Basic Information | |
---|---|
Family ID | F067145 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 126 |
Average Sequence Length | 43 residues |
Representative Sequence | PADRGRVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Number of Associated Samples | 121 |
Number of Associated Scaffolds | 126 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.59 % |
% of genes near scaffold ends (potentially truncated) | 97.62 % |
% of genes from short scaffolds (< 2000 bps) | 86.51 % |
Associated GOLD sequencing projects | 113 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (65.873 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.254 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.857 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.794 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.90% β-sheet: 0.00% Coil/Unstructured: 79.10% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 126 Family Scaffolds |
---|---|---|
PF02811 | PHP | 22.22 |
PF03786 | UxuA | 10.32 |
PF07733 | DNA_pol3_alpha | 8.73 |
PF00903 | Glyoxalase | 7.94 |
PF00441 | Acyl-CoA_dh_1 | 7.14 |
PF02771 | Acyl-CoA_dh_N | 4.76 |
PF12681 | Glyoxalase_2 | 3.17 |
PF01557 | FAA_hydrolase | 2.38 |
PF12802 | MarR_2 | 2.38 |
PF02770 | Acyl-CoA_dh_M | 1.59 |
PF08386 | Abhydrolase_4 | 1.59 |
PF14579 | HHH_6 | 1.59 |
PF07167 | PhaC_N | 0.79 |
PF13359 | DDE_Tnp_4 | 0.79 |
PF13556 | HTH_30 | 0.79 |
PF09900 | DUF2127 | 0.79 |
PF12535 | Nudix_N | 0.79 |
PF06081 | ArAE_1 | 0.79 |
PF03633 | Glyco_hydro_65C | 0.79 |
PF13469 | Sulfotransfer_3 | 0.79 |
PF07883 | Cupin_2 | 0.79 |
PF02021 | UPF0102 | 0.79 |
PF03793 | PASTA | 0.79 |
COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
---|---|---|---|
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 13.49 |
COG1312 | D-mannonate dehydratase | Carbohydrate transport and metabolism [G] | 10.32 |
COG0587 | DNA polymerase III, alpha subunit | Replication, recombination and repair [L] | 8.73 |
COG2176 | DNA polymerase III, alpha subunit (gram-positive type) | Replication, recombination and repair [L] | 8.73 |
COG0792 | Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family | Replication, recombination and repair [L] | 0.79 |
COG1554 | Phosphatase/phosphodiesterase/kojibiose phosphorylase YcjT/PafA/Npp1, AlkP superfamily | Carbohydrate transport and metabolism [G] | 0.79 |
COG3243 | Poly-beta-hydroxybutyrate synthase | Lipid transport and metabolism [I] | 0.79 |
COG4129 | Uncharacterized membrane protein YgaE, UPF0421/DUF939 family | Function unknown [S] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 65.87 % |
Unclassified | root | N/A | 34.13 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001431|F14TB_103439089 | Not Available | 696 | Open in IMG/M |
3300002075|JGI24738J21930_10138045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 537 | Open in IMG/M |
3300005335|Ga0070666_10870018 | Not Available | 665 | Open in IMG/M |
3300005337|Ga0070682_101215862 | Not Available | 636 | Open in IMG/M |
3300005339|Ga0070660_101566181 | Not Available | 561 | Open in IMG/M |
3300005347|Ga0070668_100220309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1565 | Open in IMG/M |
3300005356|Ga0070674_101132775 | Not Available | 692 | Open in IMG/M |
3300005437|Ga0070710_10669330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 729 | Open in IMG/M |
3300005457|Ga0070662_100029075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3854 | Open in IMG/M |
3300005543|Ga0070672_100590426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 967 | Open in IMG/M |
3300005544|Ga0070686_100014401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 4560 | Open in IMG/M |
3300005574|Ga0066694_10446124 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300005577|Ga0068857_100047498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → Nakamurella lactea | 3811 | Open in IMG/M |
3300005764|Ga0066903_108569121 | Not Available | 521 | Open in IMG/M |
3300006163|Ga0070715_10690272 | Not Available | 608 | Open in IMG/M |
3300006163|Ga0070715_10884726 | Not Available | 548 | Open in IMG/M |
3300006237|Ga0097621_100075554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2793 | Open in IMG/M |
3300006573|Ga0074055_11433138 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
3300006575|Ga0074053_11988428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1002 | Open in IMG/M |
3300006797|Ga0066659_11743994 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 526 | Open in IMG/M |
3300006804|Ga0079221_10453474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 815 | Open in IMG/M |
3300006806|Ga0079220_10073005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1697 | Open in IMG/M |
3300006852|Ga0075433_10834657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
3300006871|Ga0075434_102563907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
3300009011|Ga0105251_10012339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4838 | Open in IMG/M |
3300009036|Ga0105244_10136564 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
3300009098|Ga0105245_10795598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 983 | Open in IMG/M |
3300009162|Ga0075423_12496941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 564 | Open in IMG/M |
3300009177|Ga0105248_11982012 | Not Available | 661 | Open in IMG/M |
3300009545|Ga0105237_11999870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 588 | Open in IMG/M |
3300009553|Ga0105249_10509299 | All Organisms → cellular organisms → Bacteria | 1250 | Open in IMG/M |
3300010329|Ga0134111_10149474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 923 | Open in IMG/M |
3300010359|Ga0126376_10764061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 939 | Open in IMG/M |
3300010362|Ga0126377_12672139 | Not Available | 574 | Open in IMG/M |
3300010375|Ga0105239_11916580 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
3300010376|Ga0126381_101492002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 977 | Open in IMG/M |
3300010396|Ga0134126_13054705 | Not Available | 505 | Open in IMG/M |
3300010398|Ga0126383_11452440 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300010399|Ga0134127_12495786 | Not Available | 597 | Open in IMG/M |
3300012203|Ga0137399_10265090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1412 | Open in IMG/M |
3300012210|Ga0137378_10291758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1517 | Open in IMG/M |
3300012353|Ga0137367_10483350 | Not Available | 873 | Open in IMG/M |
3300012359|Ga0137385_10017145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6456 | Open in IMG/M |
3300012360|Ga0137375_10312999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1413 | Open in IMG/M |
3300012492|Ga0157335_1002992 | Not Available | 1056 | Open in IMG/M |
3300012957|Ga0164303_11466224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
3300012958|Ga0164299_10051982 | All Organisms → cellular organisms → Bacteria | 1920 | Open in IMG/M |
3300012961|Ga0164302_10906341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 677 | Open in IMG/M |
3300013102|Ga0157371_10248905 | Not Available | 1279 | Open in IMG/M |
3300013104|Ga0157370_11993867 | Not Available | 520 | Open in IMG/M |
3300013105|Ga0157369_11741250 | Not Available | 633 | Open in IMG/M |
3300013296|Ga0157374_11490480 | Not Available | 700 | Open in IMG/M |
3300013307|Ga0157372_11026098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 955 | Open in IMG/M |
3300014325|Ga0163163_10596140 | Not Available | 1168 | Open in IMG/M |
3300015264|Ga0137403_10144152 | Not Available | 2352 | Open in IMG/M |
3300015371|Ga0132258_10611683 | Not Available | 2736 | Open in IMG/M |
3300015373|Ga0132257_102023136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. Ae717_Ps2 | 743 | Open in IMG/M |
3300015373|Ga0132257_102573522 | Not Available | 662 | Open in IMG/M |
3300015374|Ga0132255_102451423 | Not Available | 797 | Open in IMG/M |
3300016294|Ga0182041_11178025 | Not Available | 698 | Open in IMG/M |
3300017792|Ga0163161_10239063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1412 | Open in IMG/M |
3300017947|Ga0187785_10622172 | Not Available | 557 | Open in IMG/M |
3300020140|Ga0179590_1031916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1299 | Open in IMG/M |
3300020579|Ga0210407_10387649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1093 | Open in IMG/M |
3300020581|Ga0210399_11459400 | Not Available | 532 | Open in IMG/M |
3300021178|Ga0210408_10155221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1813 | Open in IMG/M |
3300021403|Ga0210397_10128335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1748 | Open in IMG/M |
3300021403|Ga0210397_10293810 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1191 | Open in IMG/M |
3300021404|Ga0210389_10705722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 790 | Open in IMG/M |
3300021478|Ga0210402_10470321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1167 | Open in IMG/M |
3300021560|Ga0126371_11997730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 697 | Open in IMG/M |
3300024325|Ga0247678_1003443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2113 | Open in IMG/M |
3300025735|Ga0207713_1134725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 813 | Open in IMG/M |
3300025898|Ga0207692_10028050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2658 | Open in IMG/M |
3300025899|Ga0207642_10040417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2035 | Open in IMG/M |
3300025904|Ga0207647_10032275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3366 | Open in IMG/M |
3300025907|Ga0207645_10174035 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1411 | Open in IMG/M |
3300025914|Ga0207671_10409816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1078 | Open in IMG/M |
3300025917|Ga0207660_10342172 | Not Available | 1197 | Open in IMG/M |
3300025918|Ga0207662_10909343 | Not Available | 623 | Open in IMG/M |
3300025926|Ga0207659_10599096 | Not Available | 939 | Open in IMG/M |
3300025932|Ga0207690_10186077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1567 | Open in IMG/M |
3300025933|Ga0207706_10031186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4750 | Open in IMG/M |
3300025934|Ga0207686_11411402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 573 | Open in IMG/M |
3300025935|Ga0207709_11089444 | Not Available | 656 | Open in IMG/M |
3300025936|Ga0207670_10389800 | Not Available | 1111 | Open in IMG/M |
3300025940|Ga0207691_10025646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5533 | Open in IMG/M |
3300025940|Ga0207691_10221873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1639 | Open in IMG/M |
3300025960|Ga0207651_10179217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1679 | Open in IMG/M |
3300025961|Ga0207712_11098561 | Not Available | 708 | Open in IMG/M |
3300025981|Ga0207640_11382857 | Not Available | 630 | Open in IMG/M |
3300026088|Ga0207641_10032137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4357 | Open in IMG/M |
3300026089|Ga0207648_10066461 | All Organisms → cellular organisms → Bacteria | 3144 | Open in IMG/M |
3300026475|Ga0257147_1007808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1372 | Open in IMG/M |
3300026538|Ga0209056_10431316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 775 | Open in IMG/M |
3300027371|Ga0209418_1029071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 951 | Open in IMG/M |
3300027884|Ga0209275_10446346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 733 | Open in IMG/M |
3300028138|Ga0247684_1006695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1804 | Open in IMG/M |
3300028138|Ga0247684_1073733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 562 | Open in IMG/M |
3300028711|Ga0307293_10056595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1222 | Open in IMG/M |
3300028881|Ga0307277_10032144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2093 | Open in IMG/M |
3300028906|Ga0308309_11183616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 659 | Open in IMG/M |
3300030730|Ga0307482_1180296 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 632 | Open in IMG/M |
3300031564|Ga0318573_10060491 | Not Available | 1871 | Open in IMG/M |
3300031640|Ga0318555_10131391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1335 | Open in IMG/M |
3300031668|Ga0318542_10358171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 751 | Open in IMG/M |
3300031718|Ga0307474_10679557 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 813 | Open in IMG/M |
3300031720|Ga0307469_10898877 | All Organisms → cellular organisms → Bacteria → Spirochaetes → Spirochaetia → Spirochaetales → Treponemataceae → Treponema → unclassified Treponema → Treponema sp. | 820 | Open in IMG/M |
3300031724|Ga0318500_10203579 | Not Available | 949 | Open in IMG/M |
3300031740|Ga0307468_100281425 | Not Available | 1194 | Open in IMG/M |
3300031771|Ga0318546_11207993 | Not Available | 531 | Open in IMG/M |
3300031796|Ga0318576_10082580 | Not Available | 1446 | Open in IMG/M |
3300031799|Ga0318565_10122691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1254 | Open in IMG/M |
3300031835|Ga0318517_10424913 | Not Available | 600 | Open in IMG/M |
3300031890|Ga0306925_11821495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
3300031942|Ga0310916_10990761 | Not Available | 702 | Open in IMG/M |
3300031954|Ga0306926_11180754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 900 | Open in IMG/M |
3300032039|Ga0318559_10317500 | Not Available | 724 | Open in IMG/M |
3300032044|Ga0318558_10176788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1035 | Open in IMG/M |
3300032068|Ga0318553_10348462 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 775 | Open in IMG/M |
3300032783|Ga0335079_10430046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1418 | Open in IMG/M |
3300032892|Ga0335081_10927274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1023 | Open in IMG/M |
3300032893|Ga0335069_12040467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 603 | Open in IMG/M |
3300032954|Ga0335083_10302484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1405 | Open in IMG/M |
3300033004|Ga0335084_11559546 | Not Available | 652 | Open in IMG/M |
3300033134|Ga0335073_11263110 | Not Available | 734 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.25% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.56% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.76% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 4.76% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.97% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 3.97% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.17% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.17% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.17% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.17% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.17% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.17% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.38% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.38% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.38% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.38% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.38% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.59% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.59% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.59% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.59% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.59% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.59% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.79% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.79% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.79% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.79% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.79% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.79% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Host-Associated | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
F14TB_1034390891 | 3300001431 | Soil | EQDGAPVNWGRVTVYEPEDCDERYRQYLEHAPRHTGPTLIPIQV* |
JGI24738J21930_101380451 | 3300002075 | Corn Rhizosphere | MATQQTDRGRVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV* |
Ga0070666_108700182 | 3300005335 | Switchgrass Rhizosphere | KTREEREQAQDDDPADRGRVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV* |
Ga0070682_1012158621 | 3300005337 | Corn Rhizosphere | TRQERARDQDGEPAARGRVTVYEPEDCDERYRQYLEHTPRYTGPTLIPIQV* |
Ga0070660_1015661812 | 3300005339 | Corn Rhizosphere | RDQDGEPAARGRVTVYEPEDCDERYRQYLEHTPRYTGPTLIPIQV* |
Ga0070668_1002203091 | 3300005347 | Switchgrass Rhizosphere | AQDGDPADRGRVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV* |
Ga0070674_1011327752 | 3300005356 | Miscanthus Rhizosphere | ARTRQERARDQDGEPAARGRVTVYEPEDCDERYRQYLEHAPRYTGPTLIPIQV* |
Ga0070710_106693301 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | DPAARGRVTIYEPEDCDARWRQHLERTPRRYTGPTLIPIQV* |
Ga0070662_1000290751 | 3300005457 | Corn Rhizosphere | QDGDPADRGRVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV* |
Ga0070672_1005904261 | 3300005543 | Miscanthus Rhizosphere | DGDPADRGRVTIYEPEDWPERYRQYCEHTPRRTGPTLIPIQV* |
Ga0070686_1000144011 | 3300005544 | Switchgrass Rhizosphere | QDDDPADRGRVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV* |
Ga0066694_104461242 | 3300005574 | Soil | VPLSPQEPEPDDAPANRGRVTIYEPEDCDERYRQYLEQAPRYTGPKLIPIQV* |
Ga0068857_1000474985 | 3300005577 | Corn Rhizosphere | ADRGRVTIYEPEDCDERYRQYLEHTPRYTGPTLIPFQV* |
Ga0066903_1085691211 | 3300005764 | Tropical Forest Soil | EREHGGDPADRGRVTVYEPEDCDELIRQHLERAPRRIGPVLIPIQV* |
Ga0070715_106902723 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | NAKTREERERAQDGDPADRGRVTIYEPEDCDERYRQYLEHAPRHTGPTLIPIQV* |
Ga0070715_108847262 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | RVTIYEPEDCDERYRQYLEHAPRYTGPTLIPFQV* |
Ga0097621_1000755542 | 3300006237 | Miscanthus Rhizosphere | DQGRVTIYEPEDCDERYRQYLEHTPRHTGPTLIPIQV* |
Ga0074055_114331381 | 3300006573 | Soil | RGRVTIYEPEDWPERIRQYEAQTPRSFAPVLVPIPV* |
Ga0074053_119884282 | 3300006575 | Soil | DRGRVTVYEPEDWPERHRQYREHTPRRTGPTLIPIQV* |
Ga0066659_117439941 | 3300006797 | Soil | DAPATRGRVTIYEPEDCDERWHQHLERTPRRTGPTLIPIQV* |
Ga0079221_104534741 | 3300006804 | Agricultural Soil | ERERDPDGPPRGRVRIYEPEDCDERWRQYLERTPRRTGPTLIPIPV* |
Ga0079220_100730051 | 3300006806 | Agricultural Soil | RGRVRIYEPEDCDERWRQHLERTPRRTGPTLIPIPV* |
Ga0075433_108346571 | 3300006852 | Populus Rhizosphere | RVRIYEPEDCDERWRQHLERTPRRYTGPTLIPIQV* |
Ga0075434_1025639072 | 3300006871 | Populus Rhizosphere | DRGRVTIYEPEDCDERYRQYLEDTPRYTGPTLIPIQV* |
Ga0105251_100123391 | 3300009011 | Switchgrass Rhizosphere | QDDEPAARGRVTVYEPEDCDERYRQYLERTPRYTGPTLIPIQV* |
Ga0105244_101365641 | 3300009036 | Miscanthus Rhizosphere | GQDGEPAARGRVTVYEPEDCDERYRQYCEDTPRRTGPTLIPIQV* |
Ga0105245_107955982 | 3300009098 | Miscanthus Rhizosphere | PADRGRVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV* |
Ga0075423_124969412 | 3300009162 | Populus Rhizosphere | PKSWGDDPATRGRVRIYEPEDCDERWRQHLERTPRRHTGPTLIPIQV* |
Ga0105248_119820121 | 3300009177 | Switchgrass Rhizosphere | EQAQDDDPADRGRVTIYEPEDCDERYRQYLEHTPRHTGPTLIPIQV* |
Ga0105237_119998701 | 3300009545 | Corn Rhizosphere | DPADRGRVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV* |
Ga0105249_105092992 | 3300009553 | Switchgrass Rhizosphere | TSEEREQDGAPVIPGRVTVYEPEDCDERYRQYLEHTPRYTGPTLIPIQV* |
Ga0134111_101494741 | 3300010329 | Grasslands Soil | GDLANGGQVRIYAPADCDERWRQHLERTPRRTGPTLIPIQV* |
Ga0126376_107640611 | 3300010359 | Tropical Forest Soil | TRHERDHDTDPAGRGRATVYEPEDCEILARQYLDHAPRHTGPVLIPIQV* |
Ga0126377_126721392 | 3300010362 | Tropical Forest Soil | ARRGHVTVYEPEDCEDLIRQYLEHAPRRTGPVLIPIQV* |
Ga0105239_119165802 | 3300010375 | Corn Rhizosphere | DRITIYEPEDCDERYRQYLEHAPRRSGPTLIPIQL* |
Ga0126381_1014920021 | 3300010376 | Tropical Forest Soil | EREQGADPAHRDRVTVYEPEDCAELFRQYLEQAPPRTSPTLIPIQA* |
Ga0134126_130547051 | 3300010396 | Terrestrial Soil | TDEQKQADGDQDGDPADRGRVTIYEPEDWPERYRQYCENTPRRTGPTLIPIQV* |
Ga0126383_114524403 | 3300010398 | Tropical Forest Soil | PPSRGHVTVYEPEDCEERIRQYLEQAPRRTGPILIPVQV* |
Ga0134127_124957861 | 3300010399 | Terrestrial Soil | GAPVNRGRVTIYEPEDCDERYRQYLEHAPRRSGPTLIPIQL* |
Ga0137399_102650901 | 3300012203 | Vadose Zone Soil | ARTKEERDQDRDPGPRGRVRIYEPEDCDERWRQHLERTPRYTGPTLIPIQV* |
Ga0137378_102917582 | 3300012210 | Vadose Zone Soil | PRGRVTIYEPEDCDERYRQYLERTPRHTGPTPIPIQV* |
Ga0137367_104833501 | 3300012353 | Vadose Zone Soil | DGDPAGRGRVTVYEPEDWPERYRQYREHTPRRTGPTLIPIQV* |
Ga0137385_100171451 | 3300012359 | Vadose Zone Soil | REQGQDGDPAGRGRVTVYEPEDWPERYRQYREHTPRRTGPTLIPIQV* |
Ga0137375_103129992 | 3300012360 | Vadose Zone Soil | GRVTVYEPEDWPERYRQYREHTPRRTGPTLIPIQV* |
Ga0157335_10029921 | 3300012492 | Arabidopsis Rhizosphere | KSQNRQEPQRDQDSGPADRGRITVYEPEDCDERYRQYLERTPRRIGPTLIPIPV* |
Ga0164303_114662241 | 3300012957 | Soil | ERGQDGDPADRGRVTIYEPEDCDERYRQYLEHAPRRTGPTLIPIQV* |
Ga0164299_100519823 | 3300012958 | Soil | ARIKQERERDQDGEPAARGRVTVYEPEDCDERYRQYLEHAPRHTGPILIPIQV* |
Ga0164302_109063412 | 3300012961 | Soil | GHVTIYEPEGCDERYRQYLERTPRYTGPTLIPIQV* |
Ga0157371_102489051 | 3300013102 | Corn Rhizosphere | ADRGSVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV* |
Ga0157370_119938671 | 3300013104 | Corn Rhizosphere | GEPATRGRVTVYEPEDCDERYRQYLEHTPRYTGPTLIPIQV* |
Ga0157369_117412502 | 3300013105 | Corn Rhizosphere | RVTIYEPEDCDERYRQYLEHAPRRSGLTLIPIQL* |
Ga0157374_114904803 | 3300013296 | Miscanthus Rhizosphere | DRGRVTIYEPEDCDERYRQYLEHAPRHTGPTLIPIQV* |
Ga0157372_110260981 | 3300013307 | Corn Rhizosphere | DRGRVTIYEPEDWPERYRQYCEHTPRRTGPTLIPIQV* |
Ga0163163_105961402 | 3300014325 | Switchgrass Rhizosphere | DGEPAARGRVTVYEPEDCDERYRQYLEHTPRHTGPILIPIQV* |
Ga0137403_101441524 | 3300015264 | Vadose Zone Soil | PRGRVRIYEPEDCDERYRQYLERTPRYTGPTLIPIRV* |
Ga0132258_106116831 | 3300015371 | Arabidopsis Rhizosphere | GVTVYEPEDCDELIRRYLEHAPRRTGPTLIPIPV* |
Ga0132257_1020231362 | 3300015373 | Arabidopsis Rhizosphere | GDPADRGRVTIYEPEDCDERYRQYLEHTPRHTGPTLIPIQV* |
Ga0132257_1025735221 | 3300015373 | Arabidopsis Rhizosphere | EHGGDPPSRGGVTVYEPEDCDELIRRYLEHAPRRTGPTLIPIPV* |
Ga0132255_1024514231 | 3300015374 | Arabidopsis Rhizosphere | LAKQAQDDDPADRGRVTIYEPEDCDERYRQYLEHTPRHTGPTLIPIQV* |
Ga0182041_111780252 | 3300016294 | Soil | QGGDRASRGRVTVYEPEDCEKLIRQYLEQAPRRTGPVLIPIQV |
Ga0163161_102390632 | 3300017792 | Switchgrass Rhizosphere | RGQDGDPADRGRVTIYEPEDWPERYRQYCEHTPRRTGPTLIPIQV |
Ga0187785_106221722 | 3300017947 | Tropical Peatland | AGRGDVTVYEPEDCDDLIRQYLEHAPRRTGPVQVPIQV |
Ga0179590_10319161 | 3300020140 | Vadose Zone Soil | NARTREERDQDRDPAPRGRVRIYEPEDCDERYRQYLERTPRYTGPTLIPIQV |
Ga0210407_103876493 | 3300020579 | Soil | GDPVARGRVTIYEPEDWPERIRQYEARTPRSFAPVQVPIQV |
Ga0210399_114594001 | 3300020581 | Soil | DRGRVTIYEPEDWPERIRQYEVRTPRSFAPVLVPIQV |
Ga0210408_101552211 | 3300021178 | Soil | GDAPATRGRVRIYEPEDCDERWRQHLERTPRRTGPTLIPIQV |
Ga0210397_101283353 | 3300021403 | Soil | AWGGDPATRGRVRIYEPEDCDERWRQHLERTPRRTGPTLIPIPV |
Ga0210397_102938101 | 3300021403 | Soil | TSWGDAPATRGRVRIYEPEDCDERWRQHLERTPRRTGPTLIPIQV |
Ga0210389_107057221 | 3300021404 | Soil | DAPATRGRVRIYEPEDCDERWRQHLERTPRRTGPTLIPIQV |
Ga0210402_104703211 | 3300021478 | Soil | PKSWGDAPATRGRVRIYEPEDCDERWRQHLERTPRRTGPTLIPIQV |
Ga0126371_119977301 | 3300021560 | Tropical Forest Soil | GPADRRADVTVYEPEDCDVLVRQYLERAPRRTGPTLIPIQV |
Ga0247678_10034432 | 3300024325 | Soil | EERERAQDGDPADRGRVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0207713_11347251 | 3300025735 | Switchgrass Rhizosphere | GRVTIYEPEDCDERYRQYLEHTPRHTGPTLIPIQV |
Ga0207692_100280502 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | PAARGRVTIYEPEDCDARWRQHLERTPRRYTGPTLIPIQV |
Ga0207642_100404172 | 3300025899 | Miscanthus Rhizosphere | PADRGRVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0207647_100322754 | 3300025904 | Corn Rhizosphere | PAARGRVTVYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0207645_101740351 | 3300025907 | Miscanthus Rhizosphere | REERDRGQDDDPADRGRVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0207671_104098161 | 3300025914 | Corn Rhizosphere | NARTKEEEPEQDGAPVNRGRVTIYEPEDCDERYRQYLEHAPRRSGPTLIPIQL |
Ga0207660_103421721 | 3300025917 | Corn Rhizosphere | GDPADRGRVTIYEPEDCDERYRQYLEHTPRHTGPTLIPIQV |
Ga0207662_109093432 | 3300025918 | Switchgrass Rhizosphere | RGRVTIYEPEDCDERYRQYLEHTPRHTGPTLIPIQV |
Ga0207659_105990962 | 3300025926 | Miscanthus Rhizosphere | AQDDDPADRGSVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0207690_101860771 | 3300025932 | Corn Rhizosphere | GRVTVYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0207706_100311865 | 3300025933 | Corn Rhizosphere | ERARDQDGEPAARGRVTVYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0207686_114114022 | 3300025934 | Miscanthus Rhizosphere | REQDGAPVIPGRVTVYEPEDCDERYRQYLEHTPRYTGPTLIPIPV |
Ga0207709_110894442 | 3300025935 | Miscanthus Rhizosphere | AARGRVTVYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0207670_103898002 | 3300025936 | Switchgrass Rhizosphere | ARDQDGEPATRGRVTVYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0207691_100256461 | 3300025940 | Miscanthus Rhizosphere | GDPADQGRVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0207691_102218731 | 3300025940 | Miscanthus Rhizosphere | ERERGQDGDPADRGRVTIYEPEDWPERYRQYCEHTPRRTGPTLIPIQV |
Ga0207651_101792171 | 3300025960 | Switchgrass Rhizosphere | ARGRVTVYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0207712_110985611 | 3300025961 | Switchgrass Rhizosphere | SEEREQDGAPVIPGRVTVYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0207640_113828572 | 3300025981 | Corn Rhizosphere | RGRVTVYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0207641_100321375 | 3300026088 | Switchgrass Rhizosphere | GSVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0207648_100664611 | 3300026089 | Miscanthus Rhizosphere | QDGAPVNRGRVTIYEPEDCDERYRQYLEHAPRRSGPTLIPIQL |
Ga0257147_10078081 | 3300026475 | Soil | DQDGDPAARGRVTVYEPEDWPERIRQYEARTPRCFAPVLVPIQV |
Ga0209056_104313161 | 3300026538 | Soil | EQKQADRDQEGTPAARGRVTIYEPEDCDERYRQYLERAPRRTGPTLIPIQV |
Ga0209418_10290711 | 3300027371 | Forest Soil | QERERDQDSEPAARGRVTVYEPEDCDERYRQYLEHTPRYTGPTLIPIPV |
Ga0209275_104463461 | 3300027884 | Soil | DGPARGRVRIYEPEDCDERWRQHLERTPRRTGPTLIPIQV |
Ga0247684_10066952 | 3300028138 | Soil | DGDPADRGRVTIYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0247684_10737332 | 3300028138 | Soil | PPRGRVRIYEPEDCDERWRQHLERTPRRYTGPTLIPIQV |
Ga0307293_100565952 | 3300028711 | Soil | ADRGRVTIYEPEDWPERYRQYCEHTPRRTGPTLIPIQV |
Ga0307277_100321443 | 3300028881 | Soil | GEPAARGRVTVYEPEDCDERYRQYLEHTPRYTGPTLIPIQV |
Ga0308309_111836161 | 3300028906 | Soil | PRGRVRIYEPEDCDERWRQHLERTPRRYTGPTLIPIQV |
Ga0307482_11802962 | 3300030730 | Hardwood Forest Soil | VVGLGGPDGPPRGRVTIYEPEDCDERWRQHLERTPRRYTGPTLIPIQV |
Ga0318573_100604911 | 3300031564 | Soil | TREEREQGGDRASRGRVTVYEPEDCEKLIRQYLEQAPRRTGPVLIPIQV |
Ga0318555_101313911 | 3300031640 | Soil | EKQQHPAGPADRRADVTVYEPEDCDERYRQYLEHAPRRTGPTLIPIQV |
Ga0318542_103581711 | 3300031668 | Soil | REDREHGDPADRGRVTVYEPEDCEELIRQYLEHAPRRTGPVLIPIQV |
Ga0307474_106795572 | 3300031718 | Hardwood Forest Soil | PATRGRVTIYEPEDCDERWRQHLERTPRRTGPTLIPIQV |
Ga0307469_108988771 | 3300031720 | Hardwood Forest Soil | ARTKEEPEQDGAPVNRGRVTIYEPEDCDERYRQYLEHAPRRSGPTLIPIQL |
Ga0318500_102035791 | 3300031724 | Soil | REDREQDRNDDPVDRGRVTVYEPEDCDDLIHQYLEQAPRRTGPTLVPIQV |
Ga0307468_1002814251 | 3300031740 | Hardwood Forest Soil | NARTREERDQDGEPAARGRVTVYEPEDCDERYRQYLEHAPRHTGPTLIPIQV |
Ga0318546_112079931 | 3300031771 | Soil | GRVTVYEPEDCDELIRQYLDHAPRRTGPTLIPIQV |
Ga0318576_100825802 | 3300031796 | Soil | GDRASRGRVTVYEPEDCEELIRQYLEQAPRRTGPVLIPIQV |
Ga0318565_101226912 | 3300031799 | Soil | IAQEKQEHPADRRADVTVYEPEDCDERYRQYLERTPRRTGPTLIPIQV |
Ga0318517_104249131 | 3300031835 | Soil | GRVMVYEPEDCDDLIHQYLEQAPRRTGPTLVPIQV |
Ga0306925_118214952 | 3300031890 | Soil | ADRRADVTVYEPEDCNERYRQYLDHAPRRTGPTLIPIQV |
Ga0310916_109907612 | 3300031942 | Soil | HPAGPADRRADVTVYEPEDCDELVRQYLERAPRRTGPTLIPIQV |
Ga0306926_111807542 | 3300031954 | Soil | AGPADRRADVTVYEPEDCDERYRQYLERTPRRTGPTLIPIQV |
Ga0318559_103175001 | 3300032039 | Soil | PADRGRVTVYEPEDCDDLIHQYLEQAPRRTGPTLIPIQV |
Ga0318558_101767881 | 3300032044 | Soil | ANARTREEREQGGDFAGRGQVTVYEPEDCEELIRQYLEQAPRRTGPVLIPIQV |
Ga0318553_103484621 | 3300032068 | Soil | QQHPAGTADRRADVTVYEPEDCDERYRQYLERTPRRTGPTLIPIQV |
Ga0335079_104300461 | 3300032783 | Soil | TRDEPEQDGDPPSRDGVTVYEPDDCDKLIRQYLGHAPRRTGPTLIPIQA |
Ga0335081_109272743 | 3300032892 | Soil | PPGPADRRAGVTVYEPEDCDELIRQYLEQAPRRTGPTLIPIQV |
Ga0335069_120404672 | 3300032893 | Soil | GRGRVTVYEPQDCAERFRQYLGQAPRYTGPTLTPIQV |
Ga0335083_103024844 | 3300032954 | Soil | DSDPADRRAGVTVYEPEDCDERYRQYLERTPRRTGPTLIPIQV |
Ga0335084_115595461 | 3300033004 | Soil | GRGHVTVYEPEDCEILARQYLDHAPRHTGPTLIPIQV |
Ga0335073_112631101 | 3300033134 | Soil | QSGDPPSADSVTVYEPEDCDELIRQYLGHAPRRTGPTLVPIRV |
⦗Top⦘ |