NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F067334

Metagenome / Metatranscriptome Family F067334

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F067334
Family Type Metagenome / Metatranscriptome
Number of Sequences 125
Average Sequence Length 79 residues
Representative Sequence MTAPTPKPDEQPPARRFRIPRPAALAASACLAFAIFAVALIRVLPAPHARADYLIVGTLSTLAALITIFAGLVMGRRKR
Number of Associated Samples 85
Number of Associated Scaffolds 125

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 83.20 %
% of genes near scaffold ends (potentially truncated) 20.00 %
% of genes from short scaffolds (< 2000 bps) 66.40 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.800 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(16.000 % of family members)
Environment Ontology (ENVO) Unclassified
(43.200 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(34.400 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 47.66%    β-sheet: 0.00%    Coil/Unstructured: 52.34%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 125 Family Scaffolds
PF00589Phage_integrase 32.00
PF01663Phosphodiest 14.40
PF02899Phage_int_SAM_1 13.60
PF01134GIDA 4.80
PF02082Rrf2 1.60
PF00069Pkinase 1.60
PF08323Glyco_transf_5 1.60
PF00150Cellulase 0.80
PF01263Aldose_epim 0.80
PF01408GFO_IDH_MocA 0.80
PF01261AP_endonuc_2 0.80
PF00701DHDPS 0.80
PF00691OmpA 0.80
PF10816DUF2760 0.80
PF07638Sigma70_ECF 0.80
PF08241Methyltransf_11 0.80
PF00202Aminotran_3 0.80
PF08244Glyco_hydro_32C 0.80
PF03756AfsA 0.80
PF08450SGL 0.80
PF14246TetR_C_7 0.80
PF00728Glyco_hydro_20 0.80
PF00155Aminotran_1_2 0.80
PF07228SpoIIE 0.80
PF13349DUF4097 0.80
PF13426PAS_9 0.80
PF02616SMC_ScpA 0.80
PF05593RHS_repeat 0.80
PF04101Glyco_tran_28_C 0.80
PF01343Peptidase_S49 0.80
PF02627CMD 0.80
PF00989PAS 0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 125 Family Scaffolds
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 13.60
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 13.60
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 6.40
COG03294-hydroxy-tetrahydrodipicolinate synthase/N-acetylneuraminate lyaseCell wall/membrane/envelope biogenesis [M] 1.60
COG2524Predicted transcriptional regulator, contains C-terminal CBS domainsTranscription [K] 1.60
COG2378Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domainsTranscription [K] 1.60
COG2188DNA-binding transcriptional regulator, GntR familyTranscription [K] 1.60
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 1.60
COG1959DNA-binding transcriptional regulator, IscR familyTranscription [K] 1.60
COG1725DNA-binding transcriptional regulator YhcF, GntR familyTranscription [K] 1.60
COG0297Glycogen synthaseCarbohydrate transport and metabolism [G] 1.60
COG1414DNA-binding transcriptional regulator, IclR familyTranscription [K] 1.60
COG0438Glycosyltransferase involved in cell wall bisynthesisCell wall/membrane/envelope biogenesis [M] 1.60
COG0640DNA-binding transcriptional regulator, ArsR familyTranscription [K] 1.60
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 1.60
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.80
COG3934Endo-1,4-beta-mannosidaseCarbohydrate transport and metabolism [G] 0.80
COG3525N-acetyl-beta-hexosaminidaseCarbohydrate transport and metabolism [G] 0.80
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.80
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.80
COG3209Uncharacterized conserved protein RhaS, contains 28 RHS repeatsGeneral function prediction only [R] 0.80
COG2730Aryl-phospho-beta-D-glucosidase BglC, GH1 familyCarbohydrate transport and metabolism [G] 0.80
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.80
COG0676D-hexose-6-phosphate mutarotaseCarbohydrate transport and metabolism [G] 0.80
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.80
COG2017Galactose mutarotase or related enzymeCarbohydrate transport and metabolism [G] 0.80
COG1354Chromatin segregation and condensation protein Rec8/ScpA/Scc1, kleisin familyReplication, recombination and repair [L] 0.80
COG1621Sucrose-6-phosphate hydrolase SacC, GH32 familyCarbohydrate transport and metabolism [G] 0.80

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.80 %
UnclassifiedrootN/A11.20 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001175|JGI12649J13570_1007562All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1349Open in IMG/M
3300005338|Ga0068868_101514200All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia628Open in IMG/M
3300005533|Ga0070734_10216307All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300005538|Ga0070731_10000696All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia41277Open in IMG/M
3300005538|Ga0070731_10846728All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300005591|Ga0070761_10003590All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae9273Open in IMG/M
3300005610|Ga0070763_10579938All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300005712|Ga0070764_10344892All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300005843|Ga0068860_101863541All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia623Open in IMG/M
3300005921|Ga0070766_10118700All Organisms → cellular organisms → Bacteria → Acidobacteria1588Open in IMG/M
3300005921|Ga0070766_10171740All Organisms → cellular organisms → Bacteria1340Open in IMG/M
3300005995|Ga0066790_10449084Not Available551Open in IMG/M
3300005995|Ga0066790_10527002All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia505Open in IMG/M
3300009522|Ga0116218_1494398All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia545Open in IMG/M
3300009623|Ga0116133_1059433All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia950Open in IMG/M
3300009623|Ga0116133_1126990All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3659Open in IMG/M
3300009624|Ga0116105_1198872All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia552Open in IMG/M
3300009644|Ga0116121_1222344All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia602Open in IMG/M
3300009645|Ga0116106_1192101All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia650Open in IMG/M
3300009665|Ga0116135_1003742All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus6377Open in IMG/M
3300009665|Ga0116135_1098385All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1057Open in IMG/M
3300009698|Ga0116216_10461855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3769Open in IMG/M
3300009764|Ga0116134_1042054All Organisms → cellular organisms → Bacteria1773Open in IMG/M
3300010343|Ga0074044_10856291Not Available594Open in IMG/M
3300010343|Ga0074044_11035897Not Available538Open in IMG/M
3300010379|Ga0136449_100003376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia47853Open in IMG/M
3300014152|Ga0181533_1005486All Organisms → cellular organisms → Bacteria12117Open in IMG/M
3300014153|Ga0181527_1016059All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5075Open in IMG/M
3300014156|Ga0181518_10001407All Organisms → cellular organisms → Bacteria → Acidobacteria24675Open in IMG/M
3300014156|Ga0181518_10169447All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1156Open in IMG/M
3300014160|Ga0181517_10163841All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1240Open in IMG/M
3300014162|Ga0181538_10024870All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4075Open in IMG/M
3300014164|Ga0181532_10004317All Organisms → cellular organisms → Bacteria → Acidobacteria12492Open in IMG/M
3300014165|Ga0181523_10080464All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1973Open in IMG/M
3300014165|Ga0181523_10247446All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31019Open in IMG/M
3300014165|Ga0181523_10469664All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia696Open in IMG/M
3300014168|Ga0181534_10021336All Organisms → cellular organisms → Bacteria3273Open in IMG/M
3300014200|Ga0181526_10715949All Organisms → cellular organisms → Bacteria → Terrabacteria group631Open in IMG/M
3300014200|Ga0181526_10861517All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia570Open in IMG/M
3300014489|Ga0182018_10001043All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus33393Open in IMG/M
3300014489|Ga0182018_10023317All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4044Open in IMG/M
3300014489|Ga0182018_10169348All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1238Open in IMG/M
3300014491|Ga0182014_10323765All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia785Open in IMG/M
3300014501|Ga0182024_11116044All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus930Open in IMG/M
3300016730|Ga0181515_1439255Not Available574Open in IMG/M
3300017935|Ga0187848_10271116All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia713Open in IMG/M
3300017946|Ga0187879_10057506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2280Open in IMG/M
3300017946|Ga0187879_10078089All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA31915Open in IMG/M
3300017946|Ga0187879_10152120All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1309Open in IMG/M
3300017946|Ga0187879_10406850All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia754Open in IMG/M
3300017988|Ga0181520_10294504All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1218Open in IMG/M
3300018019|Ga0187874_10162596All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia940Open in IMG/M
3300018026|Ga0187857_10230577Not Available857Open in IMG/M
3300018030|Ga0187869_10245137All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia869Open in IMG/M
3300018033|Ga0187867_10066042All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales2144Open in IMG/M
3300018035|Ga0187875_10100774All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1641Open in IMG/M
3300018037|Ga0187883_10154323All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1182Open in IMG/M
3300018038|Ga0187855_10426001All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia773Open in IMG/M
3300018040|Ga0187862_10149067All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1577Open in IMG/M
3300018042|Ga0187871_10054186All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L462403Open in IMG/M
3300018042|Ga0187871_10059880All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2262Open in IMG/M
3300018042|Ga0187871_10106172All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1615Open in IMG/M
3300018043|Ga0187887_10345403Not Available878Open in IMG/M
3300018046|Ga0187851_10002396All Organisms → cellular organisms → Bacteria → Acidobacteria16650Open in IMG/M
3300018057|Ga0187858_10201921All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1297Open in IMG/M
3300018088|Ga0187771_11704705All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia535Open in IMG/M
3300022524|Ga0224534_1020201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1779Open in IMG/M
3300022873|Ga0224550_1069089Not Available508Open in IMG/M
3300023088|Ga0224555_1001786All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia27883Open in IMG/M
3300023088|Ga0224555_1125579All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia769Open in IMG/M
3300025927|Ga0207687_11519560All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia575Open in IMG/M
3300027676|Ga0209333_1005502All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus4344Open in IMG/M
3300027745|Ga0209908_10018852All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1284Open in IMG/M
3300027853|Ga0209274_10005072All Organisms → cellular organisms → Bacteria6072Open in IMG/M
3300027854|Ga0209517_10585013All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3594Open in IMG/M
3300027869|Ga0209579_10019449All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3859Open in IMG/M
3300027889|Ga0209380_10241272Not Available1061Open in IMG/M
3300027889|Ga0209380_10366265All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300027905|Ga0209415_10969300All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia570Open in IMG/M
3300027911|Ga0209698_10076274All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales2852Open in IMG/M
3300029910|Ga0311369_10479917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1061Open in IMG/M
3300029943|Ga0311340_10055926All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4622Open in IMG/M
3300029943|Ga0311340_10745278All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia833Open in IMG/M
3300029952|Ga0311346_10795105All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300029954|Ga0311331_10534483All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1133Open in IMG/M
3300029999|Ga0311339_10856207All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia868Open in IMG/M
3300030399|Ga0311353_11558207Not Available534Open in IMG/M
3300030520|Ga0311372_10998044All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1106Open in IMG/M
3300031234|Ga0302325_10081940All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus6163Open in IMG/M
3300031234|Ga0302325_10209516All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3335Open in IMG/M
3300031236|Ga0302324_100187937All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales3317Open in IMG/M
3300031236|Ga0302324_100774842All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1340Open in IMG/M
3300031236|Ga0302324_101960405Not Available737Open in IMG/M
3300031236|Ga0302324_102437065All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia641Open in IMG/M
3300031236|Ga0302324_102607305All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300031236|Ga0302324_102824342All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia583Open in IMG/M
3300031242|Ga0265329_10255494Not Available585Open in IMG/M
3300031525|Ga0302326_10130428All Organisms → cellular organisms → Bacteria → Acidobacteria4390Open in IMG/M
3300031525|Ga0302326_10344229All Organisms → cellular organisms → Bacteria → Acidobacteria2349Open in IMG/M
3300031525|Ga0302326_12723508All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia613Open in IMG/M
3300031525|Ga0302326_12777839All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia606Open in IMG/M
3300031708|Ga0310686_117683811All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales747Open in IMG/M
3300032160|Ga0311301_10018836All Organisms → cellular organisms → Bacteria → Acidobacteria19817Open in IMG/M
3300032160|Ga0311301_10201430All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3411Open in IMG/M
3300032160|Ga0311301_11737037All Organisms → cellular organisms → Bacteria → Acidobacteria748Open in IMG/M
3300032770|Ga0335085_10000143All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia228179Open in IMG/M
3300032783|Ga0335079_10026979All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus6579Open in IMG/M
3300032783|Ga0335079_10072473All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3921Open in IMG/M
3300032783|Ga0335079_11427461Not Available686Open in IMG/M
3300032805|Ga0335078_10019407All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus10108Open in IMG/M
3300032805|Ga0335078_10025703All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus8736Open in IMG/M
3300032805|Ga0335078_10122189All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3724Open in IMG/M
3300032805|Ga0335078_10274976All Organisms → cellular organisms → Bacteria2281Open in IMG/M
3300032828|Ga0335080_10658318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1096Open in IMG/M
3300032892|Ga0335081_10175410All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3014Open in IMG/M
3300032892|Ga0335081_11138161All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter896Open in IMG/M
3300032892|Ga0335081_11808068Not Available661Open in IMG/M
3300032893|Ga0335069_10273236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2022Open in IMG/M
3300032895|Ga0335074_10054178All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus5508Open in IMG/M
3300032895|Ga0335074_10166050All Organisms → cellular organisms → Bacteria2761Open in IMG/M
3300032897|Ga0335071_11493268Not Available620Open in IMG/M
3300033134|Ga0335073_10813291All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1000Open in IMG/M
3300033134|Ga0335073_11836678All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia564Open in IMG/M
3300033822|Ga0334828_024739All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1837Open in IMG/M
3300033887|Ga0334790_019410All Organisms → cellular organisms → Bacteria → Acidobacteria3109Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland16.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil14.40%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa14.40%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog11.20%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland6.40%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.40%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil6.40%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil4.80%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil3.20%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa2.40%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil1.60%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.60%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.60%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog1.60%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.80%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.80%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.80%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost0.80%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.80%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.80%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.80%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.80%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.80%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001175Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3EnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009623Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10EnvironmentalOpen in IMG/M
3300009624Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016730Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018046Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300022524Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24EnvironmentalOpen in IMG/M
3300022873Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 10-14EnvironmentalOpen in IMG/M
3300023088Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027869Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027889Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033822Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9EnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12649J13570_100756223300001175Forest SoilMTAPTPKPDEPGKKPPSRRFHIPSGAALTLSAGLAFAIFAVALIRVLPSPHSKADYLIVGTLATLAALITIFAGLVMGRRKR*
Ga0068868_10151420023300005338Miscanthus RhizosphereMTAPTPKPDENTPRRRFGVPRPAALAGSAFLAFAVFTIALLRVLPEPHTRSDYLIVGTLATLAGLIVVFAGLVLGRRKKLD*
Ga0070734_1021630723300005533Surface SoilMTAPTPKPDEPAPAAPTRPRLSRPVALALSACVAFTVFAVALIRVLPKPHARADYLIVGTLASLAALITIFAGLVIGRRKR*
Ga0070731_10000696173300005538Surface SoilMTAPTLKPDENRPRRFHIPRPAALIASACLAFAVFALSLVRVLPQPHTKADYLIVGTLATLAGLITVFAGLVLGRRRR*
Ga0070731_1084672823300005538Surface SoilMTAPTPKPDESERRRFRIPRPAALFAAACVAFLVFAVALIRVLPSPHTKADYMIVGTLATLAGLITIFAGLVMGRRR*
Ga0070761_10003590143300005591SoilMTAPTPKPDGPDEKAPSRRFRVPRPAALAASACLAFAVFAVALIRVLPSPHGRADYLIVGTLATLAALITIFAGLVMGRRRR*
Ga0070763_1057993823300005610SoilMTGPTPKPDNPKPDEARPRRFRLPRPAALAVSACMAFAIFAVALIRVLPSPHARSDYLIVGTLATLAALITIFAGLVMGRRRP*
Ga0070764_1034489223300005712SoilMTGPTPKPDNPKPDESKPDEVRPRRFRLPRPAALAVSACMAFAIFAVALIRVLPSPHARSDYLIVGTLATLAALITIFAGLVMGRRRP*
Ga0068860_10186354123300005843Switchgrass RhizosphereMTAPTPKPDENTPRRRFGVPRPAALAGSAFLAFAVFTIALLRVLPEPHTRSDYLIVGTLATLAGLIVVFAGL
Ga0070766_1011870023300005921SoilMTAPTPKPDEKPPARGFRIPRPAALGGSACLAFAIFALALIRVLPAPHGRADYLIVGTLATLAALITIFAGLVLGRRKR*
Ga0070766_1017174023300005921SoilMTGPTPKPDNPKPDESKPDEVRPRRFRVPRPAALAVSACMAFAIFAVALIRVLPSPHARSDYLIVGTLATLAALITIFAGLVMGRRRP*
Ga0066790_1044908423300005995SoilWRFMTAPTPKPDQSAPRKVRIPRSVALGVSACLIFIVFAFALTRLLPSPHASSDYLVVGTLATLAALITVFAGLVLSRRKR*
Ga0066790_1052700223300005995SoilMTAPTPKPDDAAQQPAARRFRIPRPAALAISASIAFAVFAVTLIRVLPSPHGRADYLIVGTLSTLAALIVIFAGLVMGRR*
Ga0116218_149439813300009522Peatlands SoilMTAPTPKPDEPKPGGNVPSRRFRLPRSAALVLAACLAFAIIAVALIRVLPSPHSKADYLIVGTLATLAALIAIFAGLVLGRQKR*
Ga0116133_105943313300009623PeatlandMTAPTPKPDEQPPARRLRIPRPAALAASACLAFTIFAVALIRVLPAPHGRADYLIVGTLSTLAALITIFAGLVLGRRKR*
Ga0116133_112699023300009623PeatlandPKPDEPAEKAAPRRFRIPRPVALAISACIAFTVFAVALIRVLPAPHGKADYLIVGTLATLAALIAIFAGLVMGRRGR*
Ga0116105_119887213300009624PeatlandMTAPTPKPDGKPAARGFRIPRPVALGASACLAFAIFAVALIRVLPAPHGRADYLIVGTLSTLAALITIFAGLVLGRRKR*
Ga0116121_122234413300009644PeatlandMTAPTPKPDEPAEKAAPRRFRIPRPVALAISACIAFAVFAVALIRVLPSPHARADYLIVGTLATLAALITIFAGLVMGRRKR*
Ga0116106_119210123300009645PeatlandMTAPTPKPDGPDEKAPPRRFRIPRPAALAISACIAFAVFAVALIRVLPSPHARADYLIVGTLATLAAL
Ga0116135_100374253300009665PeatlandMTAPTPKPDDPAKTPSSRRFRIPRGVALTGSATLAFAVFAVALIRVLPSPHSKADYLIVGTLATLAALITIFAGLVMGRRKR*
Ga0116135_109838523300009665PeatlandMTAPTPKPDEAKPEAPARGFRIPRPAALAASACLAFVVFAVALVRVLPSPHSKYDYLIVGTLATLAALITIFAGLVMSRRKR*
Ga0116216_1046185523300009698Peatlands SoilPTPKPDEPKPEGKLPSRRFRLPRPAALAISACLAFAIFTVGLIRVLPAPHTKHDYLIVGTLATLAALITMFAGLVLGRRKR*
Ga0116134_104205423300009764PeatlandMAPKPDESSAGPRRRIPRPAALIASACIVFAILAVALMQALPAPHSKADYLIVGTLATLAALITIFAGLLLGRRSRL*
Ga0074044_1085629113300010343Bog Forest SoilMTAPTPKPDEFPPPRRFRIPRPAALAGSASLAFAVFAIALIRVLPEPHGRADYLIVGTLSTLAALITIFAGLVMGRKKR*
Ga0074044_1103589723300010343Bog Forest SoilPTPKPDAPRRVRIPRSAALAASACLAFAVFAVALFRVLPSPHSKAGYLIVGTLSTLAGLITVFAGLVLGRRKR*
Ga0136449_100003376453300010379Peatlands SoilMTGPTPKPDEPKPEGKLPSRRFRLPRPAALAISACLAFAIFTVGLIRVLPAPHTKHDYLIVGTLATLAALITMFAGLVLGRRKR*
Ga0181533_100548633300014152BogMTAPTPKPDEKPPSHRFRIPRPAALAASACLPFATIAVALIRVLPAPHSKADYLIVGTLATLAALITLFAGLVLGRKR*
Ga0181527_101605913300014153BogMTAPTPKPDEKPPSHRFRIPRPAALAASACLAFATIAVALIRVLPAPHSKADYLIVGTLATLAALITLFAGLVLGRKR*
Ga0181518_1000140793300014156BogMAPKPDEDSTGARRRIPRPAALIASACIVFAILAVALMQALPAPRSKADYLIIGTLSTLAALITIFAGLLLGRRSRR*
Ga0181518_1016944723300014156BogMTAPTPKPDEQPPAHRFRIPRPAALAASASLAFAIFAIALIRVLPAPHARADYLIVGTLSTLAALITIFAG
Ga0181517_1016384123300014160BogMTAPTPKPDEQPPAHRFRIPRPAALAASASLAFAIFAIALIRVLPAPHARADYLIVGTLSTLAALITIFAGLVMGRRKR*
Ga0181538_1002487033300014162BogMTAPTPKPDEQPPARRFRIPRPAALAASASLAFAIFAIALIRVLPAPHARADYLIVGTLSTLAALITIFAGLVMGRRKR*
Ga0181532_1000431753300014164BogMTAPTPKPDEPAEKAAPRRFRIPRPMALAISACIAFTVFAVALIRVLPAPHGKADYLIVGTLATLAALIAIFAGLVMGRRGR*
Ga0181523_1008046423300014165BogMTAPTPKPDEPAEKAAPRRFRIPRPVALAISACIAFTVFAVALIRVLPAPHGKADYLIVGTLATLAALIAIFAGLVMGRRGR*
Ga0181523_1024744613300014165BogDPKPDEPKHDQKPPRRFRIPRSAALAGSACLAFAVFAVALIRVLPSPHSHADLLIVGTLSTLAALITIFAGLVLGRRKR*
Ga0181523_1046966423300014165BogMTAPTPKPDGPDEKAPPRRFRIPRSATLAGSACLAFAVFAVALIRVLPSPHSHADFLIVGTLATLAALITIFAGLVLGRRKR*
Ga0181534_1002133623300014168BogMTAPTPKPDGKPAARGFCIPRPVALGASACLAFAIFAVALIRVLPAPHGRADYLIVGTLSTLAALITIFAGLVLGRRKR*
Ga0181526_1071594923300014200BogMTAPTPKPDEPKPEEHVPAGRFRLPRPVALAAVACLAFAVFTVALLRVLPAPHTKADDLIVGTLATSAALIAVFAGLLMGRRKR*
Ga0181526_1086151723300014200BogMTAPTPKPDDPATKDPPRRFRIPRPAALAGSAAMAFAIFAVALIHVLPSPHSKYDYLIVGTLATLAALITIFAGLVLGRRKR*
Ga0182018_10001043173300014489PalsaMTVPTPKPDEKAPPRRFRIPRSAALGVSACLVFTIFAVALVRVLPSPHTRNDELIVGTLATLAALITIFAGLVLGRRKR*
Ga0182018_1002331743300014489PalsaMTEPTPKPDDPKPEESAAPRRFRIPRWAALAGSAGMAFAVFAVALNRVLPPPHTKADYLIVGTLATLAALIAIFAGLVMGRRR*
Ga0182018_1016934823300014489PalsaMTAPTPKPEEHEAKVRRYRLRIPRPAALGVSACMAFAVFALALIRVLPSPHAKSDYLIIGTLATLAALITIFAGLVMGRRKR*
Ga0182014_1032376513300014491BogMTAPTPKPDEQPPARRFRIPRPAALAASACLAFAIFAVALIRVLPAPHARADYLIVGTLSTLAALITIFAGLVMGRRKR*
Ga0182024_1111604423300014501PermafrostMTAPTPKPDEPKPGENAPSRGFRIPRPAALAISACVAFAIFAIALNRVLPAPHTRADYLIMGTLATLAGLIAIFAGLVMGRGKK*
Ga0181515_143925523300016730PeatlandMAPKPDEDSTGARRRIPRPAALIASACIVFAILAVALMQALPAPRSKADYLIIGTLSTLAALITIFAGLLLGRRSRR
Ga0187848_1027111623300017935PeatlandMTAPTPKPDEQPPARRLRIPRPAALAASACLAFTIFAVALIRVLPAPHGRADYLIVGTLSTLAALITIFAGLVLGRRKR
Ga0187879_1005750633300017946PeatlandMTAPTPKPDGPDEKAPPRRFRIPRSATLAGSACLAFAVFAVALIRVLPSPHSHADFLIVGTLATLAALITIFAGLVLGRRKR
Ga0187879_1007808923300017946PeatlandMTAPTPKPDEPAEKAAPRRFRIPRPMALAISACIAFTVFAVALIRVLPAPHGKADYLIVGTLATLAALIAIFAGLVMGRRGR
Ga0187879_1015212023300017946PeatlandMTAPTPKPDEPKPGENAPSRGFRIPRPAALAISACLAFAIFAIALNRVLPAPHTRADYLIMGTLATLAGLIAIFAGLVMGRGKK
Ga0187879_1040685023300017946PeatlandMTAPTPKPDEAKPEAPARGFRIPRPAALAASACLAFVVFAVALVRVLPSPHSKYDYLIVGTLATLAALITIFAGLVMSRRKR
Ga0181520_1029450423300017988BogMTAPTPKPDEQPPAHRFRIPRPAALAASASLAFAIFAIALIRVLPAPHARADYLIVGTLSTLAALITIFAGLVMGRRKR
Ga0187874_1016259613300018019PeatlandMTAPTPKPDEPAEKAAPRRFRIPRPMALAISACIAFTVFAVALIRVLPAPHGKADYLIVGTLATLAALIAIFAGLVM
Ga0187857_1023057713300018026PeatlandMAPKPDESSAGPRRRIPRPAALIASACIVFAILAVALMQALPAPHSKADYLIVGTLATLAALITIFAGLLLGRRSRL
Ga0187869_1024513723300018030PeatlandMTAPTPKPDGPDEKAPPRRFRIPRPAALAISACIAFTVFAVALIRVLPAPHGKADYLIVGTLATLAALIAIFAGLVMGRRGR
Ga0187867_1006604223300018033PeatlandMTAPTPKPDEPAEKAAPRRFRIPRPVALAISACIAFTVFAVALIRVLPAPHGKADYLIVGTLATLAALIAIFAGLVMGRRGR
Ga0187875_1010077423300018035PeatlandMTAPTPKPDGPDEKAPPRRFRIPRPAALAISACIAFVVFAVALIRVLPSPHARADYLIVGTLATLAALIVIFAGLVMGRRKR
Ga0187883_1015432333300018037PeatlandMTAPTPKPDEPKPGENAPSRGFRIPRPAALAISACLAFAIFAIALNRVLPAPHTRADYLIMGTLATL
Ga0187855_1042600123300018038PeatlandMTAPTPKPEGPDEKAPPRRFRIPRPAALAISACIAFAVFAVALIRVLPSPHARADYLIVGTLATLAALIVIFAGLVMGRRKR
Ga0187862_1014906723300018040PeatlandMTAPTPKPDEQPPARRLRIPRPAALPASACLAFTIFAVALIRVLPTPHGRADYLIVGTLSTLAALITIFAGLVLGRRKR
Ga0187871_1005418633300018042PeatlandMAPKPDEDSTGARRRIPRPAALIASACIVFAILAVALMQALPAPRSKADYLIVGTLATLAALITIFAGLLLGRRSRL
Ga0187871_1005988053300018042PeatlandGPDEKAPPRRFRIPRPAALAISACIAFAVFAVALIRVLPSPHARADYLIVGTLATLAALIVIFAGLVMGRRKR
Ga0187871_1010617223300018042PeatlandMTAPTPKPDGPDEKAPPRRFRIPRPAALAISACIAFVVFAVALIRVLPSPHARADYLIVGTLATLAALITIFAGLVMGRRKR
Ga0187887_1034540313300018043PeatlandMTAPTPKPDDPATKDPPRRFRIPRPAALAGSAAMAFAIFAVALIHVLPSPHSKYDYLIVGTLATLAALITIFAGLVLGRRKR
Ga0187851_1000239633300018046PeatlandMTAPTPKPDEQPPARRLRIPRPAALAASACLAFTIFAVALIRVLPTPHGRADYLIVGTLSTLAALITIFAGLVLGRRKR
Ga0187858_1020192113300018057PeatlandMTAPTPKPDGPDEKAPPRRFRIPRSATLAGSACLAFAVFAVALIRVLPSPHSHADFLIVGTLATLAALITIFAGLVLGR
Ga0187771_1170470523300018088Tropical PeatlandMTAPTPKREQNAPRRLRWLRPVALAIGACLVFAILAVALIRVLPMPHARADYLMVGTL
Ga0224534_102020123300022524SoilMTAPTPKPDEQPPARRFRIPRPAALAASACLAFAIFAVALIRVLPAPHARADYLIVGTLSTLAALITIFAGLVMGRRKR
Ga0224550_106908923300022873SoilTPKPDGPDEKATPRRFRIPRPAALAISAGIAFVFFAVVLIRVLPSPHAQADYLIVGTLATLAALITIFTGLVMGRRKR
Ga0224555_1001786243300023088SoilMTAPTPKPDEQPPARRFRIPRPAALAASACLAFAIFAVALIRVLPAPHARADYLIVGTLSTLAALITIFAWL
Ga0224555_112557923300023088SoilMTAPTPKPDEQPPARRFRIPRPAALAISASLAFAIFAIALIRVLPAPHAKADYLIVGTLSTLAALITIFAGLVMGRRKR
Ga0207687_1151956023300025927Miscanthus RhizosphereMTAPTPKPDENTPRRRFGVPRPAALAGSAFLAFAVFTIALLRVLPEPHTRSDYLIVGTLATLAGLIVVFAGLVLGRRKKLD
Ga0209333_100550243300027676Forest SoilMTAPTPKPDEPGKKPPSRRFHIPSGAALTLSAGLAFAIFAVALIRVLPSPHSKADYLIVGTLATLAALITIFAGLVMGRRKR
Ga0209908_1001885223300027745Thawing PermafrostMTVPTPKPDEKAPPRRFRIPRSAALGVSACLVFTIFAVALVRVLPSPHTRNDELIVGTLATLAALITIFAGLVLGRRKR
Ga0209274_1000507223300027853SoilMTAPTPKPDGPDEKAPSRRFRVPRPAALAASACLAFAVFAVALIRVLPSPHGRADYLIVGTLATLAALITIFAGLVMGRRRR
Ga0209517_1058501313300027854Peatlands SoilDEPKPEGKLPSRRFRLPRPAALAISACLAFAIFTVGLIRVLPAPHTKHDYLIVGTLATLAALITMFAGLVLGRRKR
Ga0209579_1001944943300027869Surface SoilMTAPTLKPDENRPRRFHIPRPAALIASACLAFAVFALSLVRVLPQPHTKADYLIVGTLATLAGLITVFAGLVLGRRRR
Ga0209380_1024127213300027889SoilNPKPDEARPRRFRLPRPAALAVSACMAFAIFAVALIRVLPSPHARSDYLIVGTLATLAALITIFAGLVMGRRRP
Ga0209380_1036626513300027889SoilMTAPTPKPDEKPPARGFRIPRPAALGGSACLAFAIFALALIRVLPAPHGRADYLIVGTLATLAALITIFAGLVLGRRKR
Ga0209415_1096930023300027905Peatlands SoilMTAPTPKPDEPRRLRIPRPAALAISASIAFAVFAVALIRVLPPPHTKADYLIVGTLATLAALITIFAGLVMGRRKS
Ga0209698_1007627433300027911WatershedsMIAPTPKPDEKPPSRFSIPRPLALAVSAAMAFTVFAVALSRVLPVPHSRSDYLIVGTLATLAGLITIFAGLVMTRRKR
Ga0311369_1047991723300029910PalsaMTEPTPKPDDPKPEESAAPRRFRIPRWAALAGSAGMAFAVFAVALNRVLPPPHTKADYLIVGTLATLAALIAIFAGLVMGRRR
Ga0311340_1005592643300029943PalsaMTAPTPKPDEFPPPRRFRIPRPAALAGSASLAFAVFAIALIRVLPEPHGRADYLIVGTLSTLAALITIFAGLVMGRKKR
Ga0311340_1074527823300029943PalsaMTVPTPKPDEPKPGVSTPPRRFRIPRSAALIASACMAFVVFAVALIRVLPAPHGKADYLIVGTLATLAALITIFAGLVIGRGKRLPRP
Ga0311346_1079510523300029952BogMTAPTPKPDAPKPESSVPARGFRLPRPAALAISACLVFAIFAVSLLRVLPPPHGHADYLIVGTLSTLSALITVFAGLVMGRGKR
Ga0311331_1053448313300029954BogMTAPTPKPDAPKPESSVPARGFRLPRPAALAISACLVFAIFAVSLLRVLPPPRGHADYLIVGTLSTLAALITVFAGLVMGRGKR
Ga0311339_1085620713300029999PalsaMTAPTPRPDDPKSGENRPSRRFRIPRPAALALSAGLAFAIFAVALIRVLPLPHGRADYLIVGTLATLAALITIFAGLV
Ga0311353_1155820713300030399PalsaPAEKAPPRRSRIPRPVALAISAGIAFAVFAVALLRVLPSPHGRADYLIVGTLATLAALIVIFAGLVMGRRKR
Ga0311372_1099804413300030520PalsaMTEPTPKPDDPKPEESAAPRRFRIPRWAALAGSAGMAFAVFAVALNRVLPPPHTKADYLIVGTLATLAALI
Ga0302325_1008194023300031234PalsaMTAPTPKPDGPAEKAPPRRSRIPRPVALAISAGIAFAVFAVALLRVLPSPHGRADYLIVGTLATLAALIVIFAGLVMGRRKR
Ga0302325_1020951623300031234PalsaVPTPKPDEKAPPRRFRIPRSAALGVSACLVFTIFAVALVRVLPSPHTRNDELIVGTLATLAALITIFAGLVLGRRKR
Ga0302324_10018793733300031236PalsaMTAPTPKPDGPKPRFRIPRPAALGVSACLAFAIFAVALIRVLPSPHGRADYLIVGTLATLAALIVIFAGLVLSRRKR
Ga0302324_10077484223300031236PalsaMTAPTPKPDGPDEKATPRRFRIPRPAALAISAGIAFVFFAVVLIRVLPSPHAQADYLIVGTLATLAALITIFTGLVMGRRKR
Ga0302324_10196040513300031236PalsaKPEEKAAPRRFRIPRPAALALSASLAFAIFAVSLIRVLPSPHGKADYLIVGTLSTLAALITIFAGLVMGRLKR
Ga0302324_10243706513300031236PalsaMTAPTPKPEEPQPPVNTAAHRWRLSRPAAMAISATLAFAIFSIALTSVLPSPHTRSDYLIVGTLSTLAALITLFAGLVLGRRKR
Ga0302324_10260730513300031236PalsaAPTPKPDGPKPRFRIPRPAALGVSASIAFAIFAVALIRVLPSPHGRADYLIVGTLATLAALIVIFAGLVLGRRKR
Ga0302324_10282434223300031236PalsaMTAPTPKPDDRKPRFRVPRPAALGISASIAFAIFAVALIRVLPSPHGRADYLIVGTLATLAALIVIFAGLLLGWRKR
Ga0265329_1025549413300031242RhizosphereMTAPTPKPDESVPRKVRIPRSVALGVSACLIFIVFAAALTRLLPSPHASSDYLVVGTLATLAALITVFAGLVLSRRKR
Ga0302326_1013042823300031525PalsaMTVPTPKPDEPKPGVSTPARRFRIPRSAALIASACMAFVVFAVALIRVLPAPHGKADYLIVGTLATLAALITIFAGLVIGRGKRLPRP
Ga0302326_1034422923300031525PalsaMTAPTPKPDGPKPRFRIPRPAALGVSASIAFAIFAVALIRVLPSPHGRADYLIVGTLATLAALIVIFAGLVLGRRKR
Ga0302326_1272350823300031525PalsaMTAPTPRPDDPKSGENRPSRRFRIPRPAALALSAGLAFAIFAVALIRVLPLPHGRADYLIVGTLATLAALITIFAGLVMGRGKR
Ga0302326_1277783913300031525PalsaMTAPTPKPDEPKPEEKAAPRRFRIPRPAALALSASLAFAIFAASLIRVLPSPHGKADYLIVGTLSTLAALITIFAGLVMGRLKR
Ga0310686_11768381123300031708SoilMTAPTPKPDAHDDNSAPHRFRIPRTAALIASACLAFAVFAVALIRVLPSPHSKADYLIVGTLATLAGLITIFAGLVMGRSKIGR
Ga0311301_10018836183300032160Peatlands SoilMTGPTPKPDEPKPEGKLPSRRFRLPRPAALAISACLAFAIFTVGLIRVLPAPHTKHDYLIVGTLATLAALITMFAGLVLGRRKR
Ga0311301_1020143023300032160Peatlands SoilMTAPTPKPDEPKPGGNVPSRRFRLPRSAALVLAACLAFAIIAVALIRVLPSPHSKADYLIVGTLATLAALIAIFAGLVLGRQKR
Ga0311301_1173703723300032160Peatlands SoilMTAPTPKPEGPKPGENAPSRRFRLPRWAALALAACLAFAIFAVALIRVLPSPHSKADYLIVGTLATLAALITIFAGLVLGRRKR
Ga0335085_100001431553300032770SoilMTGLTPKPDVPAPPRGFHIPQPLVLALSAGLAFAIFAIALIHVLPSPHSHADYLIVGTLATLAALITIFAGLVLGRRKK
Ga0335079_1002697953300032783SoilMTAPTPKPDGSKPGESAPAHRFRIPRPAVLAVSACIAFAVFALALIRVLPAPHSRADYLIVGTLATLAALITVFAGLVLGRRKT
Ga0335079_1007247333300032783SoilMVPKPDEPRRRVPRPAVLLASACLAFAILAVALVQVLPPRHSKADYLIVGTLATLAALITIFAGLLLSRRSRH
Ga0335079_1142746123300032783SoilMTAPTPKPDADTPRRFRIPRPAALIGSACIVFAVFAVALLRVLPAPHTRPDYLIVGTLSTLAALITIFAGLVLGRVKR
Ga0335078_1001940723300032805SoilMTAPTPKPDEPDAKSPPRRFRIPRWVTLGVSACLAFAIFAVALIRVLPSPHARADYLIVGTLATLAALITIFAGLVLGRRKR
Ga0335078_1002570353300032805SoilMTEPTPKPDKKPASRRFRIPRPAALAASACLAFAIFAVALIRVLPAPHARADYLIVGTLSTLAALITIFAGLVLGRKR
Ga0335078_1012218953300032805SoilMTGPTPKPEEPKPEVKALSHGPGIVRAAVLAISACLAFAIFAFALNRVLPSPHSHADYLIIGTLATLAALITVFAGLVMGRGKR
Ga0335078_1027497623300032805SoilMAPKPDEGSTGARRGIPRPAALIASACIVFAILAVALMQALPAPRSKADYLIVGTLATLAALITIFAGLLLGRRSRR
Ga0335080_1065831823300032828SoilMTAPTPKRDEKPRSRRVIALAASACLVFATFAIALIRVLPPPHGRADYLIAGTLSTLAALITIFAGLVLSRRKR
Ga0335081_1017541033300032892SoilMTAPTPKPDEPDAKSPPRRFRIPRWVTLGVSACLAFAIFAVSLIRVLPSPHARADYLIVGTLATLAALITIFAGLVLGRRKR
Ga0335081_1113816123300032892SoilMTAPTQKPEDKPARGGFRIPRSLALGVSACITFAVVGVALNQALPKPHTRGDYLIIGTLATLAALITIFAGLVLGSGKRLRR
Ga0335081_1180806813300032892SoilHRRPMDPPPDERPARRRVPRPAALIASAGIAFALLAVVLIQVLPARHSRADYLIIGTLSTLAALITIFAGLVLGRRSRP
Ga0335069_1027323613300032893SoilMTALTPKPDEPARARGFRVPQPLVLALSACLAFAVFAIALVHVLPSPHSRADYLIVGTLATLAALITIFAGLVLGHRKK
Ga0335074_1005417863300032895SoilMTAPTPKPDGHPPTRSRIPRPAALIGSACLVFAVFAIALIRVLPSPHTKADYLIVGTLSTLAALITIFAGLVLGRRKQ
Ga0335074_1016605023300032895SoilMTAPTPKPEENPRRGPRLPRPLALGAAACLVFAAFTVALMRLMPAPHASTDYLVVGTLSTLAALITVFAGLVLSRRKR
Ga0335071_1149326813300032897SoilMTAPTPKPEETAPARHARVPRPVALIVSACLAFAVFAISLNRVLPPPHTRADYLIIGTLATLAALITLFAGVVLGRRKR
Ga0335073_1081329123300033134SoilMTAPTPKPDEQTSGGRRIPRPVALAVSAAIAFLIFAVALMRVLPKPHTRADYLIVGTLATLAALITIFAGLVMGRRKR
Ga0335073_1183667823300033134SoilMTAPTPKPDEQPSPRRSRIRRPAVLALSACFVFATFAVALIRVLPAPHARADYMIAGTLSTLAALITIFAGLVLGHRKR
Ga0334828_024739_3_1973300033822SoilMTAPTPKPDEQPPARRLRIPRPAALAASACLAFTIFAVALIRVLPAPHGRADYLIVGTLSTLAAL
Ga0334790_019410_805_10383300033887SoilMTAPTPKPDAPTRRFRIPRPAALAIGAALVFLVFAVALIRVLPAPHTRADYLIVGSLATLAALIAIFAGLVMGRRKP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.