| Basic Information | |
|---|---|
| Family ID | F067304 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 125 |
| Average Sequence Length | 55 residues |
| Representative Sequence | MRCDQRLVPPLCAQRREVLRDAPERLTVKRVGRAVVDVSAQHQFGVRGGQRREVEQT |
| Number of Associated Samples | 44 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 13.60 % |
| % of genes from short scaffolds (< 2000 bps) | 72.80 % |
| Associated GOLD sequencing projects | 40 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (70.400 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat (84.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (84.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.06% β-sheet: 9.41% Coil/Unstructured: 63.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF10145 | PhageMin_Tail | 31.20 |
| PF05135 | Phage_connect_1 | 4.80 |
| PF05065 | Phage_capsid | 4.00 |
| PF01612 | DNA_pol_A_exo1 | 1.60 |
| PF02086 | MethyltransfD12 | 0.80 |
| PF02399 | Herpes_ori_bp | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 4.00 |
| COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 0.80 |
| COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 70.40 % |
| All Organisms | root | All Organisms | 29.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002493|JGI24185J35167_1050677 | Not Available | 845 | Open in IMG/M |
| 3300002510|JGI24186J35511_1043071 | Not Available | 639 | Open in IMG/M |
| 3300005246|Ga0068638_101604 | Not Available | 1095 | Open in IMG/M |
| 3300005452|Ga0068706_1054065 | Not Available | 731 | Open in IMG/M |
| 3300005452|Ga0068706_1091090 | Not Available | 532 | Open in IMG/M |
| 3300005453|Ga0068705_10119939 | Not Available | 679 | Open in IMG/M |
| 3300005490|Ga0068662_175455 | Not Available | 507 | Open in IMG/M |
| 3300010182|Ga0124917_1078708 | Not Available | 577 | Open in IMG/M |
| 3300010186|Ga0124916_1003985 | Not Available | 1213 | Open in IMG/M |
| 3300010257|Ga0124913_1052640 | All Organisms → Viruses → Predicted Viral | 3529 | Open in IMG/M |
| 3300010257|Ga0124913_1075870 | Not Available | 604 | Open in IMG/M |
| 3300026237|Ga0209750_1021177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1387 | Open in IMG/M |
| 3300026237|Ga0209750_1024618 | Not Available | 1245 | Open in IMG/M |
| 3300026509|Ga0209809_1050195 | Not Available | 1285 | Open in IMG/M |
| 3300026509|Ga0209809_1061579 | Not Available | 1090 | Open in IMG/M |
| 3300026509|Ga0209809_1067104 | Not Available | 1018 | Open in IMG/M |
| 3300026509|Ga0209809_1129700 | Not Available | 594 | Open in IMG/M |
| 3300026509|Ga0209809_1143040 | Not Available | 545 | Open in IMG/M |
| 3300027279|Ga0209691_1007995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 3722 | Open in IMG/M |
| 3300027279|Ga0209691_1064696 | Not Available | 662 | Open in IMG/M |
| 3300031245|Ga0308395_1022575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 2035 | Open in IMG/M |
| 3300031245|Ga0308395_1042490 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1243 | Open in IMG/M |
| 3300031508|Ga0308394_1033038 | Not Available | 1344 | Open in IMG/M |
| 3300031508|Ga0308394_1058200 | Not Available | 877 | Open in IMG/M |
| 3300031508|Ga0308394_1112132 | Not Available | 545 | Open in IMG/M |
| 3300031509|Ga0308399_1000219 | All Organisms → cellular organisms → Bacteria | 20258 | Open in IMG/M |
| 3300031509|Ga0308399_1003380 | Not Available | 4980 | Open in IMG/M |
| 3300031509|Ga0308399_1072371 | Not Available | 717 | Open in IMG/M |
| 3300031509|Ga0308399_1092415 | Not Available | 608 | Open in IMG/M |
| 3300031509|Ga0308399_1094721 | Not Available | 598 | Open in IMG/M |
| 3300031509|Ga0308399_1111737 | Not Available | 536 | Open in IMG/M |
| 3300031512|Ga0308397_1021387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1890 | Open in IMG/M |
| 3300031512|Ga0308397_1081178 | Not Available | 722 | Open in IMG/M |
| 3300031513|Ga0308412_1000143 | Not Available | 32389 | Open in IMG/M |
| 3300031513|Ga0308412_1003194 | All Organisms → cellular organisms → Bacteria | 8768 | Open in IMG/M |
| 3300031513|Ga0308412_1003775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 7991 | Open in IMG/M |
| 3300031513|Ga0308412_1008859 | All Organisms → Viruses → Predicted Viral | 4878 | Open in IMG/M |
| 3300031513|Ga0308412_1045500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1554 | Open in IMG/M |
| 3300031513|Ga0308412_1056490 | Not Available | 1326 | Open in IMG/M |
| 3300031513|Ga0308412_1059295 | Not Available | 1279 | Open in IMG/M |
| 3300031513|Ga0308412_1061763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1240 | Open in IMG/M |
| 3300031513|Ga0308412_1166611 | Not Available | 611 | Open in IMG/M |
| 3300031514|Ga0308390_1050534 | Not Available | 1067 | Open in IMG/M |
| 3300031514|Ga0308390_1059025 | Not Available | 941 | Open in IMG/M |
| 3300031514|Ga0308390_1083394 | Not Available | 716 | Open in IMG/M |
| 3300031516|Ga0308398_1096979 | Not Available | 647 | Open in IMG/M |
| 3300031517|Ga0308392_1000117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 30508 | Open in IMG/M |
| 3300031517|Ga0308392_1005365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 4334 | Open in IMG/M |
| 3300031517|Ga0308392_1007248 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 3592 | Open in IMG/M |
| 3300031517|Ga0308392_1022804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1675 | Open in IMG/M |
| 3300031517|Ga0308392_1050592 | Not Available | 957 | Open in IMG/M |
| 3300031518|Ga0308389_1093768 | Not Available | 688 | Open in IMG/M |
| 3300031518|Ga0308389_1099738 | Not Available | 656 | Open in IMG/M |
| 3300031567|Ga0308391_1006890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 3322 | Open in IMG/M |
| 3300031568|Ga0308393_1075770 | Not Available | 741 | Open in IMG/M |
| 3300031767|Ga0308401_1000117 | All Organisms → cellular organisms → Bacteria | 23704 | Open in IMG/M |
| 3300031767|Ga0308401_1001270 | All Organisms → cellular organisms → Bacteria | 7024 | Open in IMG/M |
| 3300031767|Ga0308401_1002272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 5189 | Open in IMG/M |
| 3300031767|Ga0308401_1005191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 3366 | Open in IMG/M |
| 3300031767|Ga0308401_1007319 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 2763 | Open in IMG/M |
| 3300031767|Ga0308401_1009466 | Not Available | 2373 | Open in IMG/M |
| 3300031767|Ga0308401_1010829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 2198 | Open in IMG/M |
| 3300031767|Ga0308401_1102677 | Not Available | 546 | Open in IMG/M |
| 3300031783|Ga0308418_1053369 | Not Available | 980 | Open in IMG/M |
| 3300031783|Ga0308418_1066748 | Not Available | 837 | Open in IMG/M |
| 3300031783|Ga0308418_1118115 | Not Available | 568 | Open in IMG/M |
| 3300031812|Ga0308411_10002156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 13391 | Open in IMG/M |
| 3300031812|Ga0308411_10048397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1956 | Open in IMG/M |
| 3300031812|Ga0308411_10052374 | Not Available | 1839 | Open in IMG/M |
| 3300031812|Ga0308411_10115576 | Not Available | 1001 | Open in IMG/M |
| 3300031812|Ga0308411_10144224 | Not Available | 851 | Open in IMG/M |
| 3300031830|Ga0308409_1005707 | Not Available | 4419 | Open in IMG/M |
| 3300031830|Ga0308409_1021744 | Not Available | 1831 | Open in IMG/M |
| 3300031865|Ga0308408_1009849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 3021 | Open in IMG/M |
| 3300031865|Ga0308408_1111968 | Not Available | 598 | Open in IMG/M |
| 3300031875|Ga0308405_1126841 | Not Available | 599 | Open in IMG/M |
| 3300031875|Ga0308405_1135332 | Not Available | 573 | Open in IMG/M |
| 3300031878|Ga0308404_1007475 | Not Available | 2721 | Open in IMG/M |
| 3300031878|Ga0308404_1012698 | Not Available | 1973 | Open in IMG/M |
| 3300031878|Ga0308404_1030429 | Not Available | 1152 | Open in IMG/M |
| 3300031878|Ga0308404_1033131 | Not Available | 1092 | Open in IMG/M |
| 3300031948|Ga0308406_1059533 | Not Available | 839 | Open in IMG/M |
| 3300031950|Ga0308417_1001462 | All Organisms → cellular organisms → Bacteria | 16168 | Open in IMG/M |
| 3300031950|Ga0308417_1022913 | Not Available | 3057 | Open in IMG/M |
| 3300031950|Ga0308417_1030257 | Not Available | 2508 | Open in IMG/M |
| 3300031950|Ga0308417_1039462 | Not Available | 2069 | Open in IMG/M |
| 3300031950|Ga0308417_1052429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1676 | Open in IMG/M |
| 3300031950|Ga0308417_1056849 | Not Available | 1576 | Open in IMG/M |
| 3300031950|Ga0308417_1057077 | Not Available | 1571 | Open in IMG/M |
| 3300031950|Ga0308417_1057408 | Not Available | 1564 | Open in IMG/M |
| 3300031950|Ga0308417_1096652 | Not Available | 1060 | Open in IMG/M |
| 3300031950|Ga0308417_1150497 | Not Available | 766 | Open in IMG/M |
| 3300031950|Ga0308417_1171517 | Not Available | 696 | Open in IMG/M |
| 3300031950|Ga0308417_1223500 | Not Available | 578 | Open in IMG/M |
| 3300031950|Ga0308417_1226774 | Not Available | 572 | Open in IMG/M |
| 3300031950|Ga0308417_1261426 | Not Available | 518 | Open in IMG/M |
| 3300031958|Ga0308410_1022362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 2531 | Open in IMG/M |
| 3300031958|Ga0308410_1069947 | Not Available | 1057 | Open in IMG/M |
| 3300031958|Ga0308410_1081904 | Not Available | 941 | Open in IMG/M |
| 3300031958|Ga0308410_1123838 | Not Available | 698 | Open in IMG/M |
| 3300031966|Ga0308420_1011142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 4136 | Open in IMG/M |
| 3300031966|Ga0308420_1019484 | Not Available | 2898 | Open in IMG/M |
| 3300031966|Ga0308420_1036086 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1914 | Open in IMG/M |
| 3300031966|Ga0308420_1067351 | Not Available | 1238 | Open in IMG/M |
| 3300031980|Ga0308403_1000186 | All Organisms → cellular organisms → Bacteria | 26211 | Open in IMG/M |
| 3300031980|Ga0308403_1020772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1523 | Open in IMG/M |
| 3300031980|Ga0308403_1062534 | Not Available | 753 | Open in IMG/M |
| 3300032033|Ga0308402_1030755 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1127 | Open in IMG/M |
| 3300032033|Ga0308402_1076413 | Not Available | 643 | Open in IMG/M |
| 3300032033|Ga0308402_1077015 | Not Available | 640 | Open in IMG/M |
| 3300032033|Ga0308402_1084242 | Not Available | 607 | Open in IMG/M |
| 3300032034|Ga0308407_1018828 | Not Available | 1846 | Open in IMG/M |
| 3300032034|Ga0308407_1023915 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1573 | Open in IMG/M |
| 3300032034|Ga0308407_1030144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 1346 | Open in IMG/M |
| 3300032049|Ga0308416_1010999 | Not Available | 2415 | Open in IMG/M |
| 3300032049|Ga0308416_1039335 | Not Available | 1017 | Open in IMG/M |
| 3300032057|Ga0308421_1061691 | Not Available | 1005 | Open in IMG/M |
| 3300032058|Ga0308419_1080989 | Not Available | 988 | Open in IMG/M |
| 3300032058|Ga0308419_1093769 | Not Available | 878 | Open in IMG/M |
| 3300032356|Ga0308414_1022580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Candidatus Thermofonsia → Candidatus Thermofonsia Clade 3 → Candidatus Thermofonsia Clade 3 bacterium | 3123 | Open in IMG/M |
| 3300032356|Ga0308414_1112545 | Not Available | 931 | Open in IMG/M |
| 3300032356|Ga0308414_1164865 | Not Available | 679 | Open in IMG/M |
| 3300034646|Ga0372965_048293 | Not Available | 558 | Open in IMG/M |
| 3300034647|Ga0372968_032591 | Not Available | 680 | Open in IMG/M |
| 3300034650|Ga0372973_033462 | Not Available | 771 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Hot Spring Phototrophic Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat | 84.00% |
| Anoxygenic And Chlorotrophic Microbial Mat | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat | 8.00% |
| Anoxygenic And Chlorotrophic | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic | 8.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002493 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012 | Environmental | Open in IMG/M |
| 3300002510 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 | Environmental | Open in IMG/M |
| 3300005246 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2300_T MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005452 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG | Environmental | Open in IMG/M |
| 3300005453 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG | Environmental | Open in IMG/M |
| 3300005490 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_B MetaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010182 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0300_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010186 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2300_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300010257 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1800_T MetaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300026237 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300026509 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027279 | Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031245 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4 | Environmental | Open in IMG/M |
| 3300031508 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2 | Environmental | Open in IMG/M |
| 3300031509 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60 | Environmental | Open in IMG/M |
| 3300031512 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T8 | Environmental | Open in IMG/M |
| 3300031513 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer | Environmental | Open in IMG/M |
| 3300031514 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_149 | Environmental | Open in IMG/M |
| 3300031516 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T9 | Environmental | Open in IMG/M |
| 3300031517 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050624_m2 | Environmental | Open in IMG/M |
| 3300031518 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_148 | Environmental | Open in IMG/M |
| 3300031567 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050623_t1 | Environmental | Open in IMG/M |
| 3300031568 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050630_ee2 | Environmental | Open in IMG/M |
| 3300031767 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M1 | Environmental | Open in IMG/M |
| 3300031783 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd | Environmental | Open in IMG/M |
| 3300031812 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer | Environmental | Open in IMG/M |
| 3300031830 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe4 | Environmental | Open in IMG/M |
| 3300031865 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe3 | Environmental | Open in IMG/M |
| 3300031875 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MS13 | Environmental | Open in IMG/M |
| 3300031878 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M4 | Environmental | Open in IMG/M |
| 3300031948 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe1 | Environmental | Open in IMG/M |
| 3300031950 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65 | Environmental | Open in IMG/M |
| 3300031958 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-MatCore | Environmental | Open in IMG/M |
| 3300031966 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS55 | Environmental | Open in IMG/M |
| 3300031980 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS-M3 | Environmental | Open in IMG/M |
| 3300032033 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M2 | Environmental | Open in IMG/M |
| 3300032034 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe2 | Environmental | Open in IMG/M |
| 3300032049 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS60 | Environmental | Open in IMG/M |
| 3300032057 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS60 | Environmental | Open in IMG/M |
| 3300032058 | Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS50 | Environmental | Open in IMG/M |
| 3300032356 | Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS50 | Environmental | Open in IMG/M |
| 3300034646 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_0000_MSt4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034647 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_0600_MSt7 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300034650 | Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1600_MSt12 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24185J35167_10506771 | 3300002493 | Anoxygenic And Chlorotrophic Microbial Mat | MPPLCAQRRKMLRDAPERLPVKRVGRAVVDVPTQHQFGVCGGQRREVEQT* |
| JGI24186J35511_10430712 | 3300002510 | Anoxygenic And Chlorotrophic Microbial Mat | MRRDQRLVPPFRAQRCEMLRHAPERLPVKRVGRAVVDVSAQHQLSVRRGQRREVEQT* |
| Ga0068638_1016043 | 3300005246 | Anoxygenic And Chlorotrophic Microbial Mat | SFAFLALMLRRNRLIPPFRAQRRKVLRHALKRQSVKRVGRAVVDVPTQHQFGVRRGQRREVEQT* |
| Ga0068706_10540652 | 3300005452 | Anoxygenic And Chlorotrophic | MPPLSAQRREVLRHAPERLSVKRVRRAVVDVPTQHQFGVCGGQRRKVEQT* |
| Ga0068706_10910902 | 3300005452 | Anoxygenic And Chlorotrophic | MRCDQRLVPPLRAQRRKMLRDAPERLTIKRVRRAVVDVPTQHQLGIRGGQRREVEQT* |
| Ga0068705_101199392 | 3300005453 | Anoxygenic And Chlorotrophic | FRAQRGEMLRHAPERLPVKRVGRAVVDVPTQHQFGVRRGQRREVEQT* |
| Ga0068662_1754552 | 3300005490 | Anoxygenic And Chlorotrophic Microbial Mat | MRCDQRLVPPLRAQRRKMLRDAPERLTIKRVRRAVVDVPTQHQFGVCGGQRREVEQT* |
| Ga0124917_10787081 | 3300010182 | Anoxygenic And Chlorotrophic Microbial Mat | MLRRNRLIPPFRAQRRKMLRHALKRQSVKRVRRAVVDVPTQHQFGVCGGQRREVEQT* |
| Ga0124916_10039852 | 3300010186 | Anoxygenic And Chlorotrophic Microbial Mat | MPPLCAQRREVLRHALKRQSVKRVGRAVVDVPTQHQFGVRRGQRREVEQT* |
| Ga0124913_10526402 | 3300010257 | Anoxygenic And Chlorotrophic Microbial Mat | MRCDQRLMPPFCAQRCEMLRDALKRQTVKRVGRAVVDVSAQHQFGIRGGQRREVE* |
| Ga0124913_10758702 | 3300010257 | Anoxygenic And Chlorotrophic Microbial Mat | MLRRNRLIPPFRAQRCEMLRHALKRQSVKRVGRAVVDVPTQHQFGVRRGQRREVEQT* |
| Ga0209750_10211771 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | MRCDQRLMPPLCAQRREMLRHAPERLPVKRVGRAVINIPTQHQLGIRSGQRREVEQT |
| Ga0209750_10246182 | 3300026237 | Anoxygenic And Chlorotrophic Microbial Mat | MRRDQRLVPPFRAQRCEMLRHAPERLPVKRVGRAVVDVSAQHQLSVRRGQRREVEQT |
| Ga0209809_10501952 | 3300026509 | Anoxygenic And Chlorotrophic | MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVDVPTQHQFGVRRGQRREVEQT |
| Ga0209809_10615792 | 3300026509 | Anoxygenic And Chlorotrophic | MLRRNRLIPPFRAQRGEMLRHAPERLPVKRVGRAVVDVPTQHQFGVRRGQRREVEQT |
| Ga0209809_10671042 | 3300026509 | Anoxygenic And Chlorotrophic | MLRRNRLIPPFRAQRCEMLRHAPERLPVKRVRRAVVDVPTQHQFGVCGGQRREVEQT |
| Ga0209809_11297002 | 3300026509 | Anoxygenic And Chlorotrophic | RCDQRLVPPLRAQRRKMLRDAPERLTIKRVRRAVVDVPTQHQLGIRGGQRREVEQT |
| Ga0209809_11430402 | 3300026509 | Anoxygenic And Chlorotrophic | MLRRNRLIPPFRAQRREMLRHALKRQSVKRVGRAVVDVPTQHQFGVRRGQRREVEQT |
| Ga0209691_10079956 | 3300027279 | Anoxygenic And Chlorotrophic | MRCDQRLVPPLRAQRRKMLRDAPERLTIKRVRRAVVDVPTQHQLGIRGGQRREVEQT |
| Ga0209691_10646962 | 3300027279 | Anoxygenic And Chlorotrophic | MCSDYLLMPPLSAQRREVLRHAPERLSVKRVRRAVVDVPTQHQFGVCGGQRRKVEQT |
| Ga0308395_10225752 | 3300031245 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRREVLRHALKRQTVKRVGRAVVDVSAQHQLGVRGGQRRKVEQT |
| Ga0308395_10424902 | 3300031245 | Hot Spring Phototrophic Mat | MLRRNRLIPPFRAQRGEMLRHAPERLPVKRVGRAVVDVSAQHQLSVRRGQRREVEQT |
| Ga0308394_10330381 | 3300031508 | Hot Spring Phototrophic Mat | LRDAPERLTIKRVRRAVVDVPTQHQFGVCGGQRREVEQT |
| Ga0308394_10582002 | 3300031508 | Hot Spring Phototrophic Mat | MRCNQRLMPPFRAQRREMLRDALKRQTVKRVGRAVVDVPTQHQFGICGGQRREIEQT |
| Ga0308394_11121321 | 3300031508 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEMLRHAPERLPVKRVGRAVVDVPTQHQFGVRRGQRREVEQT |
| Ga0308399_100021910 | 3300031509 | Hot Spring Phototrophic Mat | MRCDQRLVPPLRAQRRKMLRDAPERLTIKRVGRAVVDVSAQHQFCVRGGQRREVEQT |
| Ga0308399_10033802 | 3300031509 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRRKVLRDAPERLTIKRVGRAMVDVSAQHQFGVRCGQRREVEQT |
| Ga0308399_10723711 | 3300031509 | Hot Spring Phototrophic Mat | RHRSSPFPLMRCDQRLVPPLCAQRREVLRYALKRQTVKRVGRAVVDVSAQHQFGVRCGQRREVEQT |
| Ga0308399_10924151 | 3300031509 | Hot Spring Phototrophic Mat | CDQRLVPPLCAQRREVLRYALKRQTVKRVGRAVVDVSAQHQFGVRGGQRREVEQT |
| Ga0308399_10947212 | 3300031509 | Hot Spring Phototrophic Mat | MRRDQRLVPPLRAQRRKMLRDAPERLTIKRVRRAVVDVPTQHQFGVCGGQRREVEQT |
| Ga0308399_11117372 | 3300031509 | Hot Spring Phototrophic Mat | MRCDQRLVPPLRAQRRKMLRDAPERLTIKRVGRAVVDVSAQHQFCVRCGQRREVEQT |
| Ga0308397_10213872 | 3300031512 | Hot Spring Phototrophic Mat | MLRRNRLIPPFRAQRREMLRHAPERLPVKRVGRAVVDVSAQHQLGVRGGQRRKVEQT |
| Ga0308397_10811781 | 3300031512 | Hot Spring Phototrophic Mat | MRCDQRLVPPLRAQRRKMLRDAPERLTIKRVRRAVVDVPTQHQFGVCGGQRREVEQT |
| Ga0308412_100014335 | 3300031513 | Hot Spring Phototrophic Mat | MRRDQRLIPPLCAQRSKVLRHAPKRLTVKYVGRAVVDVSTQYQFGIRGGQRREVEQT |
| Ga0308412_10031942 | 3300031513 | Hot Spring Phototrophic Mat | MRCDQRLVPPLCAQRREMLRHALKRLPVKRVGRAVVDVSTQHQFCVRCGQRREVEQT |
| Ga0308412_10037757 | 3300031513 | Hot Spring Phototrophic Mat | MPPLCAQRREMLRHAPERLPVKRVGRAVVDVSTQHQFCVRCGQRREVEQT |
| Ga0308412_10088597 | 3300031513 | Hot Spring Phototrophic Mat | MRCDQRLMPPFRAQRRKMLRDALKRQPVKRVGGAVVDVSTQHQLGVRCGQRREVEQT |
| Ga0308412_10455002 | 3300031513 | Hot Spring Phototrophic Mat | MRCDQRLMPPFRAQRREMLRDALKRQTVKRVGRAVVDVPTQHQFGIRGGQRREVEQT |
| Ga0308412_10564903 | 3300031513 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRRKVLRDAPERLPVKRVGRAVVDVPAQHQFGIRGGQRREVEQT |
| Ga0308412_10592952 | 3300031513 | Hot Spring Phototrophic Mat | MPPLCAQRRKVLRDALQRQTVKRVRRAVVDVPAQHQFGIRSGQRREVKQT |
| Ga0308412_10617632 | 3300031513 | Hot Spring Phototrophic Mat | MRRDQRLIPPLCAQRSKVLRHAPKRLTVKYVGRAVVDVSAQYQFGIRDGQRCEVEQT |
| Ga0308412_11666112 | 3300031513 | Hot Spring Phototrophic Mat | MRRDQRLIPPLCAQRRKMLRDAPERLTVKRVGRAVVDVSAQHQFGVRGGQRREVEQT |
| Ga0308390_10505342 | 3300031514 | Hot Spring Phototrophic Mat | MLRRNRLIPPLRAQRREMLRHALKRQSVKRVGRAVVDVPTQHQFGVRRGQRREVEQT |
| Ga0308390_10590252 | 3300031514 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRREMLRHAPERLPVKRVGRAVVDVSAQHQLGVRGGQRRKVEQT |
| Ga0308390_10833942 | 3300031514 | Hot Spring Phototrophic Mat | MCSDQLLMPPLCAQRREVLRHAPERLPVKRVGRAVINIPTQHQLGIRSGQRREVKQT |
| Ga0308398_10969792 | 3300031516 | Hot Spring Phototrophic Mat | MRCNQRLMPPFRAQRREMLRDALKRQTVKRVGRAVVDVPTQHQFGICGGQRREVEQT |
| Ga0308392_100011714 | 3300031517 | Hot Spring Phototrophic Mat | MRCDQRLMPPLRAQRRKMLRDAPERLTIKRVGRAVVDVSAQHQFCVRGGQRREVEQT |
| Ga0308392_10053654 | 3300031517 | Hot Spring Phototrophic Mat | MCSDQLLMPPLCAQRRKMLRDAPERLTVKRVGRAVVDVPAQHQFGIRGGQRREVEQT |
| Ga0308392_10072482 | 3300031517 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEVLRDAPERLSVKRVGRTVVDVPTQHQFGVRGGQRREVEQT |
| Ga0308392_10228042 | 3300031517 | Hot Spring Phototrophic Mat | MRCDQRLVPPLCAQRREVLRYALKRQTVKRVGRAVVDVSAQHQFCVRGGQRREVEQT |
| Ga0308392_10505922 | 3300031517 | Hot Spring Phototrophic Mat | MHCDQRLMPPLRAQRRKMLRDAPERLTIKRVGRAVVDVSAQHQFCVRCGQRREVEQT |
| Ga0308389_10937681 | 3300031518 | Hot Spring Phototrophic Mat | MLRRNRLIPPLRAQRRKMLRDAPERLTIKRVRRAVVDVPTQHQFGVCGGQRREVEQT |
| Ga0308389_10997382 | 3300031518 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRREVLRHALKRQSVKRVGRAVVDVPTQHQFGVRRGQRREVEQT |
| Ga0308391_10068904 | 3300031567 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEVLHDAPERLSVKRVGRTVVDVPTQHQFGVRSGQRREVEQT |
| Ga0308393_10757702 | 3300031568 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRREMLRHAPERLPVKRVGRAVVDVSAQHQLGVRGGQRRKVEQT |
| Ga0308401_100011711 | 3300031767 | Hot Spring Phototrophic Mat | MRRDQRLMPPLRAQRRKMLRDAPERLTVKRVGRAVVDVSAQHQFCVRGGQRREVEQT |
| Ga0308401_10012702 | 3300031767 | Hot Spring Phototrophic Mat | MRCDQRLVPPLRAQRRKMLRYAPERLTIKRVGRAVVDVSAQHQFGVRGGQRREVEQT |
| Ga0308401_10022728 | 3300031767 | Hot Spring Phototrophic Mat | MRCDQRLVPPLCAQRREVLRYALKRQTVKRVGRAVVDVSAQHQFGVRCGQRREVEQT |
| Ga0308401_10051916 | 3300031767 | Hot Spring Phototrophic Mat | MRCDQRLVPPLRAQRRKMLRDAPERLTIKRVGSAVVDVSAQHQFCVRGGQRREVEQT |
| Ga0308401_10073191 | 3300031767 | Hot Spring Phototrophic Mat | MRCDQRLMPPFRTQRREVLRDAPERLTIKRVGRTVVDVSAQHQFCVRGGQRREVEQT |
| Ga0308401_10094666 | 3300031767 | Hot Spring Phototrophic Mat | PFPLMRRDQRLMPPLRAQRRKMLRDAPERLTVKRVGRAVVDVPTQHQFGVCGGQRREVEQ |
| Ga0308401_10108292 | 3300031767 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRREVLRYALKRQTVKRVGRAVVDVSAQHQFCVRCGQRREVEQT |
| Ga0308401_11026772 | 3300031767 | Hot Spring Phototrophic Mat | MLRRNRLIASLRAKRREMLRDAPERLTVKRVGRAVIDVPTQHQFGVCGGQRREVEQT |
| Ga0308418_10533692 | 3300031783 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRREVLRDALKRQTVKRVGRAVVDVSAQHQFGIRGGQRREVEQT |
| Ga0308418_10667482 | 3300031783 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRREMLRHAPERLPVKRVGRAVVDVSAQHQLGVRGGQRREVEQT |
| Ga0308418_11181152 | 3300031783 | Hot Spring Phototrophic Mat | MLRRNRLIPPFRAQRREVLRHALKRQSVKRVGRAVVDVPAQHQFGVRRGQRREVEQT |
| Ga0308411_1000215610 | 3300031812 | Hot Spring Phototrophic Mat | MCSDQLLMPPLCAQRRKMLRDAPERLTVKRVGRAVVDVSAQHQFGVRGGQRREVEQT |
| Ga0308411_100483971 | 3300031812 | Hot Spring Phototrophic Mat | MRCDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVDVSTQHQFGICGGQRREVEQT |
| Ga0308411_100523743 | 3300031812 | Hot Spring Phototrophic Mat | MPPFRAQRCEVLRHALQRQTVKRIGRAVVNIPTQYQLSIRGGQRREVEQT |
| Ga0308411_101155762 | 3300031812 | Hot Spring Phototrophic Mat | MLRRNRLIASLRAQRSEMLRDAPERLTIKRVGRAVVDVSAQYQFGIRDGQRREVEQT |
| Ga0308411_101442242 | 3300031812 | Hot Spring Phototrophic Mat | MRCNQRLIASLRAQRRKMLRDALERQTVKRVGRAVVNIPTQYQLSIRGGQRREVEQT |
| Ga0308409_10057072 | 3300031830 | Hot Spring Phototrophic Mat | MRCDQRLVPPLRAQRRKMLRDAPERLTIKRVRRAVVDVPTQHQFGVRRGQRREVEQT |
| Ga0308409_10217444 | 3300031830 | Hot Spring Phototrophic Mat | MRRDQRLVPPLRAQRCEVLRHALQRQTVKRVGRAVVDVSAQHQFGVRCGQRRKVE |
| Ga0308408_10098495 | 3300031865 | Hot Spring Phototrophic Mat | MLRRNRLIPPFRAQRGEMLRHAPERLTVKRVGRAVVDVPTQHQFGVRRGQRREVEQT |
| Ga0308408_11119681 | 3300031865 | Hot Spring Phototrophic Mat | RCEMLRDALKRQTVKRVGRAVVDVPTQHQFGICGGQRREVEQT |
| Ga0308405_11268412 | 3300031875 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEMLRHAPERLTVKRVGRAVVDVPTQHQFGVRRGQRREVEQT |
| Ga0308405_11353322 | 3300031875 | Hot Spring Phototrophic Mat | MLRRNRLIPPFRAQRREMLRHAPERLPVKRVGRAVVDVPTQHQFGVRRGQRREVEQT |
| Ga0308404_10074752 | 3300031878 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAVVDVPTQHQFGVRCGQRREVEQT |
| Ga0308404_10126982 | 3300031878 | Hot Spring Phototrophic Mat | MRCDQRLMPPLRAQRRKMLRDAPERLTIKRVRRAVVDVPTQHQFGVCGGQRREVEQT |
| Ga0308404_10304292 | 3300031878 | Hot Spring Phototrophic Mat | MCCDQRLMPPLCAQRREVLRDAPERLTVKRVGRAMVDVPTQHQLGVRGGQRREVEQT |
| Ga0308404_10331312 | 3300031878 | Hot Spring Phototrophic Mat | MRCDQRLVPPLCAQRCEVLRDAPERLTIKRVGRAVVDVSAQHQFCVRGGQRREVEQT |
| Ga0308406_10595332 | 3300031948 | Hot Spring Phototrophic Mat | MCSDYLLMPPLSAQRREVLRHALQRQTVKRVGRAVVDVSAQHQFGVRCGQRRKVE |
| Ga0308417_10014624 | 3300031950 | Hot Spring Phototrophic Mat | MRCDQRLMPPLRAQRRKMLRDAPERLTVKRVGRAVVDVPAQHQFGIRSGQRREVEQT |
| Ga0308417_10229136 | 3300031950 | Hot Spring Phototrophic Mat | MLRYNRLMPPLRAQRREVLCDALKRQSVKRVGWAVVDVSAQYQFGVRGGQRREIEQT |
| Ga0308417_10302572 | 3300031950 | Hot Spring Phototrophic Mat | MRRDQRLVPPLRAQRREVLRHAPKRLTVKRVGRAVVDVPAQHQFGIRGGQRREVEQT |
| Ga0308417_10394624 | 3300031950 | Hot Spring Phototrophic Mat | MRCDQRLVSPLRAQRRKMLRDAPERLTIKRVRRAVVDVPTQHQFGICGGQRREVEQT |
| Ga0308417_10524292 | 3300031950 | Hot Spring Phototrophic Mat | MRCDQRLVPPLCAQRRKMLRDAPERLTIKRVGRAVVDVSAQHQFCVRGGQRREVEQT |
| Ga0308417_10568492 | 3300031950 | Hot Spring Phototrophic Mat | MRCDQRLVPPLCAQRREVLRHAPERLTVKRVGRAVVDVPAQHQFGIRGGQRREVEQT |
| Ga0308417_10570771 | 3300031950 | Hot Spring Phototrophic Mat | LMLRYNRLMPPLRAQRREVLCDALKRQSVKRVGWAVVDVSAQHQFGVRGGQRREVKQT |
| Ga0308417_10574082 | 3300031950 | Hot Spring Phototrophic Mat | MRRDQHLIPPLCAQRRKMLRDAPERLTVKRVGRAVVDVSAQHQFGVRGGQRREVEQT |
| Ga0308417_10966522 | 3300031950 | Hot Spring Phototrophic Mat | MRCDQRLMPPLRAQRREVLRHAPERLMIKRVRRTVIDVSAQHQFCVRGGQRRKVEQT |
| Ga0308417_11504971 | 3300031950 | Hot Spring Phototrophic Mat | MRCDQRLMPPFRAQRCEVLRHAPERLTVKRVGRAVVDVPTQHQFGIRGGQRREVEQT |
| Ga0308417_11715172 | 3300031950 | Hot Spring Phototrophic Mat | FPLVCSDYLLMPPLCAQRRKVLRDALQRQTVKRVRRAVVDVPAQHQFGIRSGQRREVKQT |
| Ga0308417_12235002 | 3300031950 | Hot Spring Phototrophic Mat | MRRDQRLMPPLCAQRREMLRHAPERLPVKRVGRAVVDVSAQHQFGVRSGQRREVEQT |
| Ga0308417_12267741 | 3300031950 | Hot Spring Phototrophic Mat | MRRNERLVPPLRAQRCEVLRDAPKRLPVKRVRRAVVNIPTQHQFGVRSG |
| Ga0308417_12614262 | 3300031950 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEMLRDALKRQTVKRVGRAVVDVPTQHQLGVRGGQRREVEQT |
| Ga0308410_10223622 | 3300031958 | Hot Spring Phototrophic Mat | MCSDQLLMPPLCAQRRKMLRDAPERLTVKRVGRAVIDVPTQHQFCVRGGQRREVEQT |
| Ga0308410_10699472 | 3300031958 | Hot Spring Phototrophic Mat | MPPLCAQRREMLRDAPERLTVKRVRRAVVDVSAQHQFGVRGGQRREVEQT |
| Ga0308410_10819042 | 3300031958 | Hot Spring Phototrophic Mat | MCSDQLLMPPLRAQRRKVLRYALKRLPVKRVGRAVVDVSAQHQFGVRCGQRREVEQT |
| Ga0308410_11238381 | 3300031958 | Hot Spring Phototrophic Mat | VLRDALKRQPVKRVGRTVIDVPTQHQFGVRGGQRREVEQT |
| Ga0308420_10111425 | 3300031966 | Hot Spring Phototrophic Mat | MPPLCAQRRKVLRDALQRQMVKRVRRAVVDVPAQHQFGIRSGQRREVEQT |
| Ga0308420_10194846 | 3300031966 | Hot Spring Phototrophic Mat | LRRNRLIPPLRAQRRKVLRHAPERLPVKRVGRAVVDVSAQHQLSVRGGQRREVEQT |
| Ga0308420_10360862 | 3300031966 | Hot Spring Phototrophic Mat | MCSDQLLMPPLRAQRREVLRDAPERLPVKRVGRAVINIPTQHQLGIRSGQRREVKQT |
| Ga0308420_10673512 | 3300031966 | Hot Spring Phototrophic Mat | MLRRNRLIPPFRAQRREVLRHAPERLPVKRVGRAVVDVPTQHQFGVRRGQRREVEQT |
| Ga0308403_10001862 | 3300031980 | Hot Spring Phototrophic Mat | MRCDQRLVPPLRAQRRKMLRDAPERLTIKRVGRAVVDVSTQHQFCVRCGQRREVEQT |
| Ga0308403_10207721 | 3300031980 | Hot Spring Phototrophic Mat | MRCDQRLVPPLCAQRREVLRDAPERLTVKRVGRAVVDVSAQHQFGVRGGQRREVEQT |
| Ga0308403_10625342 | 3300031980 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEMLRHALKRLAVKRVGRAVVDVPTQHQFGVRGGQRREVEQT |
| Ga0308402_10307552 | 3300032033 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRCEVLRDAPERLTIKRIGRAVVDVSAQHQFCVRGGQRREVEQT |
| Ga0308402_10764131 | 3300032033 | Hot Spring Phototrophic Mat | MRRDQRLMPPLRAQRRKMLRYALKRQTVKRVRRAVVDVPTQHQFGVCGG |
| Ga0308402_10770152 | 3300032033 | Hot Spring Phototrophic Mat | MRCDQRLMPPLRAQRRKMLRDAPERLTIKRVGRAVVDVSAQHQFGVRGGQRREVEQT |
| Ga0308402_10842422 | 3300032033 | Hot Spring Phototrophic Mat | MRRDQRLMPPFRAQRCEMLRDALKRQTVKRVGRAVVDVSTQHQFGICGGQRREVEQT |
| Ga0308407_10188282 | 3300032034 | Hot Spring Phototrophic Mat | MLRRNRLIPPFRAQRREMLRHALKRQSVKRVRRAVVDVPTQHQFGVRRGQRREVEQT |
| Ga0308407_10239152 | 3300032034 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRREMLRHAPERLPVKRVGRAVINIPTQHQLGIRSGQRREVKQT |
| Ga0308407_10301441 | 3300032034 | Hot Spring Phototrophic Mat | MLRRNRLIPPFRAQRGEMLRHALKRQSVKRVRRAVVDVPTQHQFGVRRGQRREVEQT |
| Ga0308416_10109991 | 3300032049 | Hot Spring Phototrophic Mat | RRRSSSLPLMRCDQRLMPPLCAQRREMPRHALERLTVKRVGRAVIDVPTQHQFGVCGGQRREVEQT |
| Ga0308416_10393352 | 3300032049 | Hot Spring Phototrophic Mat | MRCDQRLMPPLCAQRRKMLRDALEWLSVKRVRRAVIDIPAQHQLGVRDGQRREVEQT |
| Ga0308421_10616912 | 3300032057 | Hot Spring Phototrophic Mat | MCSDQLLMPPLRAQRCKVLRHAPERLPVKRVGRAVVDVPTQHQFGVRRGQRREVEQT |
| Ga0308419_10809892 | 3300032058 | Hot Spring Phototrophic Mat | MRCDQRLMPPFRAQRREMLRNAPERLTVKRVGRAVVDVSAQHQFGIRGGQRREVEQT |
| Ga0308419_10937692 | 3300032058 | Hot Spring Phototrophic Mat | VFLPLMLSRNRLMPPLRAQRREMMCHALKRQSVKRVGWAVVDVSAQHQFGVCGR |
| Ga0308414_10225805 | 3300032356 | Hot Spring Phototrophic Mat | MLRYNRLMPPLRAQRREVLRDALKRQSVKRVGWAVINIPTQHQLGVCGGQRREVEQT |
| Ga0308414_11125452 | 3300032356 | Hot Spring Phototrophic Mat | MLRYNRLMPPLRAQCREVLCDALKRQSVKRVGRAMVDVSAQYQFSVCGR |
| Ga0308414_11648651 | 3300032356 | Hot Spring Phototrophic Mat | PPLCAQRRKVLRDALQRQTVKRVRRAVVDVPAQHQFGIRSGQRREVKQT |
| Ga0372965_048293_34_207 | 3300034646 | Hot Spring Phototrophic Mat | MLRRNRLIPPFRAQRREMLRHAPERLPVKRVGRAGVEVPTQPQFGVRRGQRREVEQT |
| Ga0372968_032591_3_137 | 3300034647 | Hot Spring Phototrophic Mat | QRRKVLRHAPERLPVKRVRRAVVDVPTQHQFGVRRGQRREVEQT |
| Ga0372973_033462_43_210 | 3300034650 | Hot Spring Phototrophic Mat | MRCDQRLVPPLRAQRGEMLRHAPERLPVKRVGRAVVDVSAQHQLSVRGGQRREVE |
| ⦗Top⦘ |