| Basic Information | |
|---|---|
| Family ID | F067144 |
| Family Type | Metagenome |
| Number of Sequences | 126 |
| Average Sequence Length | 43 residues |
| Representative Sequence | RQLGDETFRSRAPEKIIKGLEATLAEQRIELQKLQERLRQLEKGS |
| Number of Associated Samples | 105 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.41 % |
| % of genes from short scaffolds (< 2000 bps) | 89.68 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.66 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.032 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (23.016 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.778 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.68% β-sheet: 0.00% Coil/Unstructured: 49.32% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF02749 | QRPTase_N | 60.32 |
| PF08279 | HTH_11 | 23.02 |
| PF03309 | Pan_kinase | 7.14 |
| PF10458 | Val_tRNA-synt_C | 4.76 |
| PF01709 | Transcrip_reg | 0.79 |
| PF13384 | HTH_23 | 0.79 |
| PF03551 | PadR | 0.79 |
| PF00133 | tRNA-synt_1 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 60.32 |
| COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 60.32 |
| COG1521 | Pantothenate kinase type III | Coenzyme transport and metabolism [H] | 7.14 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.79 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.79 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.03 % |
| Unclassified | root | N/A | 3.97 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000891|JGI10214J12806_11175820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium ADurb.Bin340 | 675 | Open in IMG/M |
| 3300000955|JGI1027J12803_107586528 | Not Available | 1826 | Open in IMG/M |
| 3300004480|Ga0062592_100359010 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
| 3300005167|Ga0066672_10119069 | All Organisms → cellular organisms → Bacteria | 1630 | Open in IMG/M |
| 3300005179|Ga0066684_10109166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1707 | Open in IMG/M |
| 3300005180|Ga0066685_10397684 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300005181|Ga0066678_10442193 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300005332|Ga0066388_103020432 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300005450|Ga0066682_10080634 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2021 | Open in IMG/M |
| 3300005467|Ga0070706_101750310 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300005542|Ga0070732_10196695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1205 | Open in IMG/M |
| 3300005552|Ga0066701_10273350 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300005553|Ga0066695_10730808 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300005555|Ga0066692_10129533 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
| 3300005561|Ga0066699_10428293 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300005569|Ga0066705_10089429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1813 | Open in IMG/M |
| 3300005569|Ga0066705_10872779 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300005575|Ga0066702_10184907 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300005586|Ga0066691_10319419 | All Organisms → cellular organisms → Bacteria | 918 | Open in IMG/M |
| 3300005586|Ga0066691_10353118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300005586|Ga0066691_10405180 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300005602|Ga0070762_10800181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 638 | Open in IMG/M |
| 3300005610|Ga0070763_10501944 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 694 | Open in IMG/M |
| 3300005843|Ga0068860_100835815 | All Organisms → cellular organisms → Bacteria | 935 | Open in IMG/M |
| 3300006032|Ga0066696_10095200 | All Organisms → cellular organisms → Bacteria | 1778 | Open in IMG/M |
| 3300006059|Ga0075017_100484495 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300006163|Ga0070715_10705933 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300006163|Ga0070715_11002233 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006175|Ga0070712_101404139 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300006796|Ga0066665_10902522 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300006800|Ga0066660_10654195 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300006893|Ga0073928_10270227 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300007076|Ga0075435_101347499 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Verminephrobacter → Verminephrobacter eiseniae → Verminephrobacter eiseniae EF01-2 | 625 | Open in IMG/M |
| 3300007076|Ga0075435_102016288 | Not Available | 507 | Open in IMG/M |
| 3300007265|Ga0099794_10780699 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300007788|Ga0099795_10199810 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300009038|Ga0099829_11072783 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300009088|Ga0099830_11337627 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300009089|Ga0099828_10797257 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300009137|Ga0066709_100448129 | All Organisms → cellular organisms → Bacteria | 1804 | Open in IMG/M |
| 3300009700|Ga0116217_10321162 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300009700|Ga0116217_10545495 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300010358|Ga0126370_10087580 | All Organisms → cellular organisms → Bacteria | 2114 | Open in IMG/M |
| 3300010359|Ga0126376_12384171 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010360|Ga0126372_10098702 | All Organisms → cellular organisms → Bacteria | 2189 | Open in IMG/M |
| 3300010366|Ga0126379_12560288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300011270|Ga0137391_10382543 | All Organisms → cellular organisms → Bacteria | 1205 | Open in IMG/M |
| 3300012189|Ga0137388_10692273 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300012202|Ga0137363_11047358 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300012203|Ga0137399_10249286 | All Organisms → cellular organisms → Bacteria | 1456 | Open in IMG/M |
| 3300012203|Ga0137399_10912278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300012205|Ga0137362_10211404 | All Organisms → cellular organisms → Bacteria | 1672 | Open in IMG/M |
| 3300012205|Ga0137362_10702180 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300012210|Ga0137378_10379546 | All Organisms → cellular organisms → Bacteria | 1312 | Open in IMG/M |
| 3300012350|Ga0137372_10450658 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300012361|Ga0137360_11611148 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
| 3300012363|Ga0137390_10474955 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300012363|Ga0137390_10474957 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300012685|Ga0137397_10229793 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1381 | Open in IMG/M |
| 3300012922|Ga0137394_10288057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1404 | Open in IMG/M |
| 3300012922|Ga0137394_11365005 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
| 3300012944|Ga0137410_11328271 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300012977|Ga0134087_10373493 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300015168|Ga0167631_1054205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300015241|Ga0137418_11063732 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300015241|Ga0137418_11063936 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300017822|Ga0187802_10046345 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1581 | Open in IMG/M |
| 3300017930|Ga0187825_10135735 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300017955|Ga0187817_10477302 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300017961|Ga0187778_11369957 | Not Available | 500 | Open in IMG/M |
| 3300017972|Ga0187781_10293496 | All Organisms → cellular organisms → Bacteria | 1153 | Open in IMG/M |
| 3300018006|Ga0187804_10541153 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300018468|Ga0066662_10057154 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2527 | Open in IMG/M |
| 3300018468|Ga0066662_11026937 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300020580|Ga0210403_10234569 | All Organisms → cellular organisms → Bacteria | 1506 | Open in IMG/M |
| 3300020581|Ga0210399_11046493 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300021046|Ga0215015_10853239 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300021086|Ga0179596_10714843 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300021180|Ga0210396_10809889 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300021478|Ga0210402_10665799 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
| 3300021478|Ga0210402_11091735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300021478|Ga0210402_11628067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300021479|Ga0210410_11809787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300022557|Ga0212123_10121562 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2075 | Open in IMG/M |
| 3300024323|Ga0247666_1113783 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300026322|Ga0209687_1018307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2305 | Open in IMG/M |
| 3300026330|Ga0209473_1030563 | All Organisms → cellular organisms → Bacteria | 2443 | Open in IMG/M |
| 3300026333|Ga0209158_1016430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3438 | Open in IMG/M |
| 3300026343|Ga0209159_1204531 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300026475|Ga0257147_1036712 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300026497|Ga0257164_1032136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300026548|Ga0209161_10289470 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300026550|Ga0209474_10002615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 16384 | Open in IMG/M |
| 3300027376|Ga0209004_1061580 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300027439|Ga0209332_1072096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300027521|Ga0209524_1083831 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 670 | Open in IMG/M |
| 3300027629|Ga0209422_1027277 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300027671|Ga0209588_1174638 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300027703|Ga0207862_1071247 | Not Available | 1045 | Open in IMG/M |
| 3300027738|Ga0208989_10289892 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300027874|Ga0209465_10288284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 822 | Open in IMG/M |
| 3300027903|Ga0209488_11062233 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300028146|Ga0247682_1060726 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300028381|Ga0268264_10207553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1796 | Open in IMG/M |
| 3300028536|Ga0137415_10497452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 1027 | Open in IMG/M |
| 3300028536|Ga0137415_11036969 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300028536|Ga0137415_11499328 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300031122|Ga0170822_12592789 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300031231|Ga0170824_126096383 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300031545|Ga0318541_10152157 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1270 | Open in IMG/M |
| 3300031720|Ga0307469_10200719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1557 | Open in IMG/M |
| 3300031720|Ga0307469_10523704 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Verminephrobacter → Verminephrobacter eiseniae → Verminephrobacter eiseniae EF01-2 | 1044 | Open in IMG/M |
| 3300031740|Ga0307468_101148845 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300031754|Ga0307475_11169103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300031823|Ga0307478_10076972 | All Organisms → cellular organisms → Bacteria | 2536 | Open in IMG/M |
| 3300031823|Ga0307478_11769134 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031962|Ga0307479_10452252 | All Organisms → cellular organisms → Bacteria | 1268 | Open in IMG/M |
| 3300032042|Ga0318545_10301790 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 576 | Open in IMG/M |
| 3300032160|Ga0311301_10796789 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300032174|Ga0307470_11104653 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300032180|Ga0307471_100080950 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2857 | Open in IMG/M |
| 3300032180|Ga0307471_102377201 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300032180|Ga0307471_102500788 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300032205|Ga0307472_100027003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3260 | Open in IMG/M |
| 3300032205|Ga0307472_101076295 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 23.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 20.63% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.32% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 10.32% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.17% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.38% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.38% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.59% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.59% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.59% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015168 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G4A, Ice margin, adjacent to proglacial lake) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027376 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10214J12806_111758201 | 3300000891 | Soil | DPTFRSRAPEKIIQGLETTLAEQRIELGKAVERLSQLNCG* |
| JGI1027J12803_1075865281 | 3300000955 | Soil | GDETFRSRAPEKIIKALEATLAEQRIELQKLQERLDQLG* |
| Ga0062592_1003590102 | 3300004480 | Soil | LADPTFRSRAPEKIIQGLETTLAEQRIELGKAVERLSQLNCG* |
| Ga0066672_101190691 | 3300005167 | Soil | APEKIIKGLEATLAQQKVELDKLRKRLRDLEAGSQAAGTS* |
| Ga0066684_101091661 | 3300005179 | Soil | DETFRSRAPEKIIKGLEATLAEQRIELRKLKDRLSQLEKNS* |
| Ga0066685_103976842 | 3300005180 | Soil | QLGNEIFRSRAPEMIIKGLEATLAEQRIELQKLKDRLSQLEKDS* |
| Ga0066678_104421931 | 3300005181 | Soil | ETFRSRAPEKIIKGLEATLAEQRIQLRKLQDRLSQIEKDS* |
| Ga0066388_1030204322 | 3300005332 | Tropical Forest Soil | HERLAKNIAAKEQQLADTTFRSRAPEKIIQGLLSTLAEQRIELGKTAERLSQLNCG* |
| Ga0066682_100806343 | 3300005450 | Soil | ASKERQLGDETFRSRAPEKIIKGLEATLAEQRIEFRKLQDRLSQIEKDS* |
| Ga0070706_1017503101 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | KERQLGDETFRSRAPEKIIQGLQATLEERRIELKKLIERLKELESGN* |
| Ga0070732_101966952 | 3300005542 | Surface Soil | AKEKQLGDPVFRSRAPEKIVRGLEATVAEQKIELQKLRTRLEELKRAA* |
| Ga0066701_102733501 | 3300005552 | Soil | QLGDQTFRSRAPENIVKGLEVTLAEQRIALRKLQERLSQLDGDS* |
| Ga0066695_107308081 | 3300005553 | Soil | LSRAPEKIVQALRATLAERRIELQKVQERIKELESGN* |
| Ga0066692_101295333 | 3300005555 | Soil | FRSRAPEKIIQGLQATLEERRIELKKLIERLKELESGN* |
| Ga0066699_104282931 | 3300005561 | Soil | SRAPEKIIKGLEATLGEQRIELQKLKARLSQLEEGS* |
| Ga0066705_100894293 | 3300005569 | Soil | IESKERQLGDKTFRSRAPEKIIKGLEATLGEQRIELQKLKARLSQLEEGS* |
| Ga0066705_108727791 | 3300005569 | Soil | IASKERQLGDETFRSRAPEKIIKGLEATLAGQRIELQKLKDRLAQLEKGS* |
| Ga0066702_101849073 | 3300005575 | Soil | APENIVKGLEVTLAEQRIALRKLQERLSQLDGDS* |
| Ga0066691_103194192 | 3300005586 | Soil | LGDETFRSRAPEKIIQGLQATLEERRIELKKLIERLKELESGN* |
| Ga0066691_103531182 | 3300005586 | Soil | FRSRAPEKIIKGLEATLAEQRIELQKLQERLAQLESGA* |
| Ga0066691_104051801 | 3300005586 | Soil | SKERQLGDETFRSRAPENIIKGLEATLSQQRSELHKLQDRLSQLERDS* |
| Ga0070762_108001811 | 3300005602 | Soil | KQLADETFRSRAPEKIIRGLEATLAVQLVELEKSVERLGQL* |
| Ga0070763_105019441 | 3300005610 | Soil | RQLGDDTFRRRAPEKIIQGLETTLGEQRVELQKLRERLGQLEKSS* |
| Ga0068860_1008358152 | 3300005843 | Switchgrass Rhizosphere | TFRSRAPEKIIQGLEATLAEQRIELTKTTERLSQLNCA* |
| Ga0066696_100952001 | 3300006032 | Soil | APEKIIKGLEATLGEQRIELQKLKARLSQLEEGS* |
| Ga0075017_1004844952 | 3300006059 | Watersheds | ASKQSRLEDETFRSRAPENIVKGLESTLAERRTEFSKLGERLAQLERL* |
| Ga0070715_107059332 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | KETQLGNETFRSRAPENIIRGLEATLAGQRVELQKLLDRLRQLENGK* |
| Ga0070715_110022332 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | ERQLGDETFRSRAPAKIIFGLQATLEERRIEIQKVTERIKELACGS* |
| Ga0070712_1014041392 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LGDETFRSRAPGKIIQGLETTLQERRIELNKVIERRKELESGS* |
| Ga0066665_109025221 | 3300006796 | Soil | QLGDETFRSRAPEKIIKGLEATLAEQRIELRKLKDRLSQVEKNS* |
| Ga0066660_106541951 | 3300006800 | Soil | GDERFRSREPEKIIKGLEATLAEQRIELRKLQDRLSQIEKDS* |
| Ga0073928_102702272 | 3300006893 | Iron-Sulfur Acid Spring | SKEQQLGDETFRRRAPEKIIRGLEATLATQRIEMQKLTERFEQLDC* |
| Ga0075435_1013474992 | 3300007076 | Populus Rhizosphere | EVFRSRAPEKVIKDMEGTLVEQRVELQKLSDRLEQLGG* |
| Ga0075435_1020162881 | 3300007076 | Populus Rhizosphere | FRSRAPEKIIQGLESTLAEQRVELSKTTERLSQLNCS* |
| Ga0099794_107806991 | 3300007265 | Vadose Zone Soil | LGDETFRSRAPEKIIKELEATLAEQRIELRKLQDRLSQIEKDS* |
| Ga0099795_101998102 | 3300007788 | Vadose Zone Soil | IGAKERQLGDATFRSRAPEKIVRGLEATLAAQQIELEKLRSRLDELLRGGGA* |
| Ga0099829_110727831 | 3300009038 | Vadose Zone Soil | ERQLGDETFRSRAPEKIIKGLEATLAEQRIELRKLQDRLSQLEKDS* |
| Ga0099830_113376271 | 3300009088 | Vadose Zone Soil | ETFRNRAPEQIVKGLEATLAQQRIELEKLRKRLAELEGGGQAAGT* |
| Ga0099828_107972571 | 3300009089 | Vadose Zone Soil | AISSKEGQLGNDTFRSRAPGVIIKGLEATLAEQRIELRKLQDRLAQLEQNS* |
| Ga0066709_1004481293 | 3300009137 | Grasslands Soil | SRAPEKVIKDMEGVLAEQKIELQKLQDRLSQLHS* |
| Ga0116217_103211622 | 3300009700 | Peatlands Soil | FRSRAPEKIIKGLEATLAEQRIEQQKLQDRLSQLE* |
| Ga0116217_105454952 | 3300009700 | Peatlands Soil | NETFRSRAPEKIIKGLEATLAEQRIELKKLQDRLDQLG* |
| Ga0126370_100875801 | 3300010358 | Tropical Forest Soil | RAPEKIIKGLEAMLAQQRIELEKLQRRLGDLDGDSSQAAGT* |
| Ga0126376_123841712 | 3300010359 | Tropical Forest Soil | SKERQLADTTFRSRAPEKIIKGLEATLAQQTLELEKLGRRLEDLARVS* |
| Ga0126372_100987021 | 3300010360 | Tropical Forest Soil | ETFRSRAPENIIKDMEAALATQRIECQKLTERLSQMAN* |
| Ga0126379_125602881 | 3300010366 | Tropical Forest Soil | RQLGDETFRSRAPEMIIKQLKATLAQQKTEEGKLLRRLGDLDGGSSQAAGT* |
| Ga0137391_103825433 | 3300011270 | Vadose Zone Soil | PEMIIKGLEATLAQQKIELEKLGKRLEDLNRGSQDAGT* |
| Ga0137388_106922731 | 3300012189 | Vadose Zone Soil | RQLGDETFRSRAPEKIIKGLEATLAEQRIELHKVQDRLSQLDKDL* |
| Ga0137363_110473582 | 3300012202 | Vadose Zone Soil | GNETFRSRAPEMIIKGLEATLAEQRTELKKLQDRLAQLE* |
| Ga0137399_102492863 | 3300012203 | Vadose Zone Soil | SRAPEKIIKRLEATLAEQRIELRKLQDRLSQLDGDS* |
| Ga0137399_109122781 | 3300012203 | Vadose Zone Soil | VSKEKQLGDETFRSRAPEKIIRGLEATLAAQRIELSKLTERLEQLN* |
| Ga0137362_102114041 | 3300012205 | Vadose Zone Soil | SRAPEKIIQGLQATLEERRIELKKLIERLKELESGN* |
| Ga0137362_107021801 | 3300012205 | Vadose Zone Soil | GNELFRSRAPELIIKGLEATLAMQQIELRKLQDRLSQLDGNA* |
| Ga0137378_103795461 | 3300012210 | Vadose Zone Soil | ERQLGDETFRSRAPEKIIKGLEATLAEQRIELRKLQDRLSQIEKDS* |
| Ga0137372_104506581 | 3300012350 | Vadose Zone Soil | RAPEKIIQGLQVTLEERRIELKKLIERLKELESGN* |
| Ga0137360_116111482 | 3300012361 | Vadose Zone Soil | FRSRAPEKIIRGLQGTLQERRIEIRKVAARIRELESGG* |
| Ga0137390_104749551 | 3300012363 | Vadose Zone Soil | SFRSRAPEMIIKGLEATLAQQKIELEKLGKRLEDLNRGSQGTGT* |
| Ga0137390_104749571 | 3300012363 | Vadose Zone Soil | SFRSRAPEMIIKGLEATLAQQKIELEKLGKRLEDLNRGSQDAGT* |
| Ga0137397_102297933 | 3300012685 | Vadose Zone Soil | GDDTFRSRAPEKIIKGLETALAEQRIEVQKLQDRLDQLG* |
| Ga0137394_102880573 | 3300012922 | Vadose Zone Soil | GDETFRSRAPGDIIKKLQATLAEQRIELQKLQERLDQLESGA* |
| Ga0137394_113650052 | 3300012922 | Vadose Zone Soil | ETEGLQKAISSKEKQLEDDTFRTRAPAKIIKGLEATLLEQRHGLQKLQERLAQLESGA* |
| Ga0137410_113282711 | 3300012944 | Vadose Zone Soil | LADDTFRSRAPEKIIRGLEATLAEQMTELRKLRSRLEELKAAA* |
| Ga0134087_103734932 | 3300012977 | Grasslands Soil | RSRAPEKIIKGLEATLGEQRIELQKLKARLSQLEEGS* |
| Ga0167631_10542051 | 3300015168 | Glacier Forefield Soil | GDETFRSRAPDKVVRALEATLTEQRIEMQKLTERFEQLNQNGQ* |
| Ga0137418_110637321 | 3300015241 | Vadose Zone Soil | LGDDTFRSRAPEKIIKVLEATLAEQRIELKKLQDRLARL* |
| Ga0137418_110639361 | 3300015241 | Vadose Zone Soil | KQLGDETFRSRAPEKIIRGLEATLAAQRIELSKLTERLEQLN* |
| Ga0187802_100463451 | 3300017822 | Freshwater Sediment | TFRSRAPEKIIKQMEEALATQRIELQKIEQRLRSLDG |
| Ga0187825_101357351 | 3300017930 | Freshwater Sediment | KERQLGDETFRSRAPEMIIKGLEAALTQQKIEQEKLLRRLGDLDGGSQAAGT |
| Ga0187803_100242601 | 3300017934 | Freshwater Sediment | FRERAPEPIIKQMEEALAGQRIELQKVNDRLKQLG |
| Ga0187817_104773021 | 3300017955 | Freshwater Sediment | TFRSKAPEKIIKGLEATLAQQRIELKKLQDRLDQLLKGQ |
| Ga0187778_113699571 | 3300017961 | Tropical Peatland | RSRAPEKIVKQMEEALAAQRVELDKLRDRLKQLGDS |
| Ga0187781_102934961 | 3300017972 | Tropical Peatland | KEKQLADQIFRTKAPERIIKGLEATLEQQRIELQKLQDRLDQPEKGA |
| Ga0187804_105411531 | 3300018006 | Freshwater Sediment | ETFRSRAPEKIIRGMEATLEERCVELKKLQERLRQLERGA |
| Ga0066662_100571541 | 3300018468 | Grasslands Soil | SRAPEKIIRGMEATLEERRVELKKLAERLSQLEKAA |
| Ga0066662_110269372 | 3300018468 | Grasslands Soil | NDTFRSRAPEMIIKGLEATLAEQRTELQKLQDRLAQLEQNS |
| Ga0210403_102345693 | 3300020580 | Soil | LTKDIALKEGQLGSETFRCRAPEKIIQGLEATLGDRRIELQKVTERIRELESGK |
| Ga0210399_110464932 | 3300020581 | Soil | VASKENQLADETFRSRAPEKIVLGIEKTLGEQRIELKKLMDRLDELQEG |
| Ga0215015_108532392 | 3300021046 | Soil | TRDIAAKERQLADDTFRSRAPEKIIRGLRGTLEERRIEIQKVAARIRELESGG |
| Ga0179596_107148431 | 3300021086 | Vadose Zone Soil | KERQLGDNTFRSRAPEKIIKGLETTLAEQRIELEKLQERLDQLG |
| Ga0210396_108098892 | 3300021180 | Soil | TFRSRAPEKIIKGLEATLAEQRIELRKLQERLSQLE |
| Ga0210402_106657992 | 3300021478 | Soil | KERQLGDETFRSRAPEKIIKGLEATLAEQRIELRKLEDRLSQL |
| Ga0210402_110917351 | 3300021478 | Soil | LGNETFRSRAPGEIIAKLETSLGEQKIELQKLLERLKQLEKGN |
| Ga0210402_116280671 | 3300021478 | Soil | ISSKESQLGNETFRSRAPEKIIRGLEATLAEQRIELQKIVERLGQL |
| Ga0210410_118097872 | 3300021479 | Soil | RQLGDETFRSRAPEKIIKGLEATLAEQRIELQKLQERLRQLEKGS |
| Ga0212123_101215623 | 3300022557 | Iron-Sulfur Acid Spring | SKEQQLGDETFRRRAPEKIIRGLEATLATQRIEMQKLTERFEQLDC |
| Ga0247666_11137832 | 3300024323 | Soil | VFRSRAPEKVIKDMEGTLVEQKVELQKLSDRLEQLGG |
| Ga0209687_10183074 | 3300026322 | Soil | IISKEKQLGDETFRSRAPEKIIKGLEATLAQQKTEQDKLLKRLGDLDGGSQAAGT |
| Ga0209473_10305631 | 3300026330 | Soil | QLGDKTFRSRAPEKIIKGLEATLGEQRIELQKLKARLSQLEEGS |
| Ga0209158_10164305 | 3300026333 | Soil | ERQLVDKTFRSRAPEKIIKGLEATLGEQRIELQKLKARLSQLEEGS |
| Ga0209159_12045311 | 3300026343 | Soil | MIIKGLEATLAQQRIEQEKLRRRLGDLDGGSQAAGT |
| Ga0257147_10367122 | 3300026475 | Soil | RSRAPEKIIRGLQGTLEERRIEIQKVAARIRELESAGGRLN |
| Ga0257164_10321362 | 3300026497 | Soil | RAITSKERQLGDETFRSRAPGDIIKKLQATLADQRIELGKLQNRLDQLE |
| Ga0209161_102894701 | 3300026548 | Soil | ASKERQLGDETFRSRAPEKIIKGLEATLAGQRIELQKLKDRLSQLEKGS |
| Ga0209474_100026151 | 3300026550 | Soil | DETFRSRAPEKIIKGLEATLAQQKTEQDKLLKRLGDLDGGSQAAGT |
| Ga0209004_10615802 | 3300027376 | Forest Soil | SRAPEKIIQGLEATLAVRRIELQKVIERIRELESRQ |
| Ga0209332_10720962 | 3300027439 | Forest Soil | IGSKEKQLDDETFRSRAPEKIIRGLEATLATQRIEMQKLTERFEQLDC |
| Ga0209524_10838312 | 3300027521 | Forest Soil | EKQLGDETFRSRAPEKIIRGLEATLATQRIEMQKLTERFEQLDC |
| Ga0209422_10272773 | 3300027629 | Forest Soil | IGSKERQLDDETFRSRAPEKIIRGLEATLATQRIEMQKLTERFEQLDC |
| Ga0209588_11746382 | 3300027671 | Vadose Zone Soil | NEIFRSRAPEMIIQGLEATLAEQRIELRKLQDRLSQLEKNS |
| Ga0207862_10712474 | 3300027703 | Tropical Forest Soil | LGDETFRSRAPEKIIRGLEATLAERQVELQKFQDRVKELGDS |
| Ga0208989_102898921 | 3300027738 | Forest Soil | TFRSRAPEKIIKGLEATLAEQRIELRKLQDRLSQLEGAS |
| Ga0209465_102882842 | 3300027874 | Tropical Forest Soil | RSRAPEKIIKGLEATLAQQKIELEKLQRRLVDLDGGSSQAAGT |
| Ga0209488_110622331 | 3300027903 | Vadose Zone Soil | SKEGQLGNETFRSRAPENIIKGLEATLAEQRVEFQKLQGRLLQLEKA |
| Ga0247682_10607261 | 3300028146 | Soil | KQLSNDVFRSRAPEKVIKDMESTLGEQKVELQKLSDRLKQLAG |
| Ga0268264_102075533 | 3300028381 | Switchgrass Rhizosphere | GSKERQLADVTFRSRAPEKIIQGLEATLAEQRIELTKTTERLSQLNCA |
| Ga0137415_104974523 | 3300028536 | Vadose Zone Soil | SNETFRSRAPEKIIKGLEVTLAEQKIELQKLRDRLTGLQ |
| Ga0137415_110369692 | 3300028536 | Vadose Zone Soil | AVASKERQLGDKTFRRRAPEKIIKGLEATLAEQRIELRKLQDRLSQLE |
| Ga0137415_114993282 | 3300028536 | Vadose Zone Soil | SKERQLADETFRSRAPENIIKGMEGALAEQRIELRKLQDRLSQLEGNS |
| Ga0170822_125927892 | 3300031122 | Forest Soil | ETFRNRAPEKIIQGLEATLAERRIELDKTAARIRELESGK |
| Ga0170824_1260963831 | 3300031231 | Forest Soil | IASKERQLGDDTFRSRAPEKIISGLQGTLEERRIEIQKVAARIRELESGG |
| Ga0318541_101521572 | 3300031545 | Soil | ENQLGNETFRERAPEPIIKQMEETLSGQRIELQKLSDRLQQLE |
| Ga0307469_102007191 | 3300031720 | Hardwood Forest Soil | SKERQLGDETFRSRAPGDIIKKLEATLAEQRIELQKLQERLAQLELA |
| Ga0307469_105237041 | 3300031720 | Hardwood Forest Soil | ETVRSRAPEKIIQGVQTTLEERRVELKKVSERSQELESGNQ |
| Ga0307468_1011488452 | 3300031740 | Hardwood Forest Soil | QQLGDETFRSRAPEKIIKGMLTTLEERRIELGKSSERLRQLESGA |
| Ga0307475_111691032 | 3300031754 | Hardwood Forest Soil | KDRQLGDETFRSRAPEKIIRGLEETLATQRIELKKLEDRLGQL |
| Ga0307478_100769724 | 3300031823 | Hardwood Forest Soil | FRSRAPEKIIKGLGATLAGQRIELQKLQDRLDQLERGE |
| Ga0307478_117691342 | 3300031823 | Hardwood Forest Soil | SRAPEKIIQGLEKTLGEQRIELKKLMDRLVELEKV |
| Ga0307479_104522521 | 3300031962 | Hardwood Forest Soil | QLGDETFRSRAPEKIIQGLKATLAERRIELAKTMERLTQLSGN |
| Ga0318545_103017902 | 3300032042 | Soil | GNDTFRSKAPEKIIQQMESALAGQRIELQKLSERLGQLGEA |
| Ga0311301_107967891 | 3300032160 | Peatlands Soil | NETFRSRAPEKIIKGLEATLAEQRIELKKLQDRLDQLG |
| Ga0307470_111046531 | 3300032174 | Hardwood Forest Soil | DTASKERQLGDETFRSRAPEKIIQNLQSTLEERRIEIIKVTERIRELESGK |
| Ga0307471_1000809501 | 3300032180 | Hardwood Forest Soil | ITSKQRQLGDETFRSRAPEKIIQGLEVTLAERRIELKKVQDRTRELESGK |
| Ga0307471_1023772012 | 3300032180 | Hardwood Forest Soil | RSRAPEKIIKGMQNTLEERRIELGKSSERLRQLESGA |
| Ga0307471_1025007882 | 3300032180 | Hardwood Forest Soil | DETFRSRAPEKIIQGLQATLEERRIELKKLIERLKELESGN |
| Ga0307472_1000270031 | 3300032205 | Hardwood Forest Soil | NETFRSRAPEHIIRGMETTLTEQRSALQKLQERLKQLEHNT |
| Ga0307472_1010762951 | 3300032205 | Hardwood Forest Soil | QLADDTFRNRAPEKIIQGLETTLAEQRVELSKTTERLSQLNCS |
| ⦗Top⦘ |