NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F067106

Metagenome / Metatranscriptome Family F067106

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F067106
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 120 residues
Representative Sequence MNLELDQFSVTLNKKHFDSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWVDPKDDRNSSE
Number of Associated Samples 105
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 20.00 %
% of genes near scaffold ends (potentially truncated) 41.27 %
% of genes from short scaffolds (< 2000 bps) 81.75 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.206 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(34.921 % of family members)
Environment Ontology (ENVO) Unclassified
(69.841 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(78.571 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.97%    β-sheet: 4.14%    Coil/Unstructured: 46.90%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.21 %
UnclassifiedrootN/A0.79 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000128|SA_S1_NOR08_45mDRAFT_c10048812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1575Open in IMG/M
3300003909|JGI26087J52781_1031200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani567Open in IMG/M
3300006165|Ga0075443_10035929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1655Open in IMG/M
3300006399|Ga0075495_1495041All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1385Open in IMG/M
3300008931|Ga0103734_1003819All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1758Open in IMG/M
3300008933|Ga0103736_1005158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1397Open in IMG/M
3300008934|Ga0103737_1003574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1539Open in IMG/M
3300008935|Ga0103738_1001461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2071Open in IMG/M
3300008993|Ga0104258_1003393All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2858Open in IMG/M
3300009024|Ga0102811_1254139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani657Open in IMG/M
3300009071|Ga0115566_10669769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300009080|Ga0102815_10621922All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani608Open in IMG/M
3300009402|Ga0103742_1011868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1016Open in IMG/M
3300009434|Ga0115562_1224058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300009441|Ga0115007_10032511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani3233Open in IMG/M
3300009441|Ga0115007_10663736All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani697Open in IMG/M
3300009442|Ga0115563_1151289All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani932Open in IMG/M
3300009543|Ga0115099_10817239All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2846Open in IMG/M
3300009593|Ga0115011_10856418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani757Open in IMG/M
3300009599|Ga0115103_1798401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1125Open in IMG/M
3300009606|Ga0115102_10755312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1894Open in IMG/M
3300009606|Ga0115102_10925721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani580Open in IMG/M
3300009677|Ga0115104_10325609All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani585Open in IMG/M
3300012414|Ga0138264_1116058All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani589Open in IMG/M
3300012416|Ga0138259_1647691All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani511Open in IMG/M
3300012516|Ga0129325_1141651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani835Open in IMG/M
3300012523|Ga0129350_1331820All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani689Open in IMG/M
3300012525|Ga0129353_1131666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani561Open in IMG/M
3300012782|Ga0138268_1318941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2140Open in IMG/M
3300012952|Ga0163180_11670611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani538Open in IMG/M
3300012970|Ga0129338_1184431All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2280Open in IMG/M
3300017767|Ga0181406_1209587All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani577Open in IMG/M
3300017771|Ga0181425_1191273All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani644Open in IMG/M
3300017781|Ga0181423_1216636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani721Open in IMG/M
3300018649|Ga0192969_1002167All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2830Open in IMG/M
3300018671|Ga0193571_1018699All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani545Open in IMG/M
3300018692|Ga0192944_1000271All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2674Open in IMG/M
3300018692|Ga0192944_1003968All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1553Open in IMG/M
3300018742|Ga0193138_1001704All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2047Open in IMG/M
3300018765|Ga0193031_1001357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1747Open in IMG/M
3300018765|Ga0193031_1075982All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani568Open in IMG/M
3300018842|Ga0193219_1057476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani598Open in IMG/M
3300018846|Ga0193253_1001534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2874Open in IMG/M
3300018861|Ga0193072_1052682All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani806Open in IMG/M
3300018874|Ga0192977_1001818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2585Open in IMG/M
3300018874|Ga0192977_1018717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1291Open in IMG/M
3300018885|Ga0193311_10006129All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1361Open in IMG/M
3300018899|Ga0193090_1022085All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1385Open in IMG/M
3300018967|Ga0193178_10037452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani691Open in IMG/M
3300018979|Ga0193540_10010098All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1556Open in IMG/M
3300018980|Ga0192961_10002265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2993Open in IMG/M
3300018980|Ga0192961_10003732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2655Open in IMG/M
3300018982|Ga0192947_10171185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani722Open in IMG/M
3300018989|Ga0193030_10008404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1668Open in IMG/M
3300018989|Ga0193030_10021197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1391Open in IMG/M
3300018989|Ga0193030_10145596All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani764Open in IMG/M
3300019021|Ga0192982_10016716All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1708Open in IMG/M
3300019021|Ga0192982_10017296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1692Open in IMG/M
3300019025|Ga0193545_10109579All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani586Open in IMG/M
3300019031|Ga0193516_10097365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1002Open in IMG/M
3300019036|Ga0192945_10008632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1924Open in IMG/M
3300019048|Ga0192981_10018415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2088Open in IMG/M
3300019048|Ga0192981_10065678All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1358Open in IMG/M
3300019048|Ga0192981_10198783All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani783Open in IMG/M
3300019050|Ga0192966_10003201All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2807Open in IMG/M
3300019050|Ga0192966_10048960All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1310Open in IMG/M
3300019050|Ga0192966_10083949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1070Open in IMG/M
3300019051|Ga0192826_10017791All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1888Open in IMG/M
3300019051|Ga0192826_10369436All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani518Open in IMG/M
3300019095|Ga0188866_1008601All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani987Open in IMG/M
3300019125|Ga0193104_1029259All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani758Open in IMG/M
3300019131|Ga0193249_1070238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani839Open in IMG/M
3300019149|Ga0188870_10160545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani501Open in IMG/M
3300021353|Ga0206693_1162516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani803Open in IMG/M
3300021355|Ga0206690_10133434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani605Open in IMG/M
3300021355|Ga0206690_10322377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani562Open in IMG/M
3300021359|Ga0206689_10914592All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani603Open in IMG/M
3300021869|Ga0063107_102210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani530Open in IMG/M
3300021872|Ga0063132_103771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1995Open in IMG/M
3300021872|Ga0063132_106994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1990Open in IMG/M
3300021910|Ga0063100_1021315All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1600Open in IMG/M
3300021912|Ga0063133_1066766All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1159Open in IMG/M
3300021925|Ga0063096_1091303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300023698|Ga0228682_1057687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani525Open in IMG/M
3300025890|Ga0209631_10069381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2160Open in IMG/M
3300026447|Ga0247607_1042618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani786Open in IMG/M
3300026448|Ga0247594_1075351All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani587Open in IMG/M
3300026462|Ga0247568_1003545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2532Open in IMG/M
3300026465|Ga0247588_1066734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani712Open in IMG/M
3300026470|Ga0247599_1055610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani839Open in IMG/M
3300026513|Ga0247590_1019268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1637Open in IMG/M
3300027810|Ga0209302_10178817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1025Open in IMG/M
3300027810|Ga0209302_10358776All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani664Open in IMG/M
3300028106|Ga0247596_1006209All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2236Open in IMG/M
3300028106|Ga0247596_1040534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1027Open in IMG/M
3300028137|Ga0256412_1019237All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2132Open in IMG/M
3300028290|Ga0247572_1021089All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1440Open in IMG/M
3300028290|Ga0247572_1031903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1209Open in IMG/M
3300028330|Ga0247601_1008247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1321Open in IMG/M
3300030709|Ga0307400_10920837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani535Open in IMG/M
3300030720|Ga0308139_1046582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani647Open in IMG/M
3300030721|Ga0308133_1028481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani763Open in IMG/M
3300031579|Ga0308134_1007086All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2485Open in IMG/M
3300031638|Ga0302125_10145611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani756Open in IMG/M
3300031729|Ga0307391_10262258All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani929Open in IMG/M
3300032463|Ga0314684_10188154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1141Open in IMG/M
3300032470|Ga0314670_10325194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani802Open in IMG/M
3300032491|Ga0314675_10492302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani607Open in IMG/M
3300032517|Ga0314688_10045868All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1661Open in IMG/M
3300032518|Ga0314689_10660669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani539Open in IMG/M
3300032519|Ga0314676_10159564All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1229Open in IMG/M
3300032520|Ga0314667_10117011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1284Open in IMG/M
3300032521|Ga0314680_10249478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1053Open in IMG/M
3300032615|Ga0314674_10593133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300032617|Ga0314683_10101735All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1600Open in IMG/M
3300032617|Ga0314683_10289457All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1017Open in IMG/M
3300032666|Ga0314678_10002662All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum2687Open in IMG/M
3300032707|Ga0314687_10014072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani2273Open in IMG/M
3300032711|Ga0314681_10685372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani566Open in IMG/M
3300032713|Ga0314690_10357405All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani726Open in IMG/M
3300032727|Ga0314693_10607025All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani593Open in IMG/M
3300032730|Ga0314699_10051896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1475Open in IMG/M
3300032745|Ga0314704_10656408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani569Open in IMG/M
3300032747|Ga0314712_10133639All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani1137Open in IMG/M
3300032754|Ga0314692_10367964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani778Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine34.92%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater15.87%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine13.49%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater10.32%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.97%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.97%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica3.97%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine2.38%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater2.38%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.38%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.59%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine1.59%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.79%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.79%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.79%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300003909Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_133SG_5_DNAEnvironmentalOpen in IMG/M
3300006165Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNAEnvironmentalOpen in IMG/M
3300006399Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008933Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2BEnvironmentalOpen in IMG/M
3300008934Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2CEnvironmentalOpen in IMG/M
3300008935Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3AEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009024Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.705EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012782Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA30.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012970Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018671Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018861Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002482 (ERX1789410-ERR1719398)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018885Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001654 (ERX1789521-ERR1719396)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019025Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019125Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002761 (ERX1782425-ERR1712222)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021355Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 150m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021869Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-135M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021910Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-87M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021925Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-51M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026462Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 17R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026513Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 51R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028106Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 66R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028330Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 76R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030721Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1117_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032491Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032520Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032521Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032711Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032754Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SA_S1_NOR08_45mDRAFT_1004881233300000128MarineEKEAKKGGLVEKMNKELDQFSVTLNKKHFDSAVQIHEELKSDGFDDVAFKVRTNDVYKKSFTFPQIAHNDFAVDQFESLAVAEQNLNNDPASDNQFDSFLKTADEVASNLKDRYKDQWVDPKDDRASTSE*
JGI26087J52781_103120013300003909MarineSKKSGLVEKMNKELDQFSVTLSKKHFDAAVQIHQELKDDGFDDVAFKVHTNDIYKKSFTFPQIAHNDYAVDQFESLAVAEQNLNGDPSSDNQFDQFLKAADEVASNLKDRYKDQWIDPKDDRSSSSE*
Ga0075443_1003592913300006165MarineIEKKAAEAQKKKEAKKANEIEKMNLELDQFSVTLNKKHFDSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWIDPKDDRNSSE*
Ga0075495_149504113300006399AqueousKKANDIEKMNLELDQFSVSLNKKHFDAAVQLREQIKTESGEEVPLKVHSLDIYKKSFTFPQIAHNDYAVDQFESLAVVEQNLNNDPNDSNSFENFLKTADEVANNLKDRYKDQWIDPKDDRNSSE*
Ga0103734_100381913300008931Ice Edge, Mcmurdo Sound, AntarcticaVTLNKKHYDAALQVRDELKSNNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAETNLNADPQNESQMESFLRTADEVANNLKDRYKEQWVDPKDDRNAATSE*
Ga0103736_100515823300008933Ice Edge, Mcmurdo Sound, AntarcticaLNKKHYDAALQVRDELKSNNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAETNLNADPQNESQMESFLRTADEVANNLKDRYKEQWVDPKDDRNAATSE*
Ga0103737_100357433300008934Ice Edge, Mcmurdo Sound, AntarcticaLNKKHYDAALQVRDELKSNNFEDPSMKVHTMDIYKKSFTFPQIAHNDCAVEQFDALNVAETNLNADPQNESQMESFLRTADEVANNLKDRYKEQWVDPKDDRNAATSE*
Ga0103738_100146153300008935Ice Edge, Mcmurdo Sound, AntarcticaVVVLLVRDELKSNNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAETNLNADPQNDSQMESFLRTADEVANNLKDRYKEQWVDPKDDRNAATSE*
Ga0104258_100339343300008993Ocean WaterLNKKHYDSALQVRDELKANNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAEQNLNADPQNETQMESFLKTADEVANNLKDRYKEQWVDPKDDRNAPASE*
Ga0102811_125413913300009024EstuarineKEKESKKSGLVEKMNKELDQFSVTLSKKHFDAAVQIHQELKDDGFDDVAFKVHTNDIYKKSFTFPQIAHNDYAVDQFESLAVAEQNLNGDPSSDNQFDQFLKAADEVASNLKDRYKDQWIDPKDDRSSSSE*
Ga0115566_1066976923300009071Pelagic MarineMNLELDQFSVSLNKKHFDAAVQLREQIKTESGEEVPLKVHSLDIYKKSFTFPQIAHNDYAVDQFESLAVVEQNLNNDPNDSNSFENFLKTADEVANNLKDRYKDQWIDPKDDRNSSE*
Ga0102815_1062192213300009080EstuarineLDQFSVTLNKKHFDAALQLHEELKADGFDDVPMKVHTNDVYKKSFTFPQIAHNDFAVDQFESLAVAEQNLNNDPNSDNQFAQFLKTADEVASNLKDRYKDQWIDPKDDRATIE*
Ga0103742_101186823300009402Ice Edge, Mcmurdo Sound, AntarcticaHTKLSEKLNSELDSFSVTLNKKHYDAALQVRDELKSNNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAETNLNADPQNESQMESFLRTADEVANNLKDRYKEQWVDPKDDRNAATSE*
Ga0115562_122405823300009434Pelagic MarineMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYK
Ga0115007_1003251143300009441MarineLEQFSVTLNKKHFDDALQSRAELKKAGDDVAITLHTVDTYKKSFTFPQIAHNDYAVEQFETLSVAEQNLNNDPSNDTQYENFIKVANDVATNLKDRYKDQWIDPKDDRATATE*
Ga0115007_1066373613300009441MarineSALQVRDELKANNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAEQNLNADPQNETQMESFLKTADEVANNLKDRYKEQWVDPKDDRNAPASE*
Ga0115563_115128913300009442Pelagic MarineDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWIDPKDDRNSSE*
Ga0115099_1081723953300009543MarineLNKKHYDAALQVRDELKANNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAEQNLNADPQNDSQMESFLKTADEVANNLKDRYKEQWVDPKDDRNTPASE*
Ga0115011_1085641813300009593MarineMDQFSVTLNKKHFDDALQSRAELKKVGEEIPINIHTVDTYKKSFTFPQIAHNDYAVEQFETLSVAEQNLNNDPSNDTQYENFIKVANDVASNLKERYKDQWIDPKDDRATAQE*
Ga0115103_179840113300009599MarineVDKMNQELDQFSVTLSKKHFDAALQIKEELHNDGFDDVSFKVHTNDIYKKSFTFPQIAHNDYAVDQFESLAIVEQNLNNDPANDNQFDQFLKTADDVAGNLKDRYKDQWIDPKDDRATE*
Ga0115102_1075531223300009606MarineMNQELDQFSVTLSKKHFDAALQIKEELHNDGFDDVSFKVHTNDIYKKSFTFPQIAHNDYAVDQFESLAIVEQNLNNDPANDNQFDQFLKTADDVAGNLKDRYKDQWIDPKDDRATE*
Ga0115102_1092572113300009606MarineEHKKKEAKKANDIEKMNLELDQFSVSLNKKHFDAAVQLREQIKTESGEEVPLKVHSLDIYKKSFTFPQIAHNDYAVDQFESLAVVEQNLNNDPNDSNSFENFLKTADEVANNLKDRYKDQWIDPKDDRNSSE*
Ga0115104_1032560913300009677MarineMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWIDPKDDRGTSKTDAE*
Ga0138264_111605813300012414Polar MarineSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWVDPKDDRNSSE*
Ga0138259_164769113300012416Polar MarineQVRDELKSNNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAETNLNADPQNESQMESFLRTADEVANNLKDRYKEQWVDPKDDRNAATSE*
Ga0129325_114165123300012516AqueousDQFSVTLNKKHFDAALQLHEELKADGFDDVPMKVHTNDVYKKSFTFPQIAHNDFAVDQFESLAVAEQNLNNDPNSDNQFDQFLKTADEVATNLKDRYKDQWIDPKDDRATIE*
Ga0129350_133182013300012523AqueousMGKELDQFSVTLNKKHFDAAMAVRDEAKQAGLEDIPLRVHAGDIYKKSFTFPQIAHNDYAVEQFETLTIAEANLNNDPNNESNFEAFVKTADDVALNLKERYKDQWVDPKDDRGVNKKDDSE*
Ga0129353_113166613300012525AqueousQKVEAEKQKKHEKYEQLSEKMGKELDQFSVTLNKKHFDAAMAVRDEAKQAGLEDIPLRVHAGDIYKKSFTFPQIAHNDYAVEQFETLTIAEANLNNDPNNESNFEAFVKTADDVALNLKERYKDQWVDPKDDRGVNKKDDSE*
Ga0138268_131894153300012782Polar MarineMNLELDQFSVSLNKKHFENAVQLREQLKNEGADDVALKVHTMDVYKKSFTFPQIAHNDYAVEQFESLAVVEQNLNNDPTSDNSFDNFIKTADEVANNLKDRYKDQWVDPKDDRNSSE*
Ga0163180_1167061123300012952SeawaterVLSKQKDKFTQELDQFSVTLNKKHFDDALQSRAELKKAGEEVAMNIHTSDTYKKSFTFPQIAHNDYAVEQFETLSVAEQNLNNDPSNETQYENFIKVANDIATNLKDRYKDQWIDPKDDRASAQE*
Ga0129338_118443153300012970AqueousMNKELDEFSVSLNKKHFDACVQINQELKADGLEEVPILVHTSDVYKKSFTFPQIAHNDYAVEQFEALNISEQNLKTDPSNEHVYEAFIKSANEVAGNLKDRYKDQWIDPKDDRLIQSD*
Ga0181406_120958713300017767SeawaterVTLNKKHFDAAMSVKDEAKQAGLEDLPLKVHASDIYKKSFTFPQIAHNDYAVEQFESLAIAESNLNNDPSNENAYEAFVKTADDVALNLKERYKDQWVDPKDDRGVSKKEDSE
Ga0181425_119127323300017771SeawaterMGKELDQFSVTLNKKHFDAAMAVRDEAKQGGLEDIPLKVHASDIYNKSFTFPQIAHNDYAVEQFETLAVAEANLNNDPTSETSFEAFVRTADDVALNLKERYKDQWVDPKDDRGVNKKDDSE
Ga0181423_121663613300017781SeawaterKANEIEKMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWIDPKDDRNSSEXVQKDDXKS
Ga0192969_100216733300018649MarineMTATTDKMNGLMDQFSVTLNKKHFSAAMQVRDEAKTSGIEDVQLRVHASDIYKKSFTFPQIAHNDYAVEQFEALGIAEANLNNDPTNVDAYEAFVKTADDVALNLKERYKDQWVDPKDDRGVVKKEEDN
Ga0193571_101869913300018671MarineMNNLMDQFSVTLNKKHYSAAMQVREEAKAAGLDDLQMRVHAGDIYKKSFTFPQIAHNDYAVEQFETLGIAEQNLNNDPTNDQAYEAFVKTADDVALNLKERYKEQWVDPKDDRGAAKKEDDN
Ga0192944_100027123300018692MarineMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWVDPKDDRNSSEXVQKDDXKSXINCKXKKFAVCKG
Ga0192944_100396823300018692MarineLTSELDSFSVTLNKKHYDSALQVRDELKANNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAEQNLNADPQNETQMESFLKTADEVANNLKDRYKEQWVDPKDDRNAPASEXEAKAHENE
Ga0193138_100170413300018742MarineMGKELDQFSVTLNKKHFDAAIALKDEAKQAGLEDLPMKVHAGDIYKKSFTFPQIAHNDYAVEQFETLAIAESNLNNDPSNENNFEAFVKTADEVAFNLKERYKDQWVDPKDDRGASKKEDTE
Ga0193031_100135723300018765MarineMNNLMEQFSVTLNKKHYTAAMQVREEIKQNGLGDIQPNVHAADIYKKSFTFPQIAHNDYAVEQFEQLGIAEQNLNSDPTNDNAFDAFVKTADDVALNLKERYKEQWVDPKDDRGAAKKDDTE
Ga0193031_107598213300018765MarineNDLDSFSVTLNKKHFDDALSSRAELKKDGDEVPLSIHTVDIYKKSFTFPQIAHNDYAVEQFESLSVAEQNLNNDPTNETQYDNFIKAANDVAANLKERYKDQWIDPKDDRATAQEXIEIRNIEKXRKNQL
Ga0193219_105747613300018842MarineMNSELDQFSVTLNKKHFDSAVQIREQIKTDLNEELPMKVHALDIYKKSFTFPQIAHNDYAVEQFESLAAAEQNLNNDPTNSDTFDAFVRTADEVANNLKDRYKDQWIDPKDDRNSSE
Ga0193253_100153423300018846MarineLNSELDSFSVTLNKKHYDAALQVRDELKANNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAEQNLNADPQNDSQMESFLKTADEVANNLKDRYKEQWVDPKDDRNTPASEXEAKAQKXVNDRKYLCK
Ga0193072_105268213300018861MarineMEQFSVTLNKKHYTAAMQVREEIKQNGLGDIQPNVHAADIYKKSFTFPQIAHNDYAVEQFEQLGIAEQNLNSDPTNDNAFDAFVKTADDVALNLKERYKEQWVDPKDDRGAAKKDDTEXRDATEXKKWIQMKHLALLE
Ga0192977_100181853300018874MarineMNLELDQFSVTLNKKHFDSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWIDPKDDRNSSEXVQKDDXKSXINCKXKKVCSL
Ga0192977_101871733300018874MarineSELDSFSVTLNKKHYDAALQVRDELKSNNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAETNLNADPQNESQMESFLRTADEVANNLKDRYKEQWVDPKDDRNAATSE
Ga0193311_1000612913300018885MarineMRLAQEQKLEAEKKKKEQKLTQLTDKMNSLMDQFSVTLNKKHYSAAMQVRDEAKQAGIEDVQLHVHSGDIYKKSFTFPQIAHNDYAVEQFETLAIAESNLNNDPANEQMYDAFVKTADDVALNLKERYKEQWVDPKDDRGVAKKDDSE
Ga0193090_102208513300018899MarineLNKKHFDSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWIDPKDDRNSSE
Ga0193178_1003745213300018967MarineKHLDAAVQIKDEAKQAGLDDLPIRVNAADIYKKSFTFPQIAHNDYAVEQFEVLSIAEANLNNDPANQNSYEAFVKTADEVAQNLKERYKDQWVDPKDDRGTAKKEDTE
Ga0193540_1001009823300018979MarineNLMEQFSVTLNKKHYTAAMQVREEIKQNGLGDIQPNVHAADIYKKSFTFPQIAHNDYAVEQFEQLGIAEQNLNSDPTNDNAFDAFVKTADDVALNLKERYKEQWVDPKDDRGAAKKDDTE
Ga0192961_1000226523300018980MarineMTATTDKMNGLMDQFSVTLNKKHFSAAMQVRDEAKASGIEDVQLRVHASDIYKKSFTFPQIAHNDYAVEQFEALGIAESNLNNDPTNVDAYEAFVKTADDVALNLKERYKDQWVDPKDDRGVAKKEEDN
Ga0192961_1000373223300018980MarineMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWVDPKDDRNSSEXVQKDDXKSXINCKXKKVCSL
Ga0192947_1017118513300018982MarineKERYEQMSDKMGKELDQFSVTLNKKHYDAAMSLKDEAKQAGLEDLPMKVHAGDIYKKSFTFPQIAHNDYAVEQFETLAIAESNLNNDPSNENNFEAFVKTADEVALNLKERYKDQWVDPKDDRGASKKEDTE
Ga0193030_1000840443300018989MarineMEQFSVTLNKKHYTAAMQVREEIKQNGLGDIQPNVHAADIYKKSFTFPQIAHNDYAVEQFEQLGIAEQNLNSDPTNDNAFDAFVKTADDVALNLKERYKEQWVDPKDDRGAAKKDDTE
Ga0193030_1002119723300018989MarineLDSFSVTLNKKHFDDALSSRAELKKDGDEVPLSIHTVDIYKKSFTFPQIAHNDYAVEQFESLSVAEQNLNNDPTNETQYDNFIKAANDVAANLKERYKDQWIDPKDDRATAQEXIEIRNIEKXRKNQL
Ga0193030_1014559613300018989MarineMNQELDQFSVTLNKKHYDAALAVRDEAKQAGVEDVPIRVHAGDIYKKSFTFPQIAHNDFAVEQFETLSIAESNLNNDPTNDSQYEAFVRTADDVAVNLKERYKDQWVDPKDDRGAQKKEDAEXTTTAPSRD
Ga0192982_1001671623300019021MarineLNSELDSFSVTLNKKHYDAALQVRDELKSNNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAETNLNADPQNESQMESFLRTADEVANNLKDRYKEQWVDPKDDRNAATSEXEAKAQKXAK
Ga0192982_1001729623300019021MarineMNLELDQFSVTLNKKHFDSAVQLREQLKTESGKDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWVDPKDDRNSSE
Ga0193545_1010957913300019025MarineGMDQFSVTLNKKHLDAAVQIKDEAKQAGLDDLPIRVNAADIYKKSFTFPQIAHNDYAVEQFEVLSIAEANLNNDPANQNSYEAFVKTADEVAQNLKERYKDQWVDPKDDRGTAKKEDTE
Ga0193545_1013629013300019025MarineGEEGKQAGLDDLPIKVNAADIYKKSFTFPQIAHNDFAVEQFETLSIAESNLDNDPTNETQFEAFVRTADDVAQNLKERYKDQWVDPKDDRGTQKKEEAEXTTTAP
Ga0193516_1009736513300019031MarineVTLNKKHFDDALQSRAELKKLGEDVSMNIHTVDTYKKSFTFPQIAHNDYAVEQFETLSVAEQNLNNDPSNETQYESFVKVANEVAANLKDRYKDQWIDPKDDRGSSKDEXDENDAKXIKNNA
Ga0192945_1000863223300019036MarineLNKKHYDAALQMRDELKANNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAEQNLNADPQNETQMESFLKTADEVANNLKDRYKEQWVDPKDDRNAPASE
Ga0192981_1001841523300019048MarineMNLELDQFSVTLNKKHFDSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWVDPKDDRNSSEXVQKDDXKSXINCKXKKVCSL
Ga0192981_1006567823300019048MarineLNSELDSFSVTLNKKHYDAALQVRDELKSNNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAETNLNADPQNESQMESFLRTADEVANNLKDRYKEQWVDPKDDRNAATSE
Ga0192981_1019878313300019048MarineVRDEAKTSGIEDVQLRVHASDIYKKSFTFPQIAHNDYAVEQFEALGIAEANLNNDPTNVDAYEAFVKTADDVALNLKERYKDQWVDPKDDRGVVKKEEDN
Ga0192966_1000320153300019050MarineMDVYKKSFTFPQIAHNDYAVEQFESLAVTEQNLNNDPTSDNTFDNFIKTADEVANNLKDRYKDQWVDPKDDRNSSEXIKKEDSKSXIKLQIKKSLYFVRDKDRINNLKN
Ga0192966_1004896033300019050MarineLNKKHYDAALQVRDELKSNNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAETNLNADPQNESQMESFLRTADEVANNLKDRYKEQWVDPKDDRNAATSE
Ga0192966_1008394913300019050MarineKKHFDQALKIKKSAKNEGLEDISIKVHAADIYKKSFTFPQIAHNDFAVEQFDNLNIAEQNLNSDPINADVYDAFVKTADEVAMNLKERYKDQWVDPKDDRGMKISDPVLEMXRNKXTRNEKENIF
Ga0192826_1001779113300019051MarineMTKEMDQFSVTLNKKHLDAAVQIKDEAKQAGLDDLPIRVNAADIYKKSFTFPQIAHNDYAVEQFEVLSIAEANLNNDPANQNSYEAFVKTADEVAQNLKERYKDQWVDPKDDRGTAKKEDTE
Ga0192826_1036943623300019051MarineLKEQIKNESGEEIPLKVHTVDVYKKSFTFPQIAHNDYAVEQFESLAVSEQNLNNDPTSDNTFDNFIKTADEVANNLKDRYKDQWVDPKDDRSSSEXIGNEDXKSXINVQ
Ga0188866_100860113300019095Freshwater LakeMNLELDQFSVTLNKKHFDAAVQLREQIKTESGEEVPMKVHSLDIYKKSFTFPQIAHNDYAVDQFESLAVVEQNLNNDPNDSNSFENFLKTADEVANNLKDRYKDQWIDPKDDRNSSE
Ga0193104_102925913300019125MarineTLNKKHFDDALQSRAELKKAGEEVAMSIHTVDTYKKSFTFPQIAHNDYAVEQFETLSVAEQNLNNDPSNETQYENFIKVANDIATNLKERYKDQWIDPKDDRATSQEXIEKSEQIKNEXKANHYKG
Ga0193249_107023813300019131MarineLTSELDSFSVTLNKKHYDSALQVRDELKANNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAEQNLNADPQNETQMESFLKTADEVANNLKDRYKEQWVDPKDDRNAPASE
Ga0188870_1016054513300019149Freshwater LakeAVQLREQIKTESGEEVPMKVHSLDIYKKSFTFPQIAHNDYAVDQFESLAVVEQNLNNDPNDSNSFENFLKTADEVANNLKDRYKDQWIDPKDDRNSSEXITKEDLKSXM
Ga0206693_116251613300021353SeawaterDSSSVTLNKKHYDAALQVRDELKANNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAEQNLNADPQNDSQMESFLKTADEVANNLKDRYKEQWVDPKDDRNTPASEXEAKAQKXVNDRKYLCK
Ga0206690_1013343413300021355SeawaterSVTLNKKHFDDALASRAELKKSGEDVALNIHTGDTYKKSFTFPQIAHNDYAVDQFEALSVAEQNLSNDPTNETQYENFIKVANETANNLKERYKDQWIDPKDDRSSTEXIENSENXXNEXKN
Ga0206690_1032237713300021355SeawaterMDQFSVTLNKKHFDDALQSRAELKKAGEEIAMNIHTVDTYKKSFTFPQIAHNDYAMEQFEALSVAEQNLNNDPSNETQYENFVKSANEIATNLKERYKD
Ga0206689_1091459213300021359SeawaterFAQELDQFSVTLSRAHFNEALVQRSELKKLGDEPAMKIHTVDTYKKSFTFPQIAHNDYAVEQFEGLSVSEQNLNNDPSNDTQFDSFVKSANEVAQNLKDRYKDQWIDPKDDRVTA
Ga0063107_10221013300021869MarineFSVTLNKKHFDDALQSRAELKKAGDDVAITLHTVDTYKKSFTFPQIAHNDYAVEQFETLSVAEQNLNNDPSNDTQYENFIKVANDVATNLKDRYKDQWIDPKDDRATATEXIDMNEKILTNKXRENQL
Ga0063132_10377173300021872MarineLNKKHYDAALQVRDELKANNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAEQNLNADPQNDSQMESFLKTADEVANNLKDRYKEQWVDPKDDRNASTSEXEAKAQKXVNDRKYLCK
Ga0063132_10699443300021872MarineMDQFSVTLNKKHYSAAMQVREEAKAAGLDDLQMRVHAGDIYKKSFTFPQIAHNDYAVEQFETLGIAEQNLNNDPTNDQAYEAFVKTADDVALNLKERYKEQWVDPKDDRGAAKKEDDN
Ga0063100_102131523300021910MarineLEQFSVTLNKKHFDDALQSRAELKKAGDDVAITLHTVDTYKKSFTFPQIAHNDYAVEQFETLSVAEQNLNNDPSNDTQYENFIKVANDVATNLKDRYKDQWIDPKDDRATATEXIDMNEKILTNKXRENQL
Ga0063133_106676633300021912MarineLDQFSVTLNKKHFDAAMKIKEEAKQAGLEDINVKVHAGDIYKKSFTFPQIAHNDFAVEQFETLAIAEQNLNNDPTNETQYEAFVKTADDVAQNLKERYKDQWVDPKDDRGVNKKEDNAE
Ga0063096_109130313300021925MarineLESKFSELMETFSVTLNNKQFTQALESRAQLKELGAEPNMTVHASDVYKKSFTFPQIAHNDYAVEQFESLSVAESNLNNDPTNDSQMEAFIRSANDVASNLKERYKDQWIDPKDDRQSAQ
Ga0228682_105768713300023698SeawaterSVTLSKKHFDAALQVKEELHNDGFDDVSFKVHTNDIYKKSFTFPQIAHNDYAVDQFESLAIVEQNLNNDPANDNQFDQFLKQADDVAGNLKDRYKDQWIDPKDDRATEXIDTK
Ga0209631_1006938133300025890Pelagic MarineMNLELDQFSVSLNKKHFDAAVQLREQIKTESGEEVPLKVHSLDIYKKSFTFPQIAHNDYAVDQFESLAVVEQNLNNDPNDSNSFENFLKTADEVANNLKDRYKDQWIDPKDDRNSSE
Ga0247607_104261813300026447SeawaterLKLAQEQKVEAEKMKRKEKYEQLADKMGKELDQFSVSLNKKHFDAAMAVRDEAKQGGLEDIPLKVHASDIYKKSFTFPQIAHNDYAVEQFETLAVAEANLNNDPTSETSFEAFVRTADDVALNLKERYKDQWVDPKDDRGVNKKDDSE
Ga0247594_107535123300026448SeawaterMNKELEQFSVTLSKKHFDAAIQVREELVADGFSDVPFKIHTNDIYKKSFTFPQIAHNDYAVDQFESLAIVEQNLNNDPANDNQFDQFLKTADDVAGNLKDRYKDQWIDPKDDRASEXIDRHEKEDFANXNVKQKAF
Ga0247568_100354543300026462SeawaterMDQFSVTLNEKQFKAALDSRAQLKELNAEPNVNVHASEVYKKSFTFPQIAHNDYAVEQFESLSVAEQNLNNDPTNDSQMEAFIRSANDVAANLKERYKDQWIDPKDDRQTA
Ga0247588_106673423300026465SeawaterDQFSVTLNEKQFKAALDSRAQLKELNAEPNVNVHASEVYKKSFTFPQIAHNDYAVEQFESLSVAEQNLNNDPTNDSQMEAFIRSANDVAANLKERYKDQWIDPKDDRQTA
Ga0247599_105561013300026470SeawaterKEKYEQLADKMGKELDQFSVSLNKKHFDAAMAVRDEAKQGGLEDIPLKVHASDIYKKSFTFPQIAHNDYAVEQFETLAVAEANLNNDPTSETSFEAFVRTADDVALNLKERYKDQWVDPKDDRGVNKKDDSE
Ga0247590_101926843300026513SeawaterVDKMNQELDQFSVTLSKKHFDAALQIKEELHNDGFDDVSFKVHTNDIYKKSFTFPQIAHNDYAVDQFESLAIVEQNLNNDPANDNQFDQFLKTADDVAGNLKDRYKDQWIDPKDDRATE
Ga0209302_1017881723300027810MarineLEQFSVTLNKKHFDDALQSRAELKKAGDDVAITLHTVDTYKKSFTFPQIAHNDYAVEQFETLSVAEQNLNNDPSNDTQYENFIKVANDVATNLKDRYKDQWIDPKDDRATATEXIDTNEKILTNKXRENQL
Ga0209302_1035877613300027810MarineSALQVRDELKANNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAEQNLNADPQNETQMESFLKTADEVANNLKDRYKEQWVDPKDDRNAPASEXEAKAHENE
Ga0247596_100620943300028106SeawaterMDQFSVTLNEKQFKAALDSRAQLKELNAEPNVNVHASEVYKKSFTFPQIAHNDYAVEQFESLSVAEQNLNNDPTNDSQMEAFIRTANDVAANLKERYKDQWIDPKDDRQTA
Ga0247596_104053413300028106SeawaterLAQEQKVEAEKMKRKEKYEQLADKMGKELDQFSVSLNKKHFDAAMAVRDEAKQGGLEDIPLKVHASDIYKKSFTFPQIAHNDYAVEQFETLAVAEANLNNDPTSETSFEAFVRTADDVALNLKERYKDQWVDPKDDRGVNKKDDSE
Ga0256412_101923733300028137SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWIDPKDDRNSSEXVQKDDXKS
Ga0247572_102108923300028290SeawaterQKANEIEKMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWIDPKDDRNSSEXVQKDDXKS
Ga0247572_103190313300028290SeawaterLNKKHYDAALQVRDELKTNNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAEQNLNADPQNDSQMESFLKTADEVANNLKDRYKEQWVDPKDDRNTPASE
Ga0247601_100824713300028330SeawaterMDQFSVTLNEKQFKAALDSRAQLKELNAEPNVNVHASEVYKKSFTFPQIAHNDYAVEQFESLSVAEQNLNNDPTNDSQIEAFIRSANDVAANLKERYKDQWIDPKDDRQTA
Ga0307400_1092083713300030709MarineMNLELDQFSVSLNKKHFENAVQLREQLKNEGADDVSLKVHTMDVYKKSFTFPQIAHNDYAVEQFESLAVVEQNLNNDPTSDNSFDNFIKTADEVANNLKDRYKDQWVDPKDDRNSSE
Ga0308139_104658213300030720MarineMNLELDQFSVTLNKKHFDSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPANENNFENFLKTADEVANNLKDRYKDQW
Ga0308133_102848123300030721MarineLNKKHYDSALQVRDELKANNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAEQNLNADPQNETQMESFLKTADEVANNLKDRYKEQWVDPKDDRNAPASE
Ga0308134_100708643300031579MarineMNLELDQFSVTLNKKHFDSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPANENNFENFLKTADEVANNLKDRYKDQWIDPKDDRNSSEXVQKDDXKSXINCKXKKVCSL
Ga0302125_1014561113300031638MarineANEIEKMNLELDQFSVTLNKKHFDSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPANENNFENFLKTADEVANNLKDRYKDQWIDPKDDRNSSE
Ga0307391_1026225833300031729MarineLNKKHFDQALKIKESAKNEGLEDISIKVHAADIYKKSFTFPQIAHNDFAVEQFDNLNIAEQNLNSDPINADVYDAFVKTADEVAMNLKERYKDQWVDPKDDRGMKISDPVLEM
Ga0314684_1018815423300032463SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWVDPKDDRNSSEXVQKDDXKS
Ga0314670_1032519423300032470SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFESFLKTADEVANNLKDRYKDQWVDPKDDRNSSE
Ga0314675_1049230213300032491SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWIDPK
Ga0314688_1004586823300032517SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWVDPKDDRNSSE
Ga0314689_1066066923300032518SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFESFLKTADEVANNLKDRYKDQWVDPKDDRNS
Ga0314676_1015956423300032519SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFESFLKTADEVANNLKDRYKDQWVDPKDDRNSSE
Ga0314667_1011701123300032520SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFESFLKTADEVANNLKDRYKDQWVDPKDDRNSSEXVQKDDXKS
Ga0314680_1024947823300032521SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFESFLKTADEVANNLKDRYKDQWVDPKDDRNSSEXVQKDDXKS
Ga0314674_1059313323300032615SeawaterMNLELDQFSVSLNKKHFENAVQLREQLKTESGEEIPLKVHTQDVYKKSFTFPQIAHNDYAVEQFESLAVVEQNLNNDPTSDNTFDNFIKTADEVANNLKDRYKDQWVDPKDDRNSSEXIKKEDXKSXIKLQMKKSLPL
Ga0314683_1010173533300032617SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFESFLKTADEVANNLKDRYKDQWVDPKDDRNSSEXVQKDDXKSXINCKXKKVCSL
Ga0314683_1028945713300032617SeawaterLTSELDSFSVTLNKKHYDSALQVRDELKANNFEDPSMKVHTMDIYKKSFTFPQIAHNDYAVEQFDALNVAEQNLNADPQNETQMESFLKTADEVANNLKDRYKEQWVDPKDDRNAPASEXEAMAYENE
Ga0314678_1000266253300032666SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFVNFLKTADEVANNLKDRYKDQWVDPKDDRNSSEXVQKDDXKS
Ga0314687_1001407233300032707SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWVDPKDDRNSSEXVQKDDXKS
Ga0314681_1068537213300032711SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWVDPKDDRNSSE
Ga0314690_1035740513300032713SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQWVD
Ga0314693_1060702513300032727SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNKNNFESFLKTADEVANNLKDRYKDQWVDPKDDRNSSEXVQKDDXKS
Ga0314699_1005189633300032730SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFESFLKTADEVANNLKDRYKDQWIDPKDDRNSSERVQ
Ga0314704_1065640813300032745SeawaterKEAKKANEIEKMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFESFLKTADEVANNLKDRYKDQWVDPKDDRNSSEXVQKDDXKS
Ga0314712_1013363913300032747SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTETGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFENFLKTADEVANNLKDRYKDQ
Ga0314692_1036796423300032754SeawaterMNLELDQFSVTLNKKHFDSAVQLREQLKTESGEDVPLKVHALDIYKKSFTFPQIAHNDYAVDQFESLAVVESNLNNDPQNENNFESFLKTADEVANNLKDRYKDQWIDPKDDRNSSERVQKDD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.