| Basic Information | |
|---|---|
| Family ID | F067167 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 45 residues |
| Representative Sequence | RLAEHATKPGASAVSIVDDVRLFANGAGVRDDASVVFVGVGR |
| Number of Associated Samples | 113 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.59 % |
| % of genes near scaffold ends (potentially truncated) | 99.21 % |
| % of genes from short scaffolds (< 2000 bps) | 89.68 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.857 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.492 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.984 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (57.143 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.57% β-sheet: 0.00% Coil/Unstructured: 71.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF13380 | CoA_binding_2 | 69.84 |
| PF02517 | Rce1-like | 11.11 |
| PF13328 | HD_4 | 2.38 |
| PF04012 | PspA_IM30 | 0.79 |
| PF00795 | CN_hydrolase | 0.79 |
| PF07228 | SpoIIE | 0.79 |
| PF14602 | Hexapep_2 | 0.79 |
| PF15975 | Flot | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 11.11 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 11.11 |
| COG1842 | Phage shock protein A | Transcription [K] | 1.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.86 % |
| Unclassified | root | N/A | 7.14 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2140918007|ConsensusfromContig53551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 656 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105067087 | Not Available | 938 | Open in IMG/M |
| 3300004080|Ga0062385_10978591 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300004081|Ga0063454_101312092 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300004092|Ga0062389_102567448 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300004635|Ga0062388_101997506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 599 | Open in IMG/M |
| 3300005435|Ga0070714_100781168 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 924 | Open in IMG/M |
| 3300005471|Ga0070698_100224385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1812 | Open in IMG/M |
| 3300005526|Ga0073909_10707805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300005538|Ga0070731_10624738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 717 | Open in IMG/M |
| 3300005541|Ga0070733_10376027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 944 | Open in IMG/M |
| 3300005542|Ga0070732_10276297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1007 | Open in IMG/M |
| 3300005554|Ga0066661_10836101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300005556|Ga0066707_10628238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 682 | Open in IMG/M |
| 3300005602|Ga0070762_11158050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 534 | Open in IMG/M |
| 3300005764|Ga0066903_102827184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 942 | Open in IMG/M |
| 3300005995|Ga0066790_10346490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 634 | Open in IMG/M |
| 3300006028|Ga0070717_10145467 | All Organisms → cellular organisms → Bacteria | 2047 | Open in IMG/M |
| 3300006052|Ga0075029_100758904 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300006086|Ga0075019_10674998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300006163|Ga0070715_10179253 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300006797|Ga0066659_11039293 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300006954|Ga0079219_12247861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300009038|Ga0099829_11112941 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300009090|Ga0099827_11510589 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300009521|Ga0116222_1085178 | All Organisms → cellular organisms → Bacteria | 1362 | Open in IMG/M |
| 3300009551|Ga0105238_12475063 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300010048|Ga0126373_12438950 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300010343|Ga0074044_10800114 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300010359|Ga0126376_10004229 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 8438 | Open in IMG/M |
| 3300010360|Ga0126372_10892039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
| 3300010361|Ga0126378_13407503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 505 | Open in IMG/M |
| 3300010376|Ga0126381_104951460 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010379|Ga0136449_104599558 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 506 | Open in IMG/M |
| 3300011269|Ga0137392_10030970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3879 | Open in IMG/M |
| 3300012203|Ga0137399_10761877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300012211|Ga0137377_11501596 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300012363|Ga0137390_10129271 | All Organisms → cellular organisms → Bacteria | 2504 | Open in IMG/M |
| 3300012683|Ga0137398_11118365 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300012922|Ga0137394_11399748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 560 | Open in IMG/M |
| 3300012923|Ga0137359_11523079 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012971|Ga0126369_10184337 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1998 | Open in IMG/M |
| 3300014201|Ga0181537_10475107 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300014657|Ga0181522_10222779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1112 | Open in IMG/M |
| 3300015262|Ga0182007_10267649 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300015264|Ga0137403_10479875 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1116 | Open in IMG/M |
| 3300015265|Ga0182005_1045387 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1194 | Open in IMG/M |
| 3300015373|Ga0132257_101273721 | Not Available | 932 | Open in IMG/M |
| 3300015374|Ga0132255_100210881 | All Organisms → cellular organisms → Bacteria | 2753 | Open in IMG/M |
| 3300015374|Ga0132255_101138677 | All Organisms → cellular organisms → Bacteria | 1174 | Open in IMG/M |
| 3300016341|Ga0182035_11220839 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 672 | Open in IMG/M |
| 3300016404|Ga0182037_10157747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1718 | Open in IMG/M |
| 3300017924|Ga0187820_1238323 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300017975|Ga0187782_10846020 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 708 | Open in IMG/M |
| 3300018006|Ga0187804_10063860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1462 | Open in IMG/M |
| 3300018034|Ga0187863_10716780 | Not Available | 565 | Open in IMG/M |
| 3300018088|Ga0187771_10039831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3618 | Open in IMG/M |
| 3300018090|Ga0187770_10986203 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300020583|Ga0210401_10180291 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300021180|Ga0210396_11694877 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300021181|Ga0210388_11260274 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300021401|Ga0210393_11667420 | Not Available | 505 | Open in IMG/M |
| 3300021401|Ga0210393_11680968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300021404|Ga0210389_10195280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1578 | Open in IMG/M |
| 3300021420|Ga0210394_10479108 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1095 | Open in IMG/M |
| 3300021420|Ga0210394_10533871 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1032 | Open in IMG/M |
| 3300021432|Ga0210384_11348273 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300021433|Ga0210391_10195906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1589 | Open in IMG/M |
| 3300021433|Ga0210391_10596494 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300021475|Ga0210392_10041064 | All Organisms → cellular organisms → Bacteria | 2792 | Open in IMG/M |
| 3300021475|Ga0210392_10994056 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300022523|Ga0242663_1146094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300022557|Ga0212123_10077477 | All Organisms → cellular organisms → Bacteria | 2826 | Open in IMG/M |
| 3300022557|Ga0212123_10707343 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300022731|Ga0224563_1003617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1064 | Open in IMG/M |
| 3300025905|Ga0207685_10731126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300025916|Ga0207663_11320137 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300025928|Ga0207700_11144274 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300026014|Ga0208776_1009158 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300026335|Ga0209804_1203329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300026527|Ga0209059_1334186 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300026528|Ga0209378_1102564 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300027064|Ga0208724_1006971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1054 | Open in IMG/M |
| 3300027545|Ga0209008_1095566 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300027609|Ga0209221_1160637 | Not Available | 555 | Open in IMG/M |
| 3300027652|Ga0209007_1000632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 12313 | Open in IMG/M |
| 3300027674|Ga0209118_1195906 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300027681|Ga0208991_1014112 | All Organisms → cellular organisms → Bacteria | 2396 | Open in IMG/M |
| 3300027738|Ga0208989_10187178 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300027821|Ga0209811_10439443 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300027826|Ga0209060_10475588 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300027826|Ga0209060_10491112 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300027829|Ga0209773_10304613 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300027842|Ga0209580_10043990 | All Organisms → cellular organisms → Bacteria | 2065 | Open in IMG/M |
| 3300027842|Ga0209580_10437193 | Not Available | 652 | Open in IMG/M |
| 3300027842|Ga0209580_10639653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300027853|Ga0209274_10646805 | Not Available | 546 | Open in IMG/M |
| 3300027867|Ga0209167_10603366 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300027869|Ga0209579_10043211 | All Organisms → cellular organisms → Bacteria | 2418 | Open in IMG/M |
| 3300027898|Ga0209067_10716005 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300027903|Ga0209488_10695551 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300028746|Ga0302233_10282998 | Not Available | 628 | Open in IMG/M |
| 3300028775|Ga0302231_10477114 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300028800|Ga0265338_10344260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1073 | Open in IMG/M |
| 3300028906|Ga0308309_11612908 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300029636|Ga0222749_10400915 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300030007|Ga0311338_10457234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1352 | Open in IMG/M |
| 3300030042|Ga0302300_1236231 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300030743|Ga0265461_12979604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300030917|Ga0075382_11141425 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300031090|Ga0265760_10160607 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300031231|Ga0170824_110458975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 956 | Open in IMG/M |
| 3300031242|Ga0265329_10231598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 613 | Open in IMG/M |
| 3300031474|Ga0170818_104921151 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1146 | Open in IMG/M |
| 3300031474|Ga0170818_105868014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 724 | Open in IMG/M |
| 3300031708|Ga0310686_111108345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 536 | Open in IMG/M |
| 3300031708|Ga0310686_117161652 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300031715|Ga0307476_10618118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 803 | Open in IMG/M |
| 3300031718|Ga0307474_11031294 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031754|Ga0307475_10881433 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300031754|Ga0307475_10940115 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300031754|Ga0307475_11312242 | Not Available | 560 | Open in IMG/M |
| 3300032205|Ga0307472_100606729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 967 | Open in IMG/M |
| 3300032828|Ga0335080_12207406 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300032897|Ga0335071_10005549 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 13089 | Open in IMG/M |
| 3300032955|Ga0335076_11111521 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.49% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 9.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.56% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.56% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.76% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.17% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.17% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.38% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.38% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.38% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.38% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.59% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.59% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.59% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.59% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.79% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.79% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026014 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_205 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300027064 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF003 (SPAdes) | Environmental | Open in IMG/M |
| 3300027545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300030917 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| A_all_C_01781810 | 2140918007 | Soil | EYGLCRLAEHAVKPGASAVSIVDHVRSFVNGSSLRDDASVVFVGVGR |
| INPhiseqgaiiFebDRAFT_1050670872 | 3300000364 | Soil | VNPQEEEFGLCRLAEHAISSNASAVTIVDEVRTFANGNGVRDDASVVFLRAGV* |
| Ga0062385_109785911 | 3300004080 | Bog Forest Soil | LRRLAEHAVKPGASAVTIVDDVRSFANASGVRDDASVVFVGVGH* |
| Ga0063454_1013120922 | 3300004081 | Soil | SRLAQHAVKPEASAVSIVDEVRLYANGSGVRDDATVVFIGAGN* |
| Ga0062389_1025674482 | 3300004092 | Bog Forest Soil | YGLERLAEHAVSAEASAVTIVDDVRGFANGAPVRDDATVVFVGVKR* |
| Ga0062388_1019975062 | 3300004635 | Bog Forest Soil | EAEDANGEEFGLRRLAEHAVKPGASAVTIVDDVRSFANASGVRDDASVVFVGVGH* |
| Ga0070714_1007811681 | 3300005435 | Agricultural Soil | GACRLAEHAVKQGASAVTLVDEVRLFANGAGVRDDASAVFVSTVV* |
| Ga0070698_1002243851 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | RLAEHAARPGSSAVSIVDDVRSFVNGANLRDDASVVFVGVGR* |
| Ga0073909_107078051 | 3300005526 | Surface Soil | LAKHAVKPGSSAVSIVDDVRSFVSGANLHDDASVVFVGVGR* |
| Ga0070731_106247382 | 3300005538 | Surface Soil | AENANQEEYGLCRLAEHAIRTDASAVSIVDEVRSYANGSGVRDDASVVFVGVNR* |
| Ga0070733_103760273 | 3300005541 | Surface Soil | EAENTNEEEYGVCRLAEHAIKTGASAVSIVDDVRSFSSGTNLCDDATVVFVGVS* |
| Ga0070732_102762973 | 3300005542 | Surface Soil | VEHAVQPNASALTILDDVRSFANGSGVHDDATVVFVGVNA* |
| Ga0066661_108361011 | 3300005554 | Soil | KPGASAVSIVDDVRNYVNGSRLHDDASVVFVGRALTN* |
| Ga0066707_106282381 | 3300005556 | Soil | AEHAGKPGASAVSIVDDVRNYVNGSRLHDDASVVFVGRALTN* |
| Ga0070762_111580501 | 3300005602 | Soil | YGLSRLAEHAVKPGASAVSIIDEVRSYANGSGVRDDATAVFVTVTG* |
| Ga0066903_1028271841 | 3300005764 | Tropical Forest Soil | DANEEEYGLCRLVEHAIRPGTSAVSIIDEVRAFANGTGVRDDASVVFIGTGA* |
| Ga0066790_103464902 | 3300005995 | Soil | GLCRLAEHAAKSSASAVSIIDDVRAFANGAGVRDDASVVFVGVAN* |
| Ga0070717_101454674 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LCRLADHAVRTEASAVSIIDEVRAFANGTGVRDDASVVFVGVGR* |
| Ga0075029_1007589041 | 3300006052 | Watersheds | HAVSAGASAVSLVDEVRSFANGAGVRDDASAVFIAVGD* |
| Ga0075019_106749982 | 3300006086 | Watersheds | VNGNEEEYGLRRLAEHAVRLGASAVSLVDEVRSFADGAGVPDDASAVFIAVGN* |
| Ga0070715_101792533 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | EHAVKQGASAVTLVDEVRLFANGAGVRDDASAVFVSTVV* |
| Ga0066659_110392931 | 3300006797 | Soil | SRDEEFGLTRLAEHAGKPGASAVSIVDDVRNYVNGSRLHDDASVVFVGRALTN* |
| Ga0079219_122478611 | 3300006954 | Agricultural Soil | VPSREHAIRPDASAVSIIDEVRAFANGTGVRDDASVVFIG |
| Ga0099829_111129411 | 3300009038 | Vadose Zone Soil | HEYGLERLAEHAIGPLASAVSIVDDVRAFANGSCLRDDATVVFVGVGR* |
| Ga0099827_115105892 | 3300009090 | Vadose Zone Soil | EDHEYGLERLAEHAIGPLASAVSIVDDVRAFANGSCLRDDATVVFVGVGR* |
| Ga0116222_10851781 | 3300009521 | Peatlands Soil | EYGLDRLSELAMKPEASVIDIADDVRAFANGAGVRDDASIVLVHVGRPS* |
| Ga0105238_124750632 | 3300009551 | Corn Rhizosphere | SDASALTILDDVRSFANGSGVHDDATVVFVGVNP* |
| Ga0126373_124389502 | 3300010048 | Tropical Forest Soil | EYGAYRLVEHAVKQGTSAVTLVDEVRTFANGGGVSDDASAVFVSTAA* |
| Ga0074044_108001142 | 3300010343 | Bog Forest Soil | DEQEYGLERLAEHAAGTGASAVTIVDDVRSFANGSGVRDDATVVFVGVRR* |
| Ga0126376_100042291 | 3300010359 | Tropical Forest Soil | LCRLVEHAIRPGTSAVSIIDEVRAFANGTGVRDDASVVFIGVGAE* |
| Ga0126372_108920391 | 3300010360 | Tropical Forest Soil | DEEYGACRLAEHAAKAGASAVSLVDEVRSFANGAGVRDDASAVFVSTAA* |
| Ga0126378_134075032 | 3300010361 | Tropical Forest Soil | CRLVEHAIRPDTSAVSIIDEVRAFANGTGVRDDASVVFVGVGA* |
| Ga0126381_1049514602 | 3300010376 | Tropical Forest Soil | EEYGMCRLVEHAIKPEASAMSMVDEVQSFADGSGVRDDASVVFVGVTR* |
| Ga0136449_1045995581 | 3300010379 | Peatlands Soil | RLAEHATKPGASAVSIVDDVRLFANGAGVRDDASVVFVGVGR* |
| Ga0137392_100309701 | 3300011269 | Vadose Zone Soil | EEYGLERLAAHAVCKEASAVSIVDDVRAFSNGAGVRDDASVVFLGVKR* |
| Ga0137399_107618773 | 3300012203 | Vadose Zone Soil | RLAAHAVCKEASAVSIVDDVRAFSNGAGVRDDASVVFLGVKR* |
| Ga0137377_115015961 | 3300012211 | Vadose Zone Soil | SEEEYGLGRLAEHAVQPGASAVSIVDDVRSFANGNGVRDDASVVFLGVGR* |
| Ga0137390_101292715 | 3300012363 | Vadose Zone Soil | ERLAEHAIGPLASAVSIVDDVRAFANGSCLRDDATVVFVGVGR* |
| Ga0137398_111183651 | 3300012683 | Vadose Zone Soil | QEYGLARLAEHAVHPTASAVTIVDDVRAFANGSGVRDDATVVFVGVGR* |
| Ga0137394_113997481 | 3300012922 | Vadose Zone Soil | EHAGKPGASAVSLVDDVRNYVNGSRLHDDASVVFVGRTLTN* |
| Ga0137359_115230791 | 3300012923 | Vadose Zone Soil | AHAVCPEASAVSIVDDVRAFSNGAGVRDDASVVFLGVKR* |
| Ga0126369_101843374 | 3300012971 | Tropical Forest Soil | RPDTSAVSIIDEVRAFANGTGVRDDASVVFIGVGT* |
| Ga0181537_104751073 | 3300014201 | Bog | TEAVDADEQEYGLERLAEHAVSAEASAVSIVDNVREFANGTGVRDDATVVFVGVKR* |
| Ga0181522_102227792 | 3300014657 | Bog | CRLAEHAIRPDASAVSIVDEVRTYANGSGVRDDASVVFVGVNR* |
| Ga0182007_102676492 | 3300015262 | Rhizosphere | GLSRLVEHAVSPDASAVTIVEDVRSFANGSGVRDDASVVFLGVR* |
| Ga0137403_104798753 | 3300015264 | Vadose Zone Soil | EEYGLCRLAEHSVRPGSSAVSIIDDVRSFANENGVRDDTSVVFVGVS* |
| Ga0182005_10453871 | 3300015265 | Rhizosphere | LVEHAVSPDASAVTIVEDVRSFANGSGVRDDASVVFLGVR* |
| Ga0132257_1012737212 | 3300015373 | Arabidopsis Rhizosphere | AENGNEEEYGASRLAEHVVKTGASAVSLVDEVRSFANGAGVRDDASAVFISVA* |
| Ga0132255_1002108811 | 3300015374 | Arabidopsis Rhizosphere | ENGNEEEYGASRLAEHVVKPGASAVSLVDEVRSFANGAGVRDDASAVFIAVGN* |
| Ga0132255_1011386771 | 3300015374 | Arabidopsis Rhizosphere | ENGNEEEYGASRLAEHVVKPGASAVSLVDEVRSFANGAGVRDDASAVFISVA* |
| Ga0182035_112208391 | 3300016341 | Soil | EYGAFRLVEHAAKPGASAVSLVDEVRSYANGAGVRDDASAVFVSTAA |
| Ga0182037_101577471 | 3300016404 | Soil | AVDGNDEESAADRLVKHAVKQGTSAVTLVDEVRSYANGGGVSDDASAVFIGVGN |
| Ga0187820_12383231 | 3300017924 | Freshwater Sediment | AENASGEEYGLSRIAAHAAKAGSSAVSIVDDVRSFVNGANLRDDASVVFVGVGR |
| Ga0187782_108460203 | 3300017975 | Tropical Peatland | CRLVEHAIRPDASAVSIVDEVQSYSNEAGVRDDASVVFVGVTR |
| Ga0187804_100638601 | 3300018006 | Freshwater Sediment | KAENSNSEEYGLCRLAEHAVKPGASAVSIVDNVRSFANGSSLRDDASVVFVGVGR |
| Ga0187863_107167801 | 3300018034 | Peatland | PERLAEHAAQPGASAISIVDDVRAFANGAGVRDDASVVFVGVGTRNLA |
| Ga0187771_100398313 | 3300018088 | Tropical Peatland | VEDAIKPGASAVSIIDQVRSFANGSGVRDDASVVFLALNP |
| Ga0187770_109862031 | 3300018090 | Tropical Peatland | SPAATALSIVDNVRSFANGSPLRDDASVVFVGVGR |
| Ga0210401_101802911 | 3300020583 | Soil | EEEYGLDRLAQHVSRSDASAVTIVDDVRAFANGSGVSDDATVVFVGVGR |
| Ga0210396_116948772 | 3300021180 | Soil | AEHAVKPEASAVSIVEDVRSFVSGSSLRDDASVVFVGVGR |
| Ga0210388_112602741 | 3300021181 | Soil | LDRLARHVSNQGTSAVSIVDDVRAFANGAGFRDDATVVFVGVGA |
| Ga0210393_116674201 | 3300021401 | Soil | RLAEHAIKPDASAVSIIDEVRSFANGSGVRDDASVVFMGVGN |
| Ga0210393_116809682 | 3300021401 | Soil | GDEYGPCRLAEHAAHAGASALSIVDDVRSFANGAGVRDDASVVFVGVGR |
| Ga0210389_101952801 | 3300021404 | Soil | EEYGACRLAEHAIEPGASAVSLVDEVRSFANGAGVPDDASAVFIAVGN |
| Ga0210394_104791081 | 3300021420 | Soil | RLSEHAAKPGASAISIVDDVRAFANGAGVRDDASVVFVGVGARNSA |
| Ga0210394_105338711 | 3300021420 | Soil | NQREEEYGLDRLAQHVSRSHASAVTIVDDVRAYANGSGVSDDATVVFVGVGR |
| Ga0210384_113482732 | 3300021432 | Soil | SQEEYGLNRLSAHAAKSGSSAVTIVDDVRSFASGGSLLDDASVVFVGVGR |
| Ga0210391_101959061 | 3300021433 | Soil | EAVNADEQEYGLERLAEHAVSAGASAVSIVDNVREFANGSGVRDDATVVFVGVKR |
| Ga0210391_105964943 | 3300021433 | Soil | GVEASAVSIVDDVRGFANGSGVRDDATVVFVGVKS |
| Ga0210392_100410645 | 3300021475 | Soil | AKSGSSAVTIVDDVRRFASGGSLLDDASVVFVGVGR |
| Ga0210392_109940561 | 3300021475 | Soil | RLAHAVSPQASALSIADDVQTFTSGATLLDDASVVFIGACP |
| Ga0242663_11460941 | 3300022523 | Soil | NGNGEEYGACRLAEHAIEPGASAVSLVDEVRSFATGAGVPDDASAVFIAVGN |
| Ga0212123_100774775 | 3300022557 | Iron-Sulfur Acid Spring | AVKPGSSAVSIEDDVRAFTHGSNLRDDASVVFVGVAR |
| Ga0212123_107073431 | 3300022557 | Iron-Sulfur Acid Spring | EYGLCRLAQHAAIAGSSAVSIVDDVRSFTQGSSLLDDASVVFVGMGR |
| Ga0224563_10036171 | 3300022731 | Soil | EEEYGPERLSEHAAKPGASAISIVDDVRAFANGAGVRDDASVVFVGVGARNSA |
| Ga0207685_107311262 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | RLAEHAVKPGASAVSLVDEVRSFANGAGVRDDASAVFIAVG |
| Ga0207663_113201371 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AIHPEASAVSIIDEVRSYANGAGVRDDASVVFVGVSR |
| Ga0207700_111442743 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | RLAEHAILPEASALSIVDDVQSFSNGAGVRDDASVVFIGVQR |
| Ga0208776_10091583 | 3300026014 | Rice Paddy Soil | GLTRLVEHAITPEASAVTIVEDVRSFANGSGVRDDASVVFLGVH |
| Ga0209804_12033291 | 3300026335 | Soil | AENGNEQEYGACRLAEHAVKPGASAVSLVDEVRSFANGAGVRDDASAVFIAVG |
| Ga0209059_13341862 | 3300026527 | Soil | AHAVRPEASAVSIVDEVRSFANGSGVRDDASVVFVGVAR |
| Ga0209378_11025643 | 3300026528 | Soil | LAEHAGKPGASAVSIVDDVRNYVNGSRLHDDASVVFVGRALTN |
| Ga0208724_10069713 | 3300027064 | Forest Soil | HAAKPGASAISIVDDVRAFANGAGVRDDASVVFVGVGARNSA |
| Ga0209008_10955661 | 3300027545 | Forest Soil | EAVNADEQEYGLERLAEHAVGADASAVSIVDDVRGFANGSGVRDDATVVFVGVKR |
| Ga0209221_11606371 | 3300027609 | Forest Soil | AEHVAKPGASAISIVDDVRAFANGAGVRDDASVVFIGVGARTLA |
| Ga0209007_100063217 | 3300027652 | Forest Soil | TEAENANQEEYGLCRLAEHAIRPDASAVSIVDEVRSYANGSGVRDDASVVFVGVNR |
| Ga0209118_11959061 | 3300027674 | Forest Soil | AENANGEDYGLCRLAEHAARAGASAVSIEDDVRSFTNGSSVCDDASVVFVGVGR |
| Ga0208991_10141121 | 3300027681 | Forest Soil | AAHTMCPEASAVSIVDDVRAFSNGAGVRDDASVVFLGVKR |
| Ga0208989_101871783 | 3300027738 | Forest Soil | HTMCPEASAVSIVDDVRAFSNGAGVRDDASVVFLGVKR |
| Ga0209811_104394432 | 3300027821 | Surface Soil | LAKHAVKPGSSAVSIVDDVRSFVSGANLHDDASVVFVGVGR |
| Ga0209060_104755882 | 3300027826 | Surface Soil | GLCRLAEHAIKPDASAVSIVDQVRSFANGAGVRDDASVVFLSTASVAANSVAA |
| Ga0209060_104911122 | 3300027826 | Surface Soil | HAIKPDASAVSIVDDVRSFANGNGVRDDATVVFIGVNR |
| Ga0209773_103046131 | 3300027829 | Bog Forest Soil | YGLERLAEHAVSAEASAVTIVDDVRGFANGAPVRDDATVVFVGVKR |
| Ga0209580_100439901 | 3300027842 | Surface Soil | AQSMCPAASALSIIDDVRAFANDAVLSDDTSVVFVGVNG |
| Ga0209580_104371931 | 3300027842 | Surface Soil | MTPNASAVSIIDEVRSFANGSGVRDDASVVFMGVGN |
| Ga0209580_106396532 | 3300027842 | Surface Soil | EAVNENEEEYGLERLAAHAAQPGASAISIADDVRSFANGAGVRDDASVVFVGVGR |
| Ga0209274_106468051 | 3300027853 | Soil | EEYGPERLSEHAAKPGASAISIVDDVRAFANGAGVRDDASVVFVGVGARHSA |
| Ga0209167_106033661 | 3300027867 | Surface Soil | CPAASAVSIIDDVRAYANGSGVRDDASVVFVGVSR |
| Ga0209579_100432114 | 3300027869 | Surface Soil | SSPQASAVSVLDDVRGFAEGVLLHDDATVVFVKASS |
| Ga0209067_107160051 | 3300027898 | Watersheds | EYGLRRLAEHAVRLGASAVSLVDEVRSFADGAGVPDDASAVFIAVGN |
| Ga0209488_106955511 | 3300027903 | Vadose Zone Soil | LDRLAEHAVSAGASAISIVDDVRAFANGSGVRDDATVVFVGVGR |
| Ga0302233_102829982 | 3300028746 | Palsa | HAAKAGASAISIVDDVRAFANGAGVRDDASVVFVGVGARNSA |
| Ga0302231_104771141 | 3300028775 | Palsa | EHAASPAASAVSIIDDVRAFANSSGVRDDATVVFLGVGR |
| Ga0265338_103442601 | 3300028800 | Rhizosphere | RLAEHAVKAGASAVSIVDNVRSFVNGSSLRDDASVVFVGVGH |
| Ga0308309_116129081 | 3300028906 | Soil | CRLAEHAVKPGASAVSLVDEVRSFANGAGVRDDASAVFIAVGN |
| Ga0222749_104009151 | 3300029636 | Soil | RLAEHAACPEASAVSIVDDVRGFANRSGVRDDATVVFVGVGR |
| Ga0311338_104572341 | 3300030007 | Palsa | EAEEEYGLDRLAGHVAGGDASAVSIVDDVRAFANGSGVRDDATVVFVGVKR |
| Ga0302300_12362311 | 3300030042 | Palsa | LGRLAEHAERAGASAVSIIDDVRTFANGTGVRDDATVVFVGVGH |
| Ga0265461_129796042 | 3300030743 | Soil | EAVDAKEEEYGPERLSEHAARPGASAISIVDDVRAFANGAGVRDDASVVFVGVGARNSA |
| Ga0075382_111414252 | 3300030917 | Soil | LCRLAEHAAKPGSSAVSIVDDVRTFANGSGVRDDATVVFVGVGRLI |
| Ga0265760_101606071 | 3300031090 | Soil | RLAAHAAMPNASAISIVEDVRAFANGAGVRDDASVVFVGVGANLA |
| Ga0170824_1104589753 | 3300031231 | Forest Soil | LERLAEHAVGPSASAVSIVDDVRAFSNGSGVRDDATVVFVGVGR |
| Ga0265329_102315981 | 3300031242 | Rhizosphere | VKPGASAVSIVDHVRSFVNGSSLRDDASVVFVGVGR |
| Ga0170818_1049211511 | 3300031474 | Forest Soil | LLNGNEEEYGACRLAEHAVKPGASAVSLVDEVRSFANGAGVRDDASAVFIAVG |
| Ga0170818_1058680141 | 3300031474 | Forest Soil | EEYGLCRLAEHAAKSGASAVSIVDDVRMFANGSGVRDDATVVFVGVGRSEFHA |
| Ga0310686_1111083451 | 3300031708 | Soil | NASEEEYGACRLAEHAVKPGASAVSIVDDVRSFANGSGVRDDASVVFVGVGR |
| Ga0310686_1171616521 | 3300031708 | Soil | EDANGEEFGLRRLAEHAVKPGASAVTIVDDVRSFANASGVRDDASVVFVGVGR |
| Ga0307476_106181182 | 3300031715 | Hardwood Forest Soil | AQEQEYGLERLAEHAAGAEASAVTIVDDVRGFANGSGVRDDATVVFVGVKR |
| Ga0307474_110312941 | 3300031718 | Hardwood Forest Soil | AEHAAGGEASAVTIVDDVRGFANGSGVRDDATVVFVGVKQ |
| Ga0307475_108814333 | 3300031754 | Hardwood Forest Soil | YGLQRLAAHAAQTGASAVSIVDDVRAFSNGAGVRDDATVVFVGVGR |
| Ga0307475_109401152 | 3300031754 | Hardwood Forest Soil | ERLVRHALSTGASAVSIVEDVRTFANGYGVRDDATVVFVGVGR |
| Ga0307475_113122422 | 3300031754 | Hardwood Forest Soil | ERLAEHTAKPGASAISIVDDVRAFANGAGIRDDASVVFVGVGVRDLA |
| Ga0307472_1006067291 | 3300032205 | Hardwood Forest Soil | DQEYGLQRLAAHAAQTGASAVSIVDDVRAFSNGAGVRDDATVVFVGVGR |
| Ga0335080_122074062 | 3300032828 | Soil | SAPGASALSIVDDVRSFANGAGVRDDASVVFVGVTG |
| Ga0335071_1000554917 | 3300032897 | Soil | VDEAEEEYGLCRLAEHAASADASAFSIIDDVRSFANRTGVRDDASVVFVGVNR |
| Ga0335076_111115211 | 3300032955 | Soil | IPDASAVSIIDEVRSYANGSGVRDDASVVFMGVNR |
| ⦗Top⦘ |