NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F067203

Metagenome / Metatranscriptome Family F067203

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F067203
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 85 residues
Representative Sequence MTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMDETARQYINRAKYVLREWNND
Number of Associated Samples 99
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 75.40 %
% of genes near scaffold ends (potentially truncated) 26.19 %
% of genes from short scaffolds (< 2000 bps) 76.19 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction Yes
3D model pTM-score0.51

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Predicted Viral (45.238 % of family members)
NCBI Taxonomy ID 10239 (predicted)
Taxonomy All Organisms → Viruses → Predicted Viral

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(44.444 % of family members)
Environment Ontology (ENVO) Unclassified
(82.540 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(88.889 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 61.26%    β-sheet: 0.00%    Coil/Unstructured: 38.74%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.51
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF03889ArfA 7.14
PF07486Hydrolase_2 1.59
PF05367Phage_endo_I 0.79
PF03796DnaB_C 0.79
PF02945Endonuclease_7 0.79
PF00589Phage_integrase 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 126 Family Scaffolds
COG3036Stalled ribosome alternative rescue factor ArfATranslation, ribosomal structure and biogenesis [J] 7.14
COG3773Cell wall hydrolase CwlJ, involved in spore germinationCell cycle control, cell division, chromosome partitioning [D] 1.59
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 0.79
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms64.29 %
UnclassifiedrootN/A35.71 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10011994All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Zobellviridae → Cobavirinae → Siovirus5497Open in IMG/M
3300000116|DelMOSpr2010_c10010271All Organisms → Viruses → Predicted Viral4879Open in IMG/M
3300000117|DelMOWin2010_c10024026All Organisms → Viruses → Predicted Viral3106Open in IMG/M
3300001450|JGI24006J15134_10038810All Organisms → Viruses → Predicted Viral2031Open in IMG/M
3300001460|JGI24003J15210_10005290Not Available5496Open in IMG/M
3300001460|JGI24003J15210_10026302Not Available2159Open in IMG/M
3300001472|JGI24004J15324_10046424All Organisms → Viruses → Predicted Viral1315Open in IMG/M
3300001589|JGI24005J15628_10022147All Organisms → Viruses → Predicted Viral2739Open in IMG/M
3300004097|Ga0055584_102632718Not Available505Open in IMG/M
3300004448|Ga0065861_1003965All Organisms → Viruses → Predicted Viral1619Open in IMG/M
3300004457|Ga0066224_1009710All Organisms → Viruses → Predicted Viral3577Open in IMG/M
3300004461|Ga0066223_1097500Not Available665Open in IMG/M
3300005086|Ga0072334_10289611All Organisms → Viruses → Predicted Viral1896Open in IMG/M
3300005512|Ga0074648_1006360Not Available8783Open in IMG/M
3300006025|Ga0075474_10001073Not Available11218Open in IMG/M
3300006025|Ga0075474_10031263All Organisms → Viruses → Predicted Viral1871Open in IMG/M
3300006026|Ga0075478_10003286Not Available5820Open in IMG/M
3300006026|Ga0075478_10037199All Organisms → Viruses → Predicted Viral1613Open in IMG/M
3300006027|Ga0075462_10024899All Organisms → Viruses → Predicted Viral1933Open in IMG/M
3300006027|Ga0075462_10146557Not Available722Open in IMG/M
3300006637|Ga0075461_10173169All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011654Open in IMG/M
3300006735|Ga0098038_1102009All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas putida group989Open in IMG/M
3300006749|Ga0098042_1132025Not Available619Open in IMG/M
3300006802|Ga0070749_10064554All Organisms → Viruses → Predicted Viral2205Open in IMG/M
3300006802|Ga0070749_10653100Not Available564Open in IMG/M
3300006810|Ga0070754_10149061All Organisms → Viruses → Predicted Viral1119Open in IMG/M
3300006810|Ga0070754_10502351Not Available522Open in IMG/M
3300006916|Ga0070750_10030239All Organisms → Viruses → Predicted Viral2696Open in IMG/M
3300006916|Ga0070750_10042120All Organisms → Viruses → Predicted Viral2236Open in IMG/M
3300006916|Ga0070750_10254556Not Available761Open in IMG/M
3300006916|Ga0070750_10360497Not Available612Open in IMG/M
3300006919|Ga0070746_10412380Not Available604Open in IMG/M
3300006928|Ga0098041_1284441All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164526Open in IMG/M
3300007229|Ga0075468_10078157All Organisms → Viruses → Predicted Viral1077Open in IMG/M
3300007234|Ga0075460_10204204All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011671Open in IMG/M
3300007236|Ga0075463_10128141All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage820Open in IMG/M
3300007276|Ga0070747_1197672Not Available709Open in IMG/M
3300007344|Ga0070745_1043305All Organisms → Viruses → Predicted Viral1880Open in IMG/M
3300007344|Ga0070745_1345869Not Available522Open in IMG/M
3300007345|Ga0070752_1031219All Organisms → Viruses → Predicted Viral2588Open in IMG/M
3300007345|Ga0070752_1213313All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon764Open in IMG/M
3300007345|Ga0070752_1313873Not Available595Open in IMG/M
3300007346|Ga0070753_1362951Not Available509Open in IMG/M
3300007538|Ga0099851_1171167Not Available801Open in IMG/M
3300007539|Ga0099849_1370174Not Available507Open in IMG/M
3300007540|Ga0099847_1018714All Organisms → Viruses → Predicted Viral2265Open in IMG/M
3300007540|Ga0099847_1034531All Organisms → Viruses → Predicted Viral1617Open in IMG/M
3300007540|Ga0099847_1166951Not Available650Open in IMG/M
3300007540|Ga0099847_1217947Not Available554Open in IMG/M
3300007541|Ga0099848_1075344All Organisms → Viruses → Predicted Viral1323Open in IMG/M
3300007963|Ga0110931_1039079All Organisms → Viruses → Predicted Viral1434Open in IMG/M
3300009149|Ga0114918_10208946All Organisms → Viruses → Predicted Viral1130Open in IMG/M
3300009433|Ga0115545_1089737All Organisms → Viruses → Predicted Viral1123Open in IMG/M
3300009593|Ga0115011_10298248All Organisms → Viruses → Predicted Viral1224Open in IMG/M
3300010148|Ga0098043_1050508All Organisms → Viruses → Predicted Viral1273Open in IMG/M
3300010153|Ga0098059_1396605Not Available521Open in IMG/M
3300010297|Ga0129345_1015043All Organisms → Viruses → Predicted Viral3007Open in IMG/M
3300010300|Ga0129351_1075218All Organisms → Viruses → Predicted Viral1368Open in IMG/M
3300010300|Ga0129351_1122179All Organisms → Viruses → Predicted Viral1038Open in IMG/M
3300010392|Ga0118731_106692221Not Available576Open in IMG/M
3300010430|Ga0118733_101505584All Organisms → Viruses → Predicted Viral1342Open in IMG/M
3300011118|Ga0114922_10454602All Organisms → Viruses → Predicted Viral1061Open in IMG/M
3300011118|Ga0114922_10698925Not Available832Open in IMG/M
3300012920|Ga0160423_10005244Not Available10570Open in IMG/M
3300013010|Ga0129327_10799454Not Available535Open in IMG/M
3300017697|Ga0180120_10020836All Organisms → Viruses → Predicted Viral3069Open in IMG/M
3300017710|Ga0181403_1103224Not Available596Open in IMG/M
3300017713|Ga0181391_1057149Not Available913Open in IMG/M
3300017717|Ga0181404_1009204All Organisms → Viruses → Predicted Viral2626Open in IMG/M
3300017717|Ga0181404_1166078Not Available530Open in IMG/M
3300017734|Ga0187222_1022492All Organisms → Viruses → Predicted Viral1525Open in IMG/M
3300017746|Ga0181389_1177376Not Available557Open in IMG/M
3300017765|Ga0181413_1056670All Organisms → Viruses → Predicted Viral1211Open in IMG/M
3300017773|Ga0181386_1176835All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164648Open in IMG/M
3300017781|Ga0181423_1077465All Organisms → Viruses → Predicted Viral1313Open in IMG/M
3300017782|Ga0181380_1274801All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164555Open in IMG/M
3300017786|Ga0181424_10406883Not Available553Open in IMG/M
3300017951|Ga0181577_10408579All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011862Open in IMG/M
3300019098|Ga0188859_1003234Not Available855Open in IMG/M
3300019937|Ga0194022_1029610Not Available721Open in IMG/M
3300020264|Ga0211526_1016348All Organisms → Viruses → Predicted Viral1219Open in IMG/M
3300020469|Ga0211577_10509892All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium728Open in IMG/M
3300021335|Ga0213867_1029978All Organisms → Viruses → Predicted Viral2167Open in IMG/M
3300021368|Ga0213860_10431104All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011569Open in IMG/M
3300021379|Ga0213864_10041670All Organisms → Viruses → Predicted Viral2173Open in IMG/M
3300021964|Ga0222719_10471927All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011761Open in IMG/M
3300022050|Ga0196883_1037563All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164589Open in IMG/M
3300022057|Ga0212025_1067257All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011618Open in IMG/M
3300022065|Ga0212024_1072834All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011610Open in IMG/M
3300022065|Ga0212024_1081423All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011576Open in IMG/M
3300022068|Ga0212021_1003215All Organisms → Viruses → Predicted Viral2254Open in IMG/M
3300022069|Ga0212026_1050987All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011624Open in IMG/M
3300022071|Ga0212028_1006131All Organisms → Viruses → Predicted Viral1755Open in IMG/M
3300022074|Ga0224906_1006902All Organisms → Viruses → Predicted Viral4645Open in IMG/M
3300022159|Ga0196893_1027875All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales529Open in IMG/M
3300022167|Ga0212020_1070748Not Available588Open in IMG/M
3300022178|Ga0196887_1125472Not Available547Open in IMG/M
3300022200|Ga0196901_1120249All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011899Open in IMG/M
3300025086|Ga0208157_1018172All Organisms → Viruses → Predicted Viral2178Open in IMG/M
3300025120|Ga0209535_1001234Not Available17557Open in IMG/M
3300025120|Ga0209535_1011789All Organisms → Viruses → Predicted Viral4859Open in IMG/M
3300025120|Ga0209535_1102225All Organisms → Viruses → Predicted Viral1022Open in IMG/M
3300025128|Ga0208919_1184843Not Available632Open in IMG/M
3300025132|Ga0209232_1065473All Organisms → Viruses → Predicted Viral1290Open in IMG/M
3300025132|Ga0209232_1110818Not Available916Open in IMG/M
3300025137|Ga0209336_10045121All Organisms → Viruses → Predicted Viral1395Open in IMG/M
3300025137|Ga0209336_10066259All Organisms → Viruses → Predicted Viral1080Open in IMG/M
3300025543|Ga0208303_1039575All Organisms → Viruses → Predicted Viral1202Open in IMG/M
3300025652|Ga0208134_1056436All Organisms → Viruses → Predicted Viral1221Open in IMG/M
3300025655|Ga0208795_1048050All Organisms → Viruses → Predicted Viral1272Open in IMG/M
3300025674|Ga0208162_1087106All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011954Open in IMG/M
3300025695|Ga0209653_1209794All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Podoviridae → unclassified Podoviridae → Puniceispirillum phage HMO-2011525Open in IMG/M
3300025810|Ga0208543_1055777Not Available969Open in IMG/M
3300025815|Ga0208785_1040950All Organisms → Viruses → Predicted Viral1352Open in IMG/M
3300025816|Ga0209193_1081818Not Available832Open in IMG/M
3300025853|Ga0208645_1090958All Organisms → Viruses → Predicted Viral1291Open in IMG/M
3300025853|Ga0208645_1221740All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon652Open in IMG/M
3300027906|Ga0209404_10792626All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon TMED164643Open in IMG/M
3300029448|Ga0183755_1066538Not Available825Open in IMG/M
3300031539|Ga0307380_10471147All Organisms → Viruses → Predicted Viral1113Open in IMG/M
3300031565|Ga0307379_11142472Not Available651Open in IMG/M
3300032277|Ga0316202_10190750Not Available952Open in IMG/M
3300034374|Ga0348335_003417Not Available10541Open in IMG/M
3300034374|Ga0348335_012972All Organisms → Viruses → Predicted Viral4420Open in IMG/M
3300034374|Ga0348335_032440All Organisms → Viruses → Predicted Viral2274Open in IMG/M
3300034374|Ga0348335_065031All Organisms → Viruses → Predicted Viral1311Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous44.44%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine17.46%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater9.52%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient3.97%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface2.38%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater2.38%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.38%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.38%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.38%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.59%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil1.59%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.79%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.79%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.79%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.79%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.79%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.79%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.79%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.79%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.79%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.79%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment0.79%
WaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Water0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005086Microbial Community from Halfdan Field MHDA3EnvironmentalOpen in IMG/M
3300005512Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_waterEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010297Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNAEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010430Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samplesEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017734Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 (version 2)EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017786Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019098Metatranscriptome of marine microbial communities from Baltic Sea - GS684_0p1EnvironmentalOpen in IMG/M
3300019937Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW29Aug16_MGEnvironmentalOpen in IMG/M
3300020264Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556116-ERR599158)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021379Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO247EnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022050Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3)EnvironmentalOpen in IMG/M
3300022057Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022069Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v2)EnvironmentalOpen in IMG/M
3300022071Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v2)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022159Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v3)EnvironmentalOpen in IMG/M
3300022167Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025695Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300034374Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1001199483300000101MarineMTMTWDEIEHYELSEKDQRYMAMYGCTQDDMLCMMNDPINFIGGHQTLAISILSDAQEVMSYDPEKARQLINKAKYVIRHLRDIDL*
DelMOSpr2010_10010271143300000116MarineMTITWDEIEHYELSEKDQRYMAMYGCTQDDMLCMLNDPINFIGGHETLAISILSDAQEVMLYDPEKARQLINKAKYVIRHLRDIDL*
DelMOWin2010_1002402633300000117MarineMTMTWKEIEHYELSEKDNQYMVMYGCTQDDMVAMMNEPMNFIGGHYMLAMSILSDAQECIARGNDNTARQYINKAKYVMREWRDMDLQEG*
JGI24006J15134_1003881053300001450MarineMTMTWDEIEHYELSEKDQRYMAMYGCTQDDMLCMMNDPINFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWNEE*
JGI24003J15210_1000529063300001460MarineMTMTWKNIEASGVSEKDKQYMVMYGCTQDDMVAMMNEPMNFIGGHYMLAMSILSDAQECIARGNNNTARQYINKAKYVMREWRDMDL*
JGI24003J15210_1002630223300001460MarineMTATWEEIQHYELSEKDQQHMVMYGCTQDDMVAMMNEPMNFVGGHYMLAMSILSDAQEIMRHKPDTARQYINKAKYVMREWRDMDL*
JGI24004J15324_1004642413300001472MarineTWEEIQHYELSEKDQQHMVMYGCTQDDMVAMMNEPMNFVGGHYMLAMSILSDAQEIMRHKPDTARQYINKAKYVMREWRDMDL*
JGI24005J15628_1002214753300001589MarineMTITWEEIQHYELSEKDQQHMVMYGCTQDDMVAMMNEPMNFVGGHYMLAMSILSDAQEIMRHKPDTARQYINKAKYVMREWRDMDL*
Ga0055584_10263271813300004097Pelagic MarineMTITWDEIEHYELSEKDQRYMAMYGCTQDDMLCMLNDPINFIGGHETLAISILSDAQEVMSYDPEKARQLINKAKYVIRHLRDIDL*
Ga0065861_100396513300004448MarineMGKLTWKDVAQTETDKRYLSMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMDETARQYINRAKYVLREWNKD*
Ga0066224_100971053300004457MarineMTMTWDEIEHYELSEKDNQYMVMYGCTQDDMVAMMNEPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVMREWRDVDL*
Ga0066223_109750023300004461MarineMTMTWKEIEHYELSEKDNQYMVMYGCTQDDMVAMMNEPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVMREWRDVDL*
Ga0072334_1028961113300005086WaterMTMTWDEIEHYEFSEKDQQHMVMYGCTQDDMVAMMNEPMNFIGGHYMLAMSILSDAQECIARGNDNTARQYINKAKYVMREWRDMDLQEG*
Ga0074648_1006360123300005512Saline Water And SedimentMPSMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIKRGMDETARQYINRAKYVLREWNND*
Ga0075474_10001073133300006025AqueousMPSMTWTDIETSELSEQDKRFMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLREWNKD*
Ga0075474_1003126323300006025AqueousMPNMTWNDIEVSELSEDDKRYMVMYGCTQDDMVCMMNDPMNFVGGHYMFVMSILSDAQECIERGMNNTARQYINRAKYVVHKWTTD*
Ga0075478_10003286163300006026AqueousMTMTWDEIQHYELSEKDQRYMAMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE*
Ga0075478_1003719943300006026AqueousMPSMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMDETARQYINRAKYVLREWNND*
Ga0075462_1002489933300006027AqueousMPNMTWTDIETSELSEQDKRFMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLREWNKD*
Ga0075462_1014655713300006027AqueousMTVTWDEIEHYELSEKDQRYMAMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE*
Ga0075461_1017316913300006637AqueousMPNMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMDETARQYINRAKYVLREWNND*
Ga0098038_110200943300006735MarineMPQKGGTMTIKWKEIEASGLSEKDKQYMVMYGCTQDDMVAMMNDPMNFIGGHYMLAMSILSDAQECIAYKPNQARQFINKAKYVLRQWKIDNE*
Ga0098042_113202523300006749MarineMPQKGGTMTIKWKEIEASGLSEKDKQYMVMYGCTQDAMVSMMNDPMNFIGGHYMLAMSILSDAQECIAYKPDQARQFINKAKYVLRQWKIDNE*
Ga0070749_1006455433300006802AqueousMPSMTWNDVAQTETDKRFMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLREWNTN*
Ga0070749_1065310033300006802AqueousMPSMTWNDVAQTETDKRFMSLYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMDETARQYINRAKYVLREWNND*
Ga0070754_1014906133300006810AqueousMTITWKEIEHYEFSEKDNQYMVMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQ
Ga0070754_1050235123300006810AqueousMPSMTWTDIEVSELSEQDKRYMVMYGCTQDDMVFMMNDPMNFIGGHYMLAMSILSDAQECIERGMNNTARQYINRAKYVLREWNTN*
Ga0070750_10030239133300006916AqueousYELSEKDQRYMAMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE*
Ga0070750_1004212013300006916AqueousSELSEDDKRYMVMYGCTQDDMVCMMNDPMNFVGGHYMFVMSILSDAQECIERGMNNTARQYINRAKYVVHKWTTD*
Ga0070750_1025455623300006916AqueousMTVILSEKDQHYMTMYGCTQDDMLCMMNDPINFIGGHYMLAMSILSDAQECIALGKDETARQYINKAKYVLRQWKEDLTDGETHD*
Ga0070750_1036049733300006916AqueousMGNLTWNDIETSELSEKDKQYMVMYGCTQDDMVCMMNDPMNFIGGHYMFAMAILSDAQECIARGMDETARQYINRAKYVLREWNKD*
Ga0070746_1041238013300006919AqueousMTATWEEIKHYELSEKDNQYMVMYGCTQDDMVAMMNEPMNFIGGHYMLAMSILSDAQECIARGNDETARQYINKAKYVMREWRD
Ga0098041_128444113300006928MarineKMPQKGGTMTIKWKEIEASGLSEKDKQYMVMYGCTQDAMVSMMNDPMNFIGGHYMLAMSILSDAQECIAYKPDQARQFINKAKYVLRQWNIDNE*
Ga0075468_1007815713300007229AqueousMTITWDEIEHYELSEKDQRYMAMYGCTQDGMLCMLNDPINFIGGHETLAISILSDAQEVMLYDPEKARQLINKAKYVIRHLRDIDL*
Ga0075460_1020420423300007234AqueousTWTDIETSELSEQDKRFMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLREWNKD*
Ga0075463_1012814143300007236AqueousMPNMTWTDIETSELSEQDKRFMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAK
Ga0070747_119767223300007276AqueousMTITWEEIEHYELSEKDKQYMVMYGCTQDDMVAMMNEPMNFIGGHYMLAMSILSDAQEIMRHKPDTARQYINKAKYVMREWRDMDL*
Ga0070745_104330543300007344AqueousMTWTDIETSELSEQDKRFMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLREWNKD*
Ga0070745_134586923300007344AqueousMTWTDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMNNTARQYINRAKYVLREWNTN*
Ga0070752_103121923300007345AqueousMTVTWDEIQHYELSEKDKQYMVMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE*
Ga0070752_121331323300007345AqueousMTITWKEIEHYEFSEKDNQYMVMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE*
Ga0070752_131387323300007345AqueousMTWDEIEHYELSEKDQQHMVMYGCTQDDMVAMMNEPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINRAKYVMREWRDIDL*
Ga0070753_136295123300007346AqueousMTWTDIEVSELSEQDKRYMVMYGCTQDDMVFMMNDPMNFIGGHYMLAMSILSDAQECIERGMNNTARQYINRAKYVLREWNTN*
Ga0099851_117116743300007538AqueousMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFMSGHYMLAMSILSDAQECIARGMNETARQYINRAKYVL
Ga0099849_137017423300007539AqueousMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMDETARQYINRAKYVL
Ga0099847_101871473300007540AqueousMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIKRGMDETARQYINRAKYVLHEWNND*
Ga0099847_103453113300007540AqueousMTWDEIQHYELSEKDQRYMAMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE*
Ga0099847_116695113300007540AqueousMTATWEEIEHYELSEKDNQYMVMYGCTQDDMVAMMNEPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINRAKYVIRQTREQ*
Ga0099847_121794723300007540AqueousYELSEKDQRYMAMYGCTQDDMLCMLNDPINFIGGYETLAISILSDAQEVMLYDPEKARQLINKAKYVIRHLRDIDL*
Ga0099848_107534423300007541AqueousMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIKRGMDETARQYINRAKYVLREWNND*
Ga0110931_103907953300007963MarineASGLSEKDKQYMVMYGCTQDDMVAMMNEPLNFISGHYMLAMSILSDAQEIMRDKPDTARQYINKAKYVMREWRDMDL*
Ga0114918_1020894633300009149Deep SubsurfaceMTMTWDEIEHYELSEKDNQYMVMYGCTQDDMVAMMNEPMNFIGGHYMLAMSILSDAQECIARGNDNTARQYINKAKYVMREWRDMDLQEG*
Ga0115545_108973733300009433Pelagic MarineMTVTWDEIQHYELSEKDQRYMAMYGCTQDDMLCMMNDPINFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE*
Ga0115011_1029824843300009593MarineMTIKWKEIEASGLSEKDKQYMVMYGCTQDDMVAMMNDPMNFIGGHYMLAMSILSDAQECIAYKPDQARQFINKAKY
Ga0098043_105050843300010148MarineMTIKWKEIEASGLSEKDKQYMVMYGCTQDDMVAMMNDPMNFIGGHYMLAMSILSDAQECIAYKPDQARQFINKAKYVLRQWNIDNE*
Ga0098059_139660513300010153MarineLSEKDKQFMVMYGCTQDDMVAMMNEPLNFISGHYMLAMSILSDAQEIMRDKPDTARQYINKAKYVMREWRDMDL*
Ga0129345_101504363300010297Freshwater To Marine Saline GradientMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMDETARQYINRAKYVLHEWNND*
Ga0129351_107521813300010300Freshwater To Marine Saline GradientTWDEIEHYELSEKDQRYMAMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE*
Ga0129351_112217943300010300Freshwater To Marine Saline GradientMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFMSGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLREWNND*
Ga0118731_10669222123300010392MarineMTATWKEIEHYELSEKDQQHMVMYGCTQDDMLCMMNEPMNFIGGHYMLAMSILSDAQECIARGNDNTARQYINKAKYVMREWRDMDLQEPIK*
Ga0118733_10150558443300010430Marine SedimentMTMTWDEIEHYEFSEKDQRYMVMYGCTQDDMLCMMNEPMNFIGGHYMLAMSILSDAQECIARGNDNTARQYINKAKYVMREWRDMDLQEPIK*
Ga0114922_1045460243300011118Deep SubsurfaceMTWKEIEHYELSEKDNQYMVMYGCTQDDMVAMMNEPMNFIGGHYMLAMSILSDAQEIMRHKPDTARQYINKAKYVLRQWKTSK*
Ga0114922_1069892513300011118Deep SubsurfaceEIEHYELSEKDNQYMVMYGCTQDDMVAMMNEPMNFIGGHYMLAMSILSDAQECIARGNDNTARQYINKAKYVMREWRDMDLQEG*
Ga0160423_1000524463300012920Surface SeawaterMTIKWKEIEASGLSEKDKQYMVMYGCTQDDMVAMMNDPMNFIGGHYMLAMSILSDAQECIAYKPDQARQFINKAKYVLRQWKIDNE*
Ga0129327_1079945423300013010Freshwater To Marine Saline GradientMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAKECIARGMDETARQYINRAKYVLHEWNND*
Ga0180120_1002083623300017697Freshwater To Marine Saline GradientMTITWDEIEHYELSEKDQRYMAMYGCTQDDMLCMMNDPINFIGGHQTLAISILSDAQEVMLYDPEKARQLINKAKYVIRHLRDIDL
Ga0181403_110322413300017710SeawaterSMTMTWDEIEHYELSEKDQRYMAMYGCTQDDMLCMMNDPINFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWNEDLTDDKTHD
Ga0181391_105714933300017713SeawaterMTMTWDEIEHYELSEKDQRYMAMYGCTQDDMLCMMNDPINFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWNEDLTDDKTHD
Ga0181404_100920453300017717SeawaterMPNMTWNDVAQTETEKRFMTMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLREWNKD
Ga0181404_116607813300017717SeawaterMPQKGGTMTIKWKEIEASGLSEKDKQYMVMYGCTQDDMVSMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKA
Ga0187222_102249213300017734SeawaterMPNMTWNDVAQTETEKRFMTMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAKYVL
Ga0181389_117737613300017746SeawaterMTMTWDEIEHYELSEKDQRYMAMYGCTQDDMLCMMNDPINFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWNEDLTDDKTH
Ga0181413_105667033300017765SeawaterMSITWDEIQHYELSEKDQQHMVMYGCTQDDMVAMMNEPMNFVGGHYMLAMSILSDAQEIMRHKPDTARQYINKAKYVMREWRDMDL
Ga0181386_117683533300017773SeawaterMPQKGGTMTIKWKEIEASGLSEKDKQYMVMYGCTQDDMVSMMNDPMNFIGGHYMLAMSILSDAQECMAYKPDQARQFINKAKYVLRQWNKDNE
Ga0181423_107746533300017781SeawaterMTMTWDEIEHYELSEKDQRYMAMYGCTQDDMLCMMNDPINFIGGHYMMAMSILSDAQECIVRGKDETARQYINKAKYVLRQWNEDLTDDKTHD
Ga0181380_127480123300017782SeawaterGTMTIKWKEIEASGLSEKDKQYMVMYGCTQDDMVSMMNDPMNFIGGHYMLAMSILSDAQECIAYKPDQARQFINKAKYVLRQWKIDNE
Ga0181424_1040688323300017786SeawaterMPNMTWNDVAQTETEKRFMTMYGCTQDDRVCMMNDPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLREWNKD
Ga0181577_1040857913300017951Salt MarshMPNMTWNDVAQTETDKRFMVMYGCTQDDMVCMMNVPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLREWNKD
Ga0188859_100323433300019098Freshwater LakeMTMTWKNIEASDMSEKDKQYMVMYGCTQDDMAAMMNEPMNFIGGHYMLAMSILSDAQEIMRHKPDTARQYINKAKYVLRQWKTSNE
Ga0194022_102961013300019937FreshwaterMPSMTWTDIETSELSEQDKRFMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLREWNKD
Ga0211526_101634823300020264MarineMGDLTWDDVAQTETEKRFMTMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLREWSKD
Ga0211577_1050989233300020469MarineMTITWEEIQHYELSEKDQQHMVMYGCTQDDMVAMMNEPMNFVGGHYMLAMSILSDAQEIMRHKPDTARQYINKAKYVMREWRDMDL
Ga0213867_102997873300021335SeawaterMTVTWDEIEHYELSEKDQRYMAMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE
Ga0213860_1043110423300021368SeawaterNGMPNMTWNDVAQTETDKRFMSLYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIASGMDETARQYINRAKYVLREWNKD
Ga0213864_1004167063300021379SeawaterMPNLTWNDVAQTETDKRFMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLREWNKD
Ga0222719_1047192723300021964Estuarine WaterMGNLTWNDIAETETDKRYMSMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLREWNKN
Ga0196883_103756323300022050AqueousMPNMTWNDIEVSELSEDDKRYMVMYGCTQDDMVCMMNDPMNFVGGHYMFVMSILSDAQECIERGMNNTARQYINRAKYVVHKWTTD
Ga0212025_106725723300022057AqueousMPSMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMDETARQYINRAKYVLREWNND
Ga0212024_107283423300022065AqueousMPNMTWTDIETSELSEQDKRFMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLREWNKD
Ga0212024_108142313300022065AqueousMTWNDVAQTETDKRFMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMNNTARQYINRAKYVLREWNTN
Ga0212021_100321513300022068AqueousEIEHYELSEKDQRYMAMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE
Ga0212026_105098723300022069AqueousMPNMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMDETARQYINRAKYVLREWNND
Ga0212028_100613143300022071AqueousMTMTWDEIQHYELSEKDQRYMAMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE
Ga0224906_100690253300022074SeawaterMTMTWDEIEHYELSEKDQRYMAMYGCTQDDMLCMMNDPINFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWNEE
Ga0196893_102787523300022159AqueousMTMTWDEIEHYELSEKDQRYMAMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYG
Ga0212020_107074833300022167AqueousMPSMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMDETARQYINRAI
Ga0196887_112547223300022178AqueousITWDEIEHYELSEKDQRYMAMYGCTQDDMLCMLNDPINFIGGHETLAISILSDAQEVMLYDPEKARQLINKAKYVIRHLRDIDL
Ga0196901_112024923300022200AqueousMPSMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFMSGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLHEWNND
Ga0208157_101817253300025086MarineMPQKGGTMTIKWKEIEASGLSEKDKQYMVMYGCTQDDMVAMMNDPMNFIGGHYMLAMSILSDAQECIAYKPNQARQFINKAKYVLRQWKIDNE
Ga0209535_1001234133300025120MarineMTMTWKNIEASGVSEKDKQYMVMYGCTQDDMVAMMNEPMNFIGGHYMLAMSILSDAQECIARGNNNTARQYINKAKYVMREWRDMDL
Ga0209535_101178973300025120MarineMTATWEEIQHYELSEKDQQHMVMYGCTQDDMVAMMNEPMNFVGGHYMLAMSILSDAQEIMRHKPDTARQYINKAKYVMREWRDMDL
Ga0209535_110222523300025120MarineMPQKGGTMTIKWKEIEASGLSEKDKQYMVMYGCTQDDMVSMMNDPMNFIGGHYMLAMSILSDAQECIAYKPDQARQFINKAKYVLRQWKIDNE
Ga0208919_118484323300025128MarineMSITWDEIQHYELSEKDKQFMVMYGCTQDDMVAMMNEPLNFISGHYMLAMSILSDAQEIMRDKPDTARQYINKAKYVMREWRDMDL
Ga0209232_106547323300025132MarineMSITWDEIQHYELSEKDKQFMVMYGCTQDDMVCMMNDPMNFISGHYMLAMSILSDAQEIMRDKPDTARQYINKAKYVMREWRDMDL
Ga0209232_111081823300025132MarineMPQKGGTMTIKWKEIEASGLSEKDKQYMVMYGCTQDDMVAMMNDPMNFIGGHYMLAMSILSDAQECIAYKPDQARQFINKAKYVLRQWKIDNE
Ga0209336_1004512133300025137MarineTWEEIQHYELSEKDQQHMVMYGCTQDDMVAMMNEPMNFVGGHYMLAMSILSDAQEIMRHKPDTARQYINKAKYVMREWRDMDL
Ga0209336_1006625923300025137MarineMTMTWKNIEVSGMSEKDKQHMVMYGCTQDDMVAMMNEPMNFIGGHYMLAMSILSDAQEIMRHKPDTARQYINKAKYVMREWRDIDL
Ga0208303_103957553300025543AqueousVYSMTMTWDEIEHYELSEKDQRYMAMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE
Ga0208134_105643623300025652AqueousMTITWDEIEHYELSEKDQRYMAMYGCTQDDMLCMLNDPINFIGGHETLAISILSDAQEVMLYDPEKARQLINKAKYVIRHLRDIDL
Ga0208795_104805023300025655AqueousMPSMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIARGMNETARQYINRAKYVLREWNTN
Ga0208162_108710623300025674AqueousMPSMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMDETARQYINRAKYVLHEWNND
Ga0209653_120979423300025695MarineGMPSMTWNDVAQTETDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMDETARQYINRAKYVLREWNND
Ga0208543_105577733300025810AqueousMAEFDHDWNDWTEIQHYELSEKDQRYMAMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE
Ga0208785_104095043300025815AqueousMPSMTWTDIEVSELSEQDKRYMVMYGCTQDDMVFMMNDPMNFIGGHYMLAMSILSDAQECIERGMNNTARQYINRAKYVLREWNTN
Ga0209193_108181823300025816Pelagic MarineMTVTWDEIQHYELSEKDQRYMAMYGCTQDDMLCMMNDPINFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE
Ga0208645_109095813300025853AqueousMTWKDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMDETARQYINRAKYVLREWNND
Ga0208645_122174023300025853AqueousMTITWKEIEHYEFSEKDNQYMVMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE
Ga0209404_1079262623300027906MarineMPQKGGTMTIKWKEIEASGLSEKDKQYMVMYGCTQDDMVAMMNDPMNFIGGHYMLAMSILSDAQECIAYKPDQARQFINKAKYVLRQWKIDND
Ga0183755_106653813300029448MarineMSITWKEIETSGLSEKDKQFMVMYGCTQDDMVAMMNEPLNFISGHYMLAMSILSDAQEIMRDKPDTARQYINKAKYVMREWRDMDL
Ga0307380_1047114723300031539SoilMTMTWKEIEHYELSEKDNQYMVMYGCTQDDMVAMMNEPMNFIGGHYMLAMSILSDAQERIALGHGDIARQYINRAKYVMREWRDVDL
Ga0307379_1114247223300031565SoilMTMTWKEIEHYELSEKDNQYMVMYGCTQDDMVAMMNEPMNFIGEHYMLAMSILSDAQECIARGKDETARQYINRAKYVMREWRDIDL
Ga0316202_1019075023300032277Microbial MatMTMTWDEIEHYEFSEKDKQYMVMYGCTQDDMLCMMNEPMNFIGGHYMLAMSILSDAQECIARGNDNTARQYINKAKYVMREWRDMDLQEG
Ga0348335_003417_8305_85563300034374AqueousMTWTDIETSELSEQDKRFMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIARGMDETARQYINRAKYVLREWNKD
Ga0348335_012972_3222_34733300034374AqueousMTWDEIQHYELSEKDQRYMAMYGCTQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIARGKDETARQYINKAKYVLRQWKEE
Ga0348335_032440_3_2723300034374AqueousMAEFDHDWNDWTEIQHYELSEKDSQYMSMYGCIQDDMLCMMNDPMNFIGGHYMLAMSILSDAQECIACGNDETARQYINKAKYVMREWRD
Ga0348335_065031_939_11903300034374AqueousMTWTDIEVSELSEQDKRYMVMYGCTQDDMVCMMNDPMNFIGGHYMLAMSILSDAQECIERGMNNTARQYINRAKYVLREWNTN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.