Metagenome / Metatranscriptome Family F067313

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F067313
Family Type	Metagenome / Metatranscriptome
Number of Sequences	125
Average Sequence Length	42 residues
Representative Sequence	KITYIDNVKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRKYK
Number of Associated Samples	72
Number of Associated Scaffolds	125

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	97.60 %
% of genes from short scaffolds (< 2000 bps)	99.20 %
Associated GOLD sequencing projects	72
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.35

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (96.800 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (77.600 % of family members)
Environment Ontology (ENVO)	Unclassified (92.800 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (87.200 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 40.28% β-sheet: 0.00% Coil/Unstructured: 59.72%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.35
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.35
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 125 Family Scaffolds
PF00665	rve	1.60

COG ID	Name	Functional Category	% Frequency in 125 Family Scaffolds
COG2801	Transposase InsO and inactivated derivatives	Mobilome: prophages, transposons [X]	1.60
COG2826	Transposase and inactivated derivatives, IS30 family	Mobilome: prophages, transposons [X]	1.60
COG3316	Transposase (or an inactivated derivative), DDE domain	Mobilome: prophages, transposons [X]	1.60
COG4584	Transposase	Mobilome: prophages, transposons [X]	1.60

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
All Organisms	root	All Organisms	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
cellular organisms	root	All Organisms → cellular organisms	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	3.20 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	2.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	2.40 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Panicum sect. Panicum	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum	1.60 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.80 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Panicum hallii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	1.60 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.80 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.80 %
Panicum hallii var. hallii	varietas	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii → Panicum hallii var. hallii	0.80 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.80 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2044078004\|PVR_F5IW0KN14IRN0G	Not Available	517	Open in IMG/M
3300005544\|Ga0070686_101039626	Not Available	674	Open in IMG/M
3300005618\|Ga0068864_102048401	Not Available	579	Open in IMG/M
3300005841\|Ga0068863_102428571	Not Available	534	Open in IMG/M
3300005843\|Ga0068860_101896357	Not Available	618	Open in IMG/M
3300009972\|Ga0105137_107185	Not Available	576	Open in IMG/M
3300009976\|Ga0105128_104055	Not Available	827	Open in IMG/M
3300009976\|Ga0105128_111878	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii → Panicum hallii var. hallii	615	Open in IMG/M
3300009976\|Ga0105128_120908	Not Available	512	Open in IMG/M
3300009981\|Ga0105133_107536	Not Available	764	Open in IMG/M
3300009989\|Ga0105131_114046	Not Available	728	Open in IMG/M
3300009989\|Ga0105131_129137	Not Available	582	Open in IMG/M
3300009994\|Ga0105126_1017860	Not Available	749	Open in IMG/M
3300009994\|Ga0105126_1035256	Not Available	601	Open in IMG/M
3300009994\|Ga0105126_1044710	Not Available	552	Open in IMG/M
3300009995\|Ga0105139_1015075	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	1078	Open in IMG/M
3300010371\|Ga0134125_12473441	Not Available	564	Open in IMG/M
3300010371\|Ga0134125_12739847	Not Available	536	Open in IMG/M
3300014968\|Ga0157379_11892858	Not Available	588	Open in IMG/M
3300014968\|Ga0157379_12430814	Not Available	523	Open in IMG/M
3300015278\|Ga0182099_1031074	Not Available	642	Open in IMG/M
3300015280\|Ga0182100_1021381	Not Available	830	Open in IMG/M
3300015280\|Ga0182100_1083803	Not Available	536	Open in IMG/M
3300015284\|Ga0182101_1051766	Not Available	631	Open in IMG/M
3300015290\|Ga0182105_1039778	Not Available	709	Open in IMG/M
3300015301\|Ga0182184_1014549	Not Available	950	Open in IMG/M
3300015301\|Ga0182184_1019845	Not Available	861	Open in IMG/M
3300015301\|Ga0182184_1101712	Not Available	501	Open in IMG/M
3300015306\|Ga0182180_1037206	Not Available	703	Open in IMG/M
3300015309\|Ga0182098_1039315	Not Available	752	Open in IMG/M
3300015309\|Ga0182098_1078979	Not Available	598	Open in IMG/M
3300015310\|Ga0182162_1060321	Not Available	667	Open in IMG/M
3300015311\|Ga0182182_1039500	Not Available	745	Open in IMG/M
3300015311\|Ga0182182_1111310	Not Available	521	Open in IMG/M
3300015312\|Ga0182168_1023548	Not Available	936	Open in IMG/M
3300015312\|Ga0182168_1097768	Not Available	575	Open in IMG/M
3300015313\|Ga0182164_1128078	Not Available	517	Open in IMG/M
3300015315\|Ga0182120_1059668	Not Available	694	Open in IMG/M
3300015315\|Ga0182120_1110510	Not Available	552	Open in IMG/M
3300015315\|Ga0182120_1120240	Not Available	533	Open in IMG/M
3300015317\|Ga0182136_1048931	Not Available	745	Open in IMG/M
3300015317\|Ga0182136_1076772	Not Available	635	Open in IMG/M
3300015318\|Ga0182181_1082971	Not Available	566	Open in IMG/M
3300015324\|Ga0182134_1119223	Not Available	548	Open in IMG/M
3300015325\|Ga0182148_1065849	Not Available	678	Open in IMG/M
3300015325\|Ga0182148_1097634	Not Available	588	Open in IMG/M
3300015325\|Ga0182148_1130335	Not Available	526	Open in IMG/M
3300015325\|Ga0182148_1138731	Not Available	513	Open in IMG/M
3300015326\|Ga0182166_1076978	Not Available	640	Open in IMG/M
3300015326\|Ga0182166_1147277	Not Available	500	Open in IMG/M
3300015327\|Ga0182114_1087205	Not Available	648	Open in IMG/M
3300015328\|Ga0182153_1026593	Not Available	935	Open in IMG/M
3300015329\|Ga0182135_1073024	Not Available	674	Open in IMG/M
3300015329\|Ga0182135_1085495	Not Available	636	Open in IMG/M
3300015329\|Ga0182135_1102977	Not Available	592	Open in IMG/M
3300015329\|Ga0182135_1106805	Not Available	584	Open in IMG/M
3300015330\|Ga0182152_1092107	Not Available	619	Open in IMG/M
3300015330\|Ga0182152_1130938	Not Available	538	Open in IMG/M
3300015331\|Ga0182131_1134831	Not Available	534	Open in IMG/M
3300015332\|Ga0182117_1050528	Not Available	820	Open in IMG/M
3300015332\|Ga0182117_1101440	Not Available	627	Open in IMG/M
3300015333\|Ga0182147_1033812	Not Available	925	Open in IMG/M
3300015333\|Ga0182147_1043064	Not Available	853	Open in IMG/M
3300015335\|Ga0182116_1070594	Not Available	743	Open in IMG/M
3300015335\|Ga0182116_1167066	Not Available	519	Open in IMG/M
3300015336\|Ga0182150_1067083	Not Available	717	Open in IMG/M
3300015336\|Ga0182150_1097940	Not Available	623	Open in IMG/M
3300015337\|Ga0182151_1109690	Not Available	596	Open in IMG/M
3300015337\|Ga0182151_1122726	Not Available	570	Open in IMG/M
3300015338\|Ga0182137_1058984	Not Available	794	Open in IMG/M
3300015338\|Ga0182137_1063957	Not Available	770	Open in IMG/M
3300015338\|Ga0182137_1129036	Not Available	580	Open in IMG/M
3300015338\|Ga0182137_1170113	Not Available	514	Open in IMG/M
3300015348\|Ga0182115_1067692	Not Available	1079	Open in IMG/M
3300015348\|Ga0182115_1123740	Not Available	821	Open in IMG/M
3300015348\|Ga0182115_1172972	Not Available	692	Open in IMG/M
3300015348\|Ga0182115_1216341	Not Available	613	Open in IMG/M
3300015348\|Ga0182115_1264237	Not Available	546	Open in IMG/M
3300015348\|Ga0182115_1265034	Not Available	545	Open in IMG/M
3300015348\|Ga0182115_1269018	Not Available	540	Open in IMG/M
3300015348\|Ga0182115_1270302	Not Available	539	Open in IMG/M
3300015348\|Ga0182115_1291812	Not Available	515	Open in IMG/M
3300015349\|Ga0182185_1150316	Not Available	693	Open in IMG/M
3300015349\|Ga0182185_1256390	Not Available	533	Open in IMG/M
3300015350\|Ga0182163_1153036	Not Available	717	Open in IMG/M
3300015350\|Ga0182163_1192850	Not Available	638	Open in IMG/M
3300015350\|Ga0182163_1226281	Not Available	586	Open in IMG/M
3300015350\|Ga0182163_1296244	Not Available	506	Open in IMG/M
3300015352\|Ga0182169_1143095	Not Available	778	Open in IMG/M
3300015352\|Ga0182169_1196609	Not Available	659	Open in IMG/M
3300015353\|Ga0182179_1227768	Not Available	598	Open in IMG/M
3300015353\|Ga0182179_1313943	Not Available	511	Open in IMG/M
3300015354\|Ga0182167_1218542	Not Available	694	Open in IMG/M
3300015354\|Ga0182167_1244039	Not Available	649	Open in IMG/M
3300017408\|Ga0182197_1116348	Not Available	557	Open in IMG/M
3300017412\|Ga0182199_1145974	Not Available	576	Open in IMG/M
3300017414\|Ga0182195_1037063	Not Available	980	Open in IMG/M
3300017414\|Ga0182195_1083959	Not Available	738	Open in IMG/M
3300017414\|Ga0182195_1144786	Not Available	599	Open in IMG/M
3300017414\|Ga0182195_1187604	Not Available	539	Open in IMG/M
3300017421\|Ga0182213_1251949	Not Available	506	Open in IMG/M
3300017432\|Ga0182196_1157921	Not Available	500	Open in IMG/M
3300017439\|Ga0182200_1111508	Not Available	577	Open in IMG/M
3300017440\|Ga0182214_1159115	Not Available	504	Open in IMG/M
3300017445\|Ga0182198_1024771	Not Available	1069	Open in IMG/M
3300017445\|Ga0182198_1053655	Not Available	826	Open in IMG/M
3300017445\|Ga0182198_1190188	Not Available	516	Open in IMG/M
3300017691\|Ga0182212_1103301	Not Available	640	Open in IMG/M
3300017693\|Ga0182216_1161232	Not Available	575	Open in IMG/M
3300020023\|Ga0182178_1003484	Not Available	943	Open in IMG/M
3300028053\|Ga0268346_1014495	Not Available	714	Open in IMG/M
3300028053\|Ga0268346_1027766	Not Available	586	Open in IMG/M
3300028058\|Ga0268332_1045105	Not Available	621	Open in IMG/M
3300028151\|Ga0268308_1029344	Not Available	527	Open in IMG/M
3300028246\|Ga0268351_1037053	Not Available	501	Open in IMG/M
3300028253\|Ga0268316_1021077	Not Available	530	Open in IMG/M
3300028469\|Ga0268337_1002565	Not Available	908	Open in IMG/M
3300028476\|Ga0268329_1027345	Not Available	516	Open in IMG/M
3300032625\|Ga0214501_1019199	Not Available	1949	Open in IMG/M
3300032758\|Ga0314746_1112528	Not Available	621	Open in IMG/M
3300032791\|Ga0314748_1064764	Not Available	778	Open in IMG/M
3300032824\|Ga0314735_1007768	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	1689	Open in IMG/M
3300032915\|Ga0314749_1033898	Not Available	1080	Open in IMG/M
3300033534\|Ga0314757_1126075	Not Available	617	Open in IMG/M
3300033537\|Ga0314766_1004532	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	3157	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	97.60%
Environmental	Environmental	2.40%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	97.60%
Terrestrial	Environmental → Terrestrial	2.40%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	84.00%
Unclassified	Host-Associated → Plants → Unclassified	8.80%
Soil	Environmental → Terrestrial → Soil	2.40%
Rhizoplane	Host-Associated → Plants → Rhizoplane	2.40%
Rhizosphere	Host-Associated → Plants → Rhizosphere	1.60%
Roots	Host-Associated → Plants → Roots	0.80%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	84.00%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	8.80%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.40%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	1.60%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	1.60%
Loam	Environmental → Terrestrial → Soil → Loam	0.80%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	0.80%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	84.00%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	8.80%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.40%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	1.60%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	1.60%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.80%
Unclassified	Host-Associated → Plants → Roots → Rhizosphere → Unclassified	0.80%

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	77.60%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	8.80%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	6.40%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.40%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.60%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.60%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.80%
Switchgrass, Maize And Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Switchgrass, Maize And Miscanthus Rhizosphere	0.80%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2044078004	Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL	Host-Associated	Open in IMG/M
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300009972	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_224 metaG	Host-Associated	Open in IMG/M
3300009976	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_186 metaG	Host-Associated	Open in IMG/M
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300009989	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaG	Host-Associated	Open in IMG/M
3300009994	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaG	Host-Associated	Open in IMG/M
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated	Open in IMG/M
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015278	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015284	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015309	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015310	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015315	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015318	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015332	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015338	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017408	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017421	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017439	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017691	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300020023	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG	Host-Associated	Open in IMG/M
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated	Open in IMG/M
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated	Open in IMG/M
3300028246	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_18SEP2017_LD1	Host-Associated	Open in IMG/M
3300028253	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028469	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1	Host-Associated	Open in IMG/M
3300028476	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300032625	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032758	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032791	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032824	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032915	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033534	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033537	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
PVR_1407400	2044078004	Switchgrass, Maize And Miscanthus Rhizosphere	KVKKITYIYNVKRRIQELYQTSDDYGIPSMLDLTLTPKQLTYSRK
Ga0070686_1010396261	3300005544	Switchgrass Rhizosphere	KVKKITYIDKVKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRKYK*
Ga0068864_1020484011	3300005618	Switchgrass Rhizosphere	LRKVEKITYIDNFERKIQELYQTSEDSGIPSKLDSTLTPKLLILL*
Ga0068863_1024285712	3300005841	Switchgrass Rhizosphere	KVKRKIRELYQTSDDSGILSKLDSTLTPKLLTYSRK*
Ga0068860_1018963571	3300005843	Switchgrass Rhizosphere	LRKVENITYIDKVKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRK*
Ga0105137_1071851	3300009972	Switchgrass Associated	KITYINKVKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRKYK*
Ga0105128_1040551	3300009976	Switchgrass Associated	DKFERRIQELDQTPEGSGIPSKRDSTLTPKRLIRL*
Ga0105128_1118781	3300009976	Switchgrass Associated	KITYINKVKRKIQELYQTSDDSEIPSKLDSTLTPKLLTYSRKYK*
Ga0105128_1209081	3300009976	Switchgrass Associated	KRKIQELYQTFDHSGVPSKLDSTLTPKLLTYSRKYK*
Ga0105133_1075361	3300009981	Switchgrass Associated	VKKITYINNVKRKIQELYQTFDDSGILSKLDSTLAPKLLTYSRKYK*
Ga0105131_1140461	3300009989	Switchgrass Associated	VKKIAYINNVKRKIQELYQTSDDSGIPSKLNSTLTPKLLTYSRKYK*
Ga0105131_1291371	3300009989	Switchgrass Associated	VEKITYIDNFERKIQELYQTSEDSGIPSKLDSTLTPKLLILL*
Ga0105126_10178601	3300009994	Switchgrass Associated	KITYIYKVKRRIQELYQTSDDSGIPSKLDSTLTPKLLTYSRKYK*
Ga0105126_10352561	3300009994	Switchgrass Associated	YINKVERRIPELYQTSDDSEIPSKLDSTLTPKLLTYSRK*
Ga0105126_10447101	3300009994	Switchgrass Associated	ITYIDNFERKIQELYQTSEDSGIPSKLDSTLTPKLLILL*
Ga0105139_10150751	3300009995	Switchgrass Associated	VKKITYINNFERRIQELYQTFEDSGIPSKLNSTLTPKLVILL*
Ga0134125_124734411	3300010371	Terrestrial Soil	KIQKLYQTSDDSGVPSKLDSTLTPKLLTYSRKYKWKR*
Ga0134125_127398472	3300010371	Terrestrial Soil	KKITYINKVERKIQELYQTSDDSGVPSKLYSTLTPKLLTYSRKYK*
Ga0157379_118928581	3300014968	Switchgrass Rhizosphere	KIEKITYIYKVKRRIQELYQTSDDSGIPSKLDSTLTSKLLTYSRK*
Ga0157379_124308141	3300014968	Switchgrass Rhizosphere	KKITYIDKVKRKIQELYQTSDDSGISSKLDSTLAPKLLTYSRK*
Ga0182099_10310741	3300015278	Switchgrass Phyllosphere	SEKVKKITYINKVKIKIQELYQTFDDSRIPRQARLDSTLTPKLLTYSGK*
Ga0182100_10213811	3300015280	Switchgrass Phyllosphere	KRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRKYK*
Ga0182100_10838031	3300015280	Switchgrass Phyllosphere	VKRKIQELYQTSDDSRILSKLHSTLTPKLLTYSRKYK*
Ga0182101_10517661	3300015284	Switchgrass Phyllosphere	TDNVKRRIQELYQTYDDSGVPSKLDSTLTYKLLTYSRKYK*
Ga0182105_10397781	3300015290	Switchgrass Phyllosphere	IDNFERKIQELYQTSEDSGIPSKLYSTLIHKLLILL*
Ga0182184_10145491	3300015301	Switchgrass Phyllosphere	YINNFERRIQELYQTSEDPGISSKLDSTLTPKLLILL*
Ga0182184_10198451	3300015301	Switchgrass Phyllosphere	RKVEKIAYIDNVKRKIQELYQTPDDSRIPSKLYSNLTPKLLTYSRKYK*
Ga0182184_11017121	3300015301	Switchgrass Phyllosphere	NNIKRKIQELYQTSNDSGIPSKLDLILTPKLLTYSRKYK*
Ga0182180_10372061	3300015306	Switchgrass Phyllosphere	KLTQKVEKITYIDKFERRIQELYQTSEDSGIPSKLNSTLTPKLLILL*
Ga0182098_10393151	3300015309	Switchgrass Phyllosphere	VEKITYIDNFEKKIQELYQTSEDSGIQSKLDSTLTPKLLILL*
Ga0182098_10789791	3300015309	Switchgrass Phyllosphere	DNVKRKIQELYQTSDDSGIPSKIDSTLTPKLLTYFRKYK*
Ga0182162_10603211	3300015310	Switchgrass Phyllosphere	VEKITYIDNFERKIQELYQTSEDSGIPSKLDLTLTPKLLILL*
Ga0182182_10395001	3300015311	Switchgrass Phyllosphere	YIDKFERRIQELYQTSEDSGIPSKLDSTLTPKLLILL*
Ga0182182_11113101	3300015311	Switchgrass Phyllosphere	VEKITNINKVERKIQELYQTSDDFRIPSKLDSTLTPKLLILL*
Ga0182168_10235481	3300015312	Switchgrass Phyllosphere	EKITYIDNFERKIQELYQTSEDSGIPSKLDSTLTPKLLVLL*
Ga0182168_10977681	3300015312	Switchgrass Phyllosphere	NKVERKIQELYQTFDDSGIPSKLDSTLTPRLLAYSRK*
Ga0182164_11280781	3300015313	Switchgrass Phyllosphere	KKITYINKVKRKIQELYQTSNDSGIPSKLDLTPTPKLLTYSRKYK*
Ga0182120_10596681	3300015315	Switchgrass Phyllosphere	KITYMDNFKRKIQELYQTSKDSGIPSKLDSTLTPKLLILL*
Ga0182120_11105101	3300015315	Switchgrass Phyllosphere	LRKVKKITYINKVKRMIQELHQTSDDSGIPSKLDSTLTPKILTYSRKYK*
Ga0182120_11202401	3300015315	Switchgrass Phyllosphere	KVKKITYTNNVKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRKYK*
Ga0182136_10489311	3300015317	Switchgrass Phyllosphere	DNFERKIQELYQTSEDSGIPSKLDSTLTPKLLILL*
Ga0182136_10767721	3300015317	Switchgrass Phyllosphere	LTQKVKKITYINNFERRIQDLYQTSEDSGISSKLDSTLTPKLLILL*
Ga0182181_10829711	3300015318	Switchgrass Phyllosphere	KITYIDNVKRKIQELYQTFDDSGVSSKLDSTLTPKLLTYSKKYK*
Ga0182134_11192231	3300015324	Switchgrass Phyllosphere	KKITYLNKVKRKIHELYQTSDDSGIPSKLDSTLTPKLLTYSGK*
Ga0182148_10658491	3300015325	Switchgrass Phyllosphere	INNAKRKIQELYQTSNDSRIPSKLDSTLTPKLLTYSRKYK*
Ga0182148_10976341	3300015325	Switchgrass Phyllosphere	NKVKRKIQELYQTSADSGIPSKLDSTLTPKLLNYSR*
Ga0182148_11303351	3300015325	Switchgrass Phyllosphere	VKKIIYINNVKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRKYK*
Ga0182148_11387311	3300015325	Switchgrass Phyllosphere	VKLTPKVEKITYINNFERRIQEPYQTSEDSGILSKLDLTLTPKLLTYSRK*
Ga0182166_10769781	3300015326	Switchgrass Phyllosphere	INKVKRKIRELYQTSDDSGIPCKLDSTLTPKLLTYSRK*
Ga0182166_11472771	3300015326	Switchgrass Phyllosphere	TYIDNVKRKIQELYQTSDDSGIPSKPDSTLTPKLLTYYRKYK*
Ga0182114_10872051	3300015327	Switchgrass Phyllosphere	KVEKITYINNFERRIQELYQTSEDSGIPSKLDLTLTPKLLILLLKVKRE*
Ga0182153_10265931	3300015328	Switchgrass Phyllosphere	ITYIDNFERKIQELYQTFEDSGIPSKLDSTLTPKLLTYSRKYK*
Ga0182135_10730241	3300015329	Switchgrass Phyllosphere	NVKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRKYK*
Ga0182135_10854951	3300015329	Switchgrass Phyllosphere	RKVKKITYINKVKRKIQELYQTFDDSGIPSKLDSTLTPKLLTYSRKYN*
Ga0182135_11029771	3300015329	Switchgrass Phyllosphere	KVKKITYIDKVKRKIQELYQTSDDSGIPSKFDSTLTPKLLTYSRK*
Ga0182135_11068051	3300015329	Switchgrass Phyllosphere	NVKRKIQELYQTSDDSRIPSKIDSTLTPKLLTYSRKYK*
Ga0182152_10921071	3300015330	Switchgrass Phyllosphere	MKKINYIDKVKRRIQELYQTSDDSGIPSKLDSTLTPKLLTYSRK*
Ga0182152_11309381	3300015330	Switchgrass Phyllosphere	KITYIDKFERRIQELYQTSEDSGIPSNLNSTLTPKLLILL*
Ga0182131_11348311	3300015331	Switchgrass Phyllosphere	NKVKINIQELYQTSNNSEIPSKLDSTLTPKLLTYSRK*
Ga0182117_10505281	3300015332	Switchgrass Phyllosphere	VKRKIQELYQTPDDSRIPSKLDSNLTPKLLTYSRKYK*
Ga0182117_11014401	3300015332	Switchgrass Phyllosphere	IYKVKRRIQELYQTSDDSGIPSKLDSTLTPKLLIYSRK*
Ga0182147_10338121	3300015333	Switchgrass Phyllosphere	TFINKVKRKIQELYQTSDDSGVPSKLDSTLTPKLLTYSRKYK*
Ga0182147_10430641	3300015333	Switchgrass Phyllosphere	IDNVKIQIQELYQTSDDSRIPSKLDSTLTSKLQTYSRKYK*
Ga0182116_10705941	3300015335	Switchgrass Phyllosphere	IKRKIQELYQTSNDSGIPSKLDLTPTPKLLTYSRKYK*
Ga0182116_11670661	3300015335	Switchgrass Phyllosphere	VKKITYINNVKRKIQDLYQTSDDSGIPSKLDSTLTSKLLTYSRKYM*
Ga0182150_10670831	3300015336	Switchgrass Phyllosphere	VEKITYIDKFERMIQELYQTSEDSGIPSKLDSTLTPKLLILL*
Ga0182150_10979401	3300015336	Switchgrass Phyllosphere	NNFERRIQELYQTFEDSRIPSKIDSTLTPKLLILL*
Ga0182151_11096901	3300015337	Switchgrass Phyllosphere	EKITYINKVERKIQELYQTSDDSEIPSKLNSTLTPKLLNYSRK*
Ga0182151_11227261	3300015337	Switchgrass Phyllosphere	KITYIDNVKRRIQELYQTSDDSGVPSKLDSTLTPKLLTYSRKYK*
Ga0182137_10589841	3300015338	Switchgrass Phyllosphere	KITYIYKVKRRIQELYQTSDDSGIPSKLDSTLTPKLLIYSRK*
Ga0182137_10639571	3300015338	Switchgrass Phyllosphere	YIDNVKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRKYK*
Ga0182137_11290361	3300015338	Switchgrass Phyllosphere	KITYIDNVKRKIQELYHTFDDSRIPSKLDSTQTPKLPTYSRK*
Ga0182137_11701131	3300015338	Switchgrass Phyllosphere	RKVKKITYIDNVKRKIQELYQTSDDSGISSKLDSTLTPKLLTYSRK*
Ga0182115_10676921	3300015348	Switchgrass Phyllosphere	IDNVKRKIQELYQTSDDYGIPSKLDLTLTPKLLTYSRKYK*
Ga0182115_11237401	3300015348	Switchgrass Phyllosphere	INKVKRKIQELYQTSDDSGVSSKLDSTLTPKLLTYSRKYK*
Ga0182115_11729721	3300015348	Switchgrass Phyllosphere	KVEKITYIDNFERKIQELYQTSEDSGIQSKLDSTLTPKLLILL*
Ga0182115_12163411	3300015348	Switchgrass Phyllosphere	KIQELYQTSDNSGIPSKLDSTLTPKLLTYSRKYK*
Ga0182115_12642371	3300015348	Switchgrass Phyllosphere	VEKITYINKVKRRIQELYHTSDDSGIPSKLDSTLTPKVLTYSRK*
Ga0182115_12650341	3300015348	Switchgrass Phyllosphere	TYINNFERRIQKLYQTSEDSGIPSKLDSTLTPILLILL*
Ga0182115_12690181	3300015348	Switchgrass Phyllosphere	VKKITYIDKVKRKIQELYQTSDDSGIPSKLDSTLT
Ga0182115_12703021	3300015348	Switchgrass Phyllosphere	KVKKITYINKVKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRKYN*
Ga0182115_12918121	3300015348	Switchgrass Phyllosphere	TYINKVERKIQELYQTSEDSGIPSKLDSTLTPKLLTNSRK*
Ga0182185_11503161	3300015349	Switchgrass Phyllosphere	IKKITYTNKVKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRK*
Ga0182185_12563901	3300015349	Switchgrass Phyllosphere	VKKITYIYKVKRKIQELYQTSDDSGIPSKLDSTLIPKLLTYSRK*
Ga0182163_11530361	3300015350	Switchgrass Phyllosphere	KKITYIDNVKRKIQELYQTSDDSGIPSKLDSTLTSKLLTYSRKYK*
Ga0182163_11928502	3300015350	Switchgrass Phyllosphere	ITYINNFERRIQELYQTSEDSGIPSKLDSTLTPKLLILL*
Ga0182163_12262811	3300015350	Switchgrass Phyllosphere	LKKVKKITYIDNVKIKIQELYQTFDDSGIPSKLDSTQTPKLLTYSRK*
Ga0182163_12962441	3300015350	Switchgrass Phyllosphere	DNVKRKIQELYQTSDDSGIPSKPDSTLTPKLLTYYRKYK*
Ga0182169_11430951	3300015352	Switchgrass Phyllosphere	VEKITYIDKVKRNIQELYQTSDNSRIPSKLDSTLTLKLLTYSRK*
Ga0182169_11966091	3300015352	Switchgrass Phyllosphere	ITYINKVKRKIQELYQTSDDSEIPSKLDSTLTPKLLTYSRK*
Ga0182179_12277681	3300015353	Switchgrass Phyllosphere	RKVKKITYINNVKRKIQELYQTSDDFGIPSKLNSTLTPKLLTYSRKYN*
Ga0182179_13139431	3300015353	Switchgrass Phyllosphere	KRRIQELYQTSDDSGIPSKLDSTLTPKLLTYSRK*
Ga0182167_12185421	3300015354	Switchgrass Phyllosphere	KIQELYQTSDDSEIPSKLDSTLTPTLLTYSRKQERF*
Ga0182167_12440391	3300015354	Switchgrass Phyllosphere	LRKVKLTQKIKKITYINKVKRKIQELYQTSDDSRISSKLDSTLTPKLLTYSRKYK*
Ga0182197_11163481	3300017408	Switchgrass Phyllosphere	VKNITYINNVKRKIQGLYQTSDDSGIPSKLDSALTPKLLTYSRKYK
Ga0182199_11459741	3300017412	Switchgrass Phyllosphere	IYKVKRKIQELYQTSDNSGIPSKLDSTLTPKLLTYYRK
Ga0182195_10370631	3300017414	Switchgrass Phyllosphere	IEKITYIYKVKRRIQELYQTSVDSGISSKLDSTLTTNLL
Ga0182195_10839591	3300017414	Switchgrass Phyllosphere	RKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRKYK
Ga0182195_11447861	3300017414	Switchgrass Phyllosphere	KVEKITYIDNFERKIQELYQTSEDSGIPSKLNSTLTPKLLFLL
Ga0182195_11876041	3300017414	Switchgrass Phyllosphere	TYIDNFERKIQELYQTSEDSRIPSKLDSTLTPKLLILL
Ga0182213_12519491	3300017421	Switchgrass Phyllosphere	KVEKISYINKFERRIQELYQTSEDSGILSKLDSTLTPKLLILL
Ga0182196_11579211	3300017432	Switchgrass Phyllosphere	VKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRKYK
Ga0182200_11115081	3300017439	Switchgrass Phyllosphere	TYINKVKRKIQELYQTFDDSGVPSKLDSTLTPKLLTYSRKYKWKR
Ga0182214_11591151	3300017440	Switchgrass Phyllosphere	ITYINKVKRKIQELYQTFDDSGVPSKLDSTLTPKLLTYSKKYK
Ga0182198_10247711	3300017445	Switchgrass Phyllosphere	IYIGNVKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYFRKYK
Ga0182198_10536551	3300017445	Switchgrass Phyllosphere	LIMSKEKIQELYQTSDDSGVPSKLDLTLTPKLLTYSRKYK
Ga0182198_11901881	3300017445	Switchgrass Phyllosphere	LRKIEKITYIYKVKRRIQELYQTSDDSGIPSKLDSTLTPKLLIYSRK
Ga0182212_11033011	3300017691	Switchgrass Phyllosphere	IDNVKRKIQKLYQTSDDSGILSKLDSTLTPKLLTYSRKYE
Ga0182216_11612321	3300017693	Switchgrass Phyllosphere	ITYIDNAKRKIQELYQTSNDSRIPSKLDSTLTPKLLTYSRKYK
Ga0182178_10034841	3300020023	Switchgrass Phyllosphere	RKIQQLYQTSDDSGISSKLDSTLTPKLLTYSRKYK
Ga0268346_10144951	3300028053	Phyllosphere	KKIQELYQTSDDSGVPSKLDSTLTPKLLTYSRKYK
Ga0268346_10277661	3300028053	Phyllosphere	KITYIDNVKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRKYK
Ga0268332_10451051	3300028058	Phyllosphere	TNKVKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRK
Ga0268308_10293441	3300028151	Phyllosphere	VKRRIQELYQTSDDSGVPSKLDSTLTPKLLTYSRKYK
Ga0268351_10370531	3300028246	Phyllosphere	IKSKKRIQELYQTLDDSEIPNKLDSTLTPKLLTYSRK
Ga0268316_10210771	3300028253	Phyllosphere	LRKVEKIAYIDNVKRKIQELYQTPDDSRIPSKLDSNLTPKLLTYSRKYK
Ga0268337_10025652	3300028469	Phyllosphere	KITYIYKVKRMIQELYQTSVDSGISSKLDSTLTTNLL
Ga0268329_10273451	3300028476	Phyllosphere	KVEKITYINNFERRIQELYQTSKDSRIPSKLDSTLTPKLLILSRK
Ga0214501_10191991	3300032625	Switchgrass Phyllosphere	MTYIYKVNRKIQEVYQTSDDFGIPSKLDSTLTLKLLTYSGK
Ga0314746_11125281	3300032758	Switchgrass Phyllosphere	RKVKKITYIDNIKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRKYK
Ga0314748_10647641	3300032791	Switchgrass Phyllosphere	LQKVKLTQKVKKITYINKVKRKIKGLCQTSDDSGIPSKLDSTLTPKLLTYSRK
Ga0314735_10077683	3300032824	Switchgrass Phyllosphere	EKITYTDNVKRMIQELYQTSDNSGIPSKLDSTLTPKLITCSRKYK
Ga0314749_10338981	3300032915	Switchgrass Phyllosphere	NVKRMIQELYQTSDNSGIPSKLDSTLTPKLITCSRKYK
Ga0314757_11260751	3300033534	Switchgrass Phyllosphere	VKRKIQELYQTSDDSGIPSKLDSTLTPKLLTYSRK
Ga0314766_10045321	3300033537	Switchgrass Phyllosphere	LKKVEKITYTDNVKRMIQELYQTSDNSGIPSKLDSTLTPKLITCSRKYK

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F067313

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences