soil | LEVLGVLHLLKLIPSFEDETQALASFLPLSYSAKP |
| Ga0306921_116478472 | 3300031912 | Soil | GQGGDLKLLHPSGHVLEVFNMLHLQRLIPSFEDEAQALASFRPGC |
| Ga0306921_118692082 | 3300031912 | Soil | PGGHVLDVFKPLHLLDIIPSFEDETQALASFRPVQRRN |
| Ga0306921_121374501 | 3300031912 | Soil | SGHVLEVFRMLHLLKLISSFEDEIEALASFGLLSCSGKL |
| Ga0310912_108587781 | 3300031941 | Soil | TGSVLAGFTALRLLNVIPSFEDETQALASFRPLTNFAKPR |
| Ga0310916_109764711 | 3300031942 | Soil | RLLSPTDRVRKVLTVFRLQGTIPSFEDEAQALASFQPLGYFAKP |
| Ga0310916_110690712 | 3300031942 | Soil | VRSYVSLRQKGGDLKLLCPWGRVLQVLNVLRLLNLIPSFEDETQALASFRPQGHFAKP |
| Ga0310913_107480002 | 3300031945 | Soil | LQVLNVLRLLNLIPSFEDETQALASFRPQGHFAKP |
| Ga0306922_100060491 | 3300032001 | Soil | EVFNMLHLQRLIPSFEDEAQALASFRPLLSCSAKP |
| Ga0306922_100702528 | 3300032001 | Soil | KGGDLKLLCPWGRVLQVLNVLRLLNLIPSFEDETQALASFRPQGHFAKP |
| Ga0318507_103286152 | 3300032025 | Soil | PSGHVLEVFSILHLQKLIPSFEDEAQALASFRPLTSCSAKP |
| Ga0310911_100572692 | 3300032035 | Soil | SLRGQGGDLKLLRPSGHVHEVLGVLHLLKLIPSFGDETQALASPCLRNL |
| Ga0318559_104429501 | 3300032039 | Soil | DLKLLRPGGHVLDVFKPLHLLDIIPSFEDETQALASFRPVQHHN |
| Ga0318570_104415291 | 3300032054 | Soil | LRQKGGDLKLLCPWGRVLQVLAVLRLLNVIPSFEDETQALATFRPQGHFAKP |
| Ga0318533_1003716311 | 3300032059 | Soil | EVFSILHLQKLIPSFEDEAQALASFRPLTSCSAKP |
| Ga0318533_109040862 | 3300032059 | Soil | LLHPSGHVLEVFNMLHLQRLIPSFEDEAQALASFRPLLSCSAKL |
| Ga0318533_110173802 | 3300032059 | Soil | PWGRVLQVLNVLRLLNLIPSFEDETQALASFRPLGHFAKP |
| Ga0318514_103810133 | 3300032066 | Soil | HPSGHVLEVFSILHLQKLIPSFEDEAQALASFRPLTSCSAKP |
| Ga0306924_104654241 | 3300032076 | Soil | LKLLHPSGHVLEVFNMLHLQRLIPSFEDEAQALASFRPLLSCSAKP |
| Ga0306924_111513132 | 3300032076 | Soil | LCPCGPVLEVLTAFRLQGIIPSFEDEAQALASFRPLVYFANP |
| Ga0318577_104126462 | 3300032091 | Soil | HVHEVLGVLHLLKLIPSFEDETQALASFLPLSYSAKP |
| Ga0318540_103980331 | 3300032094 | Soil | LKLLRPGGHVLDVFKPLHLLDIIPSFEDETQALASFRPVQRRN |
| Ga0307471_1005453011 | 3300032180 | Hardwood Forest Soil | RGRVREVLRVLRLLEIIPYFENETKALASFRPRSYFARP |
| Ga0307471_1037458111 | 3300032180 | Hardwood Forest Soil | LLRLGGRVLEVFRVLHLLEIIPNFEDETQALASFRPLGYFAKP |
| Ga0306920_1027948792 | 3300032261 | Soil | DLKLLCLCGRVFEVFRLMHLIQIIPNFQDETQALASFGPRGYAAAS |
| Ga0306920_1036710101 | 3300032261 | Soil | KLLHPGGHVLEVFKTLHLLKLIPSFEDESEALASFQPLTYSAKP |
| Ga0310914_1003339713 | 3300033289 | Soil | LHPSGHVLEVFSILHLQKLIPSFEDEAQALASFRPLTSCSAKP |
| Ga0310914_100504191 | 3300033289 | Soil | LKLLCPWGRVLQVLNVLRLLNLIPSFEDETQALASFRPQGHFAKP |
| Ga0310914_104605843 | 3300033289 | Soil | GSVLAVFTALRLLDVIPSFEDETQALASFQPLTSFAKPC |
| Ga0310914_106290203 | 3300033289 | Soil | HEVLGVLHLLKLIPSFEDETQALASFRPLTYAAKP |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |