| Basic Information | |
|---|---|
| Family ID | F067104 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MKLTKETLREIIKEVIAETDGHPQILKKNKEVAHN |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 88.10 % |
| % of genes near scaffold ends (potentially truncated) | 16.67 % |
| % of genes from short scaffolds (< 2000 bps) | 76.98 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.825 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (38.889 % of family members) |
| Environment Ontology (ENVO) | Unclassified (82.540 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (92.857 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.92% β-sheet: 0.00% Coil/Unstructured: 65.08% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF00085 | Thioredoxin | 3.97 |
| PF00924 | MS_channel | 2.38 |
| PF01467 | CTP_transf_like | 2.38 |
| PF03237 | Terminase_6N | 1.59 |
| PF12847 | Methyltransf_18 | 0.79 |
| PF13671 | AAA_33 | 0.79 |
| PF00629 | MAM | 0.79 |
| PF07230 | Portal_Gp20 | 0.79 |
| PF00565 | SNase | 0.79 |
| PF03420 | Peptidase_S77 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 2.38 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 2.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 52.38 % |
| Unclassified | root | N/A | 46.83 % |
| unclassified Hyphomonas | no rank | unclassified Hyphomonas | 0.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559018|JCVI_READ_1360575 | Not Available | 972 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10098926 | All Organisms → Viruses → Predicted Viral | 1218 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10067003 | All Organisms → Viruses → Predicted Viral | 1316 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10079230 | Not Available | 1148 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10081656 | All Organisms → Viruses → Predicted Viral | 1256 | Open in IMG/M |
| 3300000973|BBAY93_10128682 | Not Available | 640 | Open in IMG/M |
| 3300001450|JGI24006J15134_10020878 | All Organisms → Viruses → Predicted Viral | 3016 | Open in IMG/M |
| 3300001460|JGI24003J15210_10018692 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 2666 | Open in IMG/M |
| 3300001938|GOS2221_1021006 | All Organisms → Viruses → Predicted Viral | 1465 | Open in IMG/M |
| 3300001958|GOS2232_1040086 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED166 | 1498 | Open in IMG/M |
| 3300001963|GOS2229_1006325 | All Organisms → Viruses → Predicted Viral | 1914 | Open in IMG/M |
| 3300001969|GOS2233_1085263 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED166 | 1684 | Open in IMG/M |
| 3300002040|GOScombined01_106410029 | Not Available | 910 | Open in IMG/M |
| 3300002231|KVRMV2_100531258 | All Organisms → Viruses → Predicted Viral | 1432 | Open in IMG/M |
| 3300005605|Ga0066850_10003795 | Not Available | 7294 | Open in IMG/M |
| 3300006165|Ga0075443_10065703 | All Organisms → Viruses → Predicted Viral | 1226 | Open in IMG/M |
| 3300006735|Ga0098038_1031362 | Not Available | 1980 | Open in IMG/M |
| 3300006737|Ga0098037_1031811 | Not Available | 1941 | Open in IMG/M |
| 3300006749|Ga0098042_1038996 | Not Available | 1319 | Open in IMG/M |
| 3300006750|Ga0098058_1042782 | Not Available | 1292 | Open in IMG/M |
| 3300006789|Ga0098054_1202369 | Not Available | 723 | Open in IMG/M |
| 3300006921|Ga0098060_1007689 | All Organisms → Viruses → Predicted Viral | 3616 | Open in IMG/M |
| 3300006921|Ga0098060_1108429 | Not Available | 783 | Open in IMG/M |
| 3300006990|Ga0098046_1015818 | All Organisms → Viruses → Predicted Viral | 1973 | Open in IMG/M |
| 3300007555|Ga0102817_1139446 | Not Available | 540 | Open in IMG/M |
| 3300007956|Ga0105741_1066537 | Not Available | 882 | Open in IMG/M |
| 3300007963|Ga0110931_1113730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED166 | 815 | Open in IMG/M |
| 3300007992|Ga0105748_10511215 | Not Available | 525 | Open in IMG/M |
| 3300008050|Ga0098052_1163931 | Not Available | 876 | Open in IMG/M |
| 3300008050|Ga0098052_1226887 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 719 | Open in IMG/M |
| 3300008050|Ga0098052_1327186 | Not Available | 576 | Open in IMG/M |
| 3300008097|Ga0111541_10389568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED166 | 604 | Open in IMG/M |
| 3300008219|Ga0114905_1150498 | Not Available | 776 | Open in IMG/M |
| 3300008219|Ga0114905_1231312 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 587 | Open in IMG/M |
| 3300008221|Ga0114916_1078193 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 844 | Open in IMG/M |
| 3300009076|Ga0115550_1160618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED166 | 779 | Open in IMG/M |
| 3300009172|Ga0114995_10110058 | All Organisms → Viruses → Predicted Viral | 1545 | Open in IMG/M |
| 3300009173|Ga0114996_10383231 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
| 3300009409|Ga0114993_10925765 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300009409|Ga0114993_10954301 | Not Available | 612 | Open in IMG/M |
| 3300009420|Ga0114994_10204574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1328 | Open in IMG/M |
| 3300009425|Ga0114997_10203538 | Not Available | 1138 | Open in IMG/M |
| 3300009426|Ga0115547_1041941 | All Organisms → Viruses → Predicted Viral | 1654 | Open in IMG/M |
| 3300009428|Ga0114915_1079601 | Not Available | 1003 | Open in IMG/M |
| 3300009435|Ga0115546_1065502 | Not Available | 1368 | Open in IMG/M |
| 3300009481|Ga0114932_10431510 | Not Available | 779 | Open in IMG/M |
| 3300009481|Ga0114932_10669546 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 605 | Open in IMG/M |
| 3300009526|Ga0115004_10192257 | Not Available | 1224 | Open in IMG/M |
| 3300009572|Ga0130020_10127517 | Not Available | 525 | Open in IMG/M |
| 3300009601|Ga0114914_1005150 | All Organisms → Viruses → Predicted Viral | 2427 | Open in IMG/M |
| 3300009679|Ga0115105_11429164 | Not Available | 616 | Open in IMG/M |
| 3300009703|Ga0114933_11023289 | Not Available | 522 | Open in IMG/M |
| 3300009705|Ga0115000_10642317 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 658 | Open in IMG/M |
| 3300009706|Ga0115002_10764977 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 677 | Open in IMG/M |
| 3300009786|Ga0114999_10364516 | Not Available | 1145 | Open in IMG/M |
| 3300009790|Ga0115012_10077311 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 2288 | Open in IMG/M |
| 3300009790|Ga0115012_11329557 | Not Available | 610 | Open in IMG/M |
| 3300010148|Ga0098043_1057688 | Not Available | 1178 | Open in IMG/M |
| 3300010149|Ga0098049_1233766 | Not Available | 560 | Open in IMG/M |
| 3300010151|Ga0098061_1130830 | Not Available | 919 | Open in IMG/M |
| 3300010151|Ga0098061_1158525 | Not Available | 817 | Open in IMG/M |
| 3300010153|Ga0098059_1087881 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1238 | Open in IMG/M |
| 3300010153|Ga0098059_1141571 | Not Available | 949 | Open in IMG/M |
| 3300010153|Ga0098059_1169670 | Not Available | 856 | Open in IMG/M |
| 3300010153|Ga0098059_1206943 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium | 763 | Open in IMG/M |
| 3300010153|Ga0098059_1399528 | Not Available | 519 | Open in IMG/M |
| 3300010155|Ga0098047_10058982 | Not Available | 1512 | Open in IMG/M |
| 3300011013|Ga0114934_10265635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED166 | 779 | Open in IMG/M |
| 3300011013|Ga0114934_10455523 | Not Available | 567 | Open in IMG/M |
| 3300011129|Ga0151672_106073 | All Organisms → Viruses → Predicted Viral | 3326 | Open in IMG/M |
| 3300011253|Ga0151671_1001648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED166 | 1246 | Open in IMG/M |
| 3300012919|Ga0160422_10186788 | Not Available | 1251 | Open in IMG/M |
| 3300012919|Ga0160422_11018630 | Not Available | 536 | Open in IMG/M |
| 3300012920|Ga0160423_10885954 | Not Available | 599 | Open in IMG/M |
| 3300012920|Ga0160423_10945292 | Not Available | 578 | Open in IMG/M |
| 3300012928|Ga0163110_11083832 | All Organisms → Viruses → environmental samples → uncultured virus | 641 | Open in IMG/M |
| 3300012928|Ga0163110_11144148 | Not Available | 624 | Open in IMG/M |
| 3300012953|Ga0163179_10223101 | All Organisms → Viruses → Predicted Viral | 1455 | Open in IMG/M |
| 3300012954|Ga0163111_11827254 | Not Available | 608 | Open in IMG/M |
| 3300017720|Ga0181383_1125262 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED166 | 689 | Open in IMG/M |
| 3300017726|Ga0181381_1088331 | Not Available | 660 | Open in IMG/M |
| 3300017730|Ga0181417_1103675 | Not Available | 688 | Open in IMG/M |
| 3300017775|Ga0181432_1052014 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
| 3300018416|Ga0181553_10265049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED166 | 968 | Open in IMG/M |
| 3300020246|Ga0211707_1005999 | Not Available | 1840 | Open in IMG/M |
| 3300020274|Ga0211658_1024097 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp. | 1361 | Open in IMG/M |
| 3300020394|Ga0211497_10184862 | All Organisms → Viruses → environmental samples → uncultured virus | 801 | Open in IMG/M |
| 3300020404|Ga0211659_10020488 | All Organisms → Viruses → Predicted Viral | 3252 | Open in IMG/M |
| 3300020413|Ga0211516_10367749 | Not Available | 640 | Open in IMG/M |
| 3300020416|Ga0211644_10232333 | Not Available | 757 | Open in IMG/M |
| 3300020436|Ga0211708_10025130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED166 | 2263 | Open in IMG/M |
| 3300020436|Ga0211708_10173071 | All Organisms → Viruses → environmental samples → uncultured virus | 863 | Open in IMG/M |
| 3300020436|Ga0211708_10318371 | Not Available | 634 | Open in IMG/M |
| 3300020438|Ga0211576_10011412 | All Organisms → cellular organisms → Bacteria | 5609 | Open in IMG/M |
| 3300020442|Ga0211559_10114010 | All Organisms → Viruses → Predicted Viral | 1298 | Open in IMG/M |
| 3300020442|Ga0211559_10219708 | Not Available | 895 | Open in IMG/M |
| 3300020450|Ga0211641_10014336 | All Organisms → Viruses → Predicted Viral | 4492 | Open in IMG/M |
| 3300020451|Ga0211473_10027363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED166 | 2812 | Open in IMG/M |
| 3300020451|Ga0211473_10048304 | All Organisms → Viruses → Predicted Viral | 2134 | Open in IMG/M |
| 3300020465|Ga0211640_10221998 | All Organisms → Viruses → Predicted Viral | 1061 | Open in IMG/M |
| 3300020467|Ga0211713_10047486 | All Organisms → cellular organisms → Bacteria | 2102 | Open in IMG/M |
| 3300020470|Ga0211543_10001258 | Not Available | 17147 | Open in IMG/M |
| 3300020470|Ga0211543_10020636 | Not Available | 3698 | Open in IMG/M |
| 3300020470|Ga0211543_10042247 | unclassified Hyphomonas → Hyphomonas sp. | 2435 | Open in IMG/M |
| 3300020470|Ga0211543_10162035 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
| 3300020478|Ga0211503_10045274 | Not Available | 2762 | Open in IMG/M |
| 3300020595|Ga0206126_10005120 | All Organisms → cellular organisms → Bacteria | 12179 | Open in IMG/M |
| 3300020595|Ga0206126_10030206 | All Organisms → Viruses → Predicted Viral | 3305 | Open in IMG/M |
| 3300025099|Ga0208669_1023896 | Not Available | 1542 | Open in IMG/M |
| 3300025101|Ga0208159_1001806 | All Organisms → cellular organisms → Bacteria | 7738 | Open in IMG/M |
| 3300025120|Ga0209535_1028564 | All Organisms → Viruses → Predicted Viral | 2673 | Open in IMG/M |
| 3300025128|Ga0208919_1163085 | Not Available | 685 | Open in IMG/M |
| 3300025131|Ga0209128_1039282 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | 1832 | Open in IMG/M |
| 3300025131|Ga0209128_1119034 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Marinimicrobia → Candidatus Marinimicrobia bacterium | 827 | Open in IMG/M |
| 3300025132|Ga0209232_1028224 | All Organisms → Viruses → Predicted Viral | 2160 | Open in IMG/M |
| 3300025151|Ga0209645_1021039 | All Organisms → Viruses | 2484 | Open in IMG/M |
| 3300025168|Ga0209337_1010460 | All Organisms → cellular organisms → Bacteria | 5859 | Open in IMG/M |
| 3300027801|Ga0209091_10118799 | Not Available | 1400 | Open in IMG/M |
| 3300029318|Ga0185543_1079795 | Not Available | 655 | Open in IMG/M |
| 3300029319|Ga0183748_1000925 | All Organisms → cellular organisms → Bacteria | 19044 | Open in IMG/M |
| 3300029319|Ga0183748_1002666 | Not Available | 9712 | Open in IMG/M |
| 3300029319|Ga0183748_1007424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4900 | Open in IMG/M |
| 3300029319|Ga0183748_1009407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4164 | Open in IMG/M |
| 3300029319|Ga0183748_1038439 | All Organisms → Viruses → Predicted Viral | 1465 | Open in IMG/M |
| 3300029319|Ga0183748_1077967 | All Organisms → Viruses → environmental samples → uncultured virus | 827 | Open in IMG/M |
| 3300031775|Ga0315326_10526508 | Not Available | 758 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 38.89% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 24.60% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 3.97% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.97% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 3.97% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 3.17% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.17% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.17% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 2.38% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 1.59% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.59% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.59% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.59% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.79% |
| Environmental And Host-Associated | Environmental → Aquatic → Marine → Oceanic → Unclassified → Environmental And Host-Associated | 0.79% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.79% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.79% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.79% |
| Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine | 0.79% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.79% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559018 | Marine microbial communities from the Atlantic Ocean, for comparison studies - Ocean6 (GOS4441574) | Environmental | Open in IMG/M |
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001938 | Marine microbial communities from Bedford Basin, Nova Scotia, Canada - GS005 | Environmental | Open in IMG/M |
| 3300001958 | Marine microbial communities from Gulf of Mexico, USA - GS016 | Environmental | Open in IMG/M |
| 3300001963 | Marine microbial communities from Nags Head, North Carolina, USA - GS013 | Environmental | Open in IMG/M |
| 3300001969 | Marine microbial communities from Yucatan Channel, Mexico - GS017 | Environmental | Open in IMG/M |
| 3300002040 | GS000c - Sargasso Station 3 | Environmental | Open in IMG/M |
| 3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
| 3300005605 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV67 | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006750 | Marine viral communities from the Subarctic Pacific Ocean - 19_ETSP_OMZ_AT15317 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007956 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2um | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008050 | Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG | Environmental | Open in IMG/M |
| 3300008097 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_DCM_ad_131m_LV_B (version 2) | Environmental | Open in IMG/M |
| 3300008219 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009172 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 | Environmental | Open in IMG/M |
| 3300009173 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134 | Environmental | Open in IMG/M |
| 3300009409 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009425 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 | Environmental | Open in IMG/M |
| 3300009426 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100420 | Environmental | Open in IMG/M |
| 3300009428 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 | Environmental | Open in IMG/M |
| 3300009435 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009572 | Marine microbial communities associated with Trichodesmium colonies (puff morphology) from Station ALOHA, North Pacific Subtropical Gyre ? SampleE20 | Environmental | Open in IMG/M |
| 3300009601 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 | Environmental | Open in IMG/M |
| 3300009679 | Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300009705 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009786 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010151 | Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaG | Environmental | Open in IMG/M |
| 3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
| 3300010155 | Marine viral communities from the Subarctic Pacific Ocean - 12_ETSP_OMZ_AT15267 metaG | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011129 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.02 | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
| 3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017726 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24 | Environmental | Open in IMG/M |
| 3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
| 3300017775 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17 | Environmental | Open in IMG/M |
| 3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020246 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105) | Environmental | Open in IMG/M |
| 3300020274 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX556029-ERR598943) | Environmental | Open in IMG/M |
| 3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
| 3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
| 3300020478 | Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025131 | Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300031775 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ocean6-_02703770 | 2166559018 | Environmental And Host-Associated | MKLTKKSLREIIKEVISEADGHPQILKKNKEVAHN |
| DelMOSum2010_100989262 | 3300000101 | Marine | MKLTKESLREIIKEVLAETDAHPQILKKNKEVAHN* |
| DelMOSum2011_100670031 | 3300000115 | Marine | RLRSQTMKLTKESLREIIKEVLAETDAHPQILKKNKEVAHN* |
| DelMOSum2011_100792303 | 3300000115 | Marine | MKLTKESLRKIIKEVLAEADGHPQIIKKNKEVAHN* |
| DelMOWin2010_100816562 | 3300000117 | Marine | MKLTKESLREIIKEVLAETDAHPQILKKXKEVAHN* |
| BBAY93_101286821 | 3300000973 | Macroalgal Surface | MKLTKQTLREMIKEVISENDGHPQLLKKNKEVAHN* |
| JGI24006J15134_100208783 | 3300001450 | Marine | MKLTKQTLREIIKEVIAENDGHPKLLKKNKEVAHN* |
| JGI24003J15210_100186925 | 3300001460 | Marine | MKLTKESLREIIKEVLAETDAHPQIXKKNKEVAHN* |
| GOS2221_10210062 | 3300001938 | Marine | MKLTKQSLRKIIKEVLAEADGHPQILKKNKEVAHN* |
| GOS2232_10400863 | 3300001958 | Marine | MKLTKKVLREIIKEVITETDAHPQIVKKNKEVAHN* |
| GOS2229_10063253 | 3300001963 | Marine | MKLTKESLREIIKEVLAEADGHPQILKKNKEVAHN* |
| GOS2233_10852633 | 3300001969 | Marine | MKLTKETLREIIKEVIEENDGHPQIIKKNKEVAHN* |
| GOScombined01_1064100293 | 3300002040 | Marine | MKLTKETLREIIKEVIAEADGHPQIIKKNKEVAHN* |
| KVRMV2_1005312583 | 3300002231 | Marine Sediment | MKLTKESLREIIKEVXAETDAHPQILKKNKEVAHN* |
| Ga0066850_100037951 | 3300005605 | Marine | VKISKDRLMEIIREVIAETDGFPKILNKNKEIEHN* |
| Ga0075443_100657035 | 3300006165 | Marine | MKLTKQSLRKIVKEVLAEADGHPQIIKKNKEVAHN*ATHM |
| Ga0098038_10313621 | 3300006735 | Marine | MKLTKETLREIIKEVIAENDGHPQILKKNKEVAHN* |
| Ga0098037_10318115 | 3300006737 | Marine | MKLTKETLREIIKEVIAENDGHPQIIKKNKEVAHN* |
| Ga0098042_10389964 | 3300006749 | Marine | MKLTKKALREIIKEVIAENDGHPQIIKKNKEVAHN* |
| Ga0098058_10427822 | 3300006750 | Marine | MKLTKSKLRKIIKEELAENDGHPQILKKNKEVAHN* |
| Ga0098054_12023693 | 3300006789 | Marine | NKMKLTKQILREMIKEVISENDGHPQLLKKNKEVAHN* |
| Ga0098060_10076894 | 3300006921 | Marine | MKITKSQLREIIREVIAETDAHPNMLNHNKEVPHN* |
| Ga0098060_11084291 | 3300006921 | Marine | MKLTKESLREIIKEVIAENDGHPQILKKNKEVAHN* |
| Ga0098046_10158184 | 3300006990 | Marine | MKLTKESLREIIKEVIAEADGHPQILKKNKEVAHN* |
| Ga0102817_11394463 | 3300007555 | Estuarine | MKITKKSLRKIIKEVLAEADGHPQILKKNKEVAHN* |
| Ga0105741_10665372 | 3300007956 | Estuary Water | MKLTKESLREIIKEVIAETDAHPQILKKNKEVAHN* |
| Ga0110931_11137302 | 3300007963 | Marine | MKLTKETLREIIKEVLAETDAHPQIIKKNKEVAHN* |
| Ga0105748_105112152 | 3300007992 | Estuary Water | MKLTKESLRKIIKEVIAEVDGHPQILKKNKEVAHN* |
| Ga0098052_11639312 | 3300008050 | Marine | MKITKSVLRKLVKEVMAENDGHPQILKKNKEVAHN* |
| Ga0098052_12268872 | 3300008050 | Marine | MKLTKSQLKEIIKEVIVEADGHPNMVKHNKEVSHN* |
| Ga0098052_13271862 | 3300008050 | Marine | MKLTKSTLRKLVKEVINETDGFPKLLKKNKEVAHN* |
| Ga0111541_103895683 | 3300008097 | Marine | MKLTKETLREIIKEVIAETDAHPQILKKNKEVAHN* |
| Ga0114905_11504981 | 3300008219 | Deep Ocean | MKLTKSKLKEIIKEVISENDGHLNLIKKNKEVAHN* |
| Ga0114905_12313123 | 3300008219 | Deep Ocean | SKTMKLTKETLREIIKEVIAETDGHPQILNKNKEVAHN* |
| Ga0114916_10781932 | 3300008221 | Deep Ocean | MKLTKQTLREIIKEVIAENDGHPQILKKNKEVAHN* |
| Ga0115550_11606183 | 3300009076 | Pelagic Marine | MKLTKESLRKIIKEVIAETDAHPQIIKKNKEVAHN* |
| Ga0114995_101100583 | 3300009172 | Marine | MKLTKQSLRKIVKEVLAEADGHPQILKKNKEVAHN* |
| Ga0114996_103832312 | 3300009173 | Marine | MKLTKQSLRKIIKEVIAEADGHPQILKKNKEVAHN* |
| Ga0114993_109257652 | 3300009409 | Marine | MKLTKETLREIIKEVISENDGHPKLLKKNREVAHN* |
| Ga0114993_109543013 | 3300009409 | Marine | MKLTKESLRKIIKEVIAEADGHPQILKKNKEVAHN* |
| Ga0114994_102045744 | 3300009420 | Marine | MKLTKKSLTKIVKEVLAEADGHPQILKKNKEVAHN* |
| Ga0114997_102035382 | 3300009425 | Marine | MKLTKKSLTKIIKEVLAEADGHPQILKKNKEVAHN* |
| Ga0115547_10419413 | 3300009426 | Pelagic Marine | MKLTKESLREIIKEVIAETDAHPQIIKKNKEVAHN* |
| Ga0114915_10796013 | 3300009428 | Deep Ocean | MKITKESLRKIVKEVLAEADGHPQILKKNKEVAHN* |
| Ga0115546_10655023 | 3300009435 | Pelagic Marine | MKLTKESLREIIKEVLAETDAHPQIIKKNKEVAHN* |
| Ga0114932_104315102 | 3300009481 | Deep Subsurface | MKLTKKSLKKIVKEVLAEVDGHPQLLKKNKEVAHN* |
| Ga0114932_106695462 | 3300009481 | Deep Subsurface | MKLTKETLREIIKEVLAETDAHPQILKKNKEVAHN* |
| Ga0115004_101922573 | 3300009526 | Marine | MKLTKQSLRKIIKEVIAETDGHPQILKKNKEVAHN* |
| Ga0130020_101275172 | 3300009572 | Marine | MKLTKETLREIIKEVIAETDAHPQIIKKNKEVAHN* |
| Ga0114914_10051504 | 3300009601 | Deep Ocean | MKLTKQSLRKIVKEVLAEADGHPQIIKKNKEVAHN* |
| Ga0115105_114291642 | 3300009679 | Marine | MKFTKESLREIIREVLAETDGHPQILKKNKEVAHN* |
| Ga0114933_110232892 | 3300009703 | Deep Subsurface | MKLTKETLREIIKEVIAEADGHPQILKKNKEVAHN* |
| Ga0115000_106423172 | 3300009705 | Marine | MKLTKQTLREIIKEVIAETDGHPNLIKKNKEVVHN* |
| Ga0115002_107649772 | 3300009706 | Marine | MKLTKETLREIIREVITETDGFPQILKKNKEVAHN* |
| Ga0114999_103645162 | 3300009786 | Marine | MKLTKDSLRKIVKEVIAETDGFPQILKKNKEVAHN* |
| Ga0115012_100773112 | 3300009790 | Marine | MKITKSELREIIKEVIAENDGHPQILKKNKEVAHN* |
| Ga0115012_113295572 | 3300009790 | Marine | MKITKSELRKIVKEVIAENDGHPQILRKNKEVAHN* |
| Ga0098043_10576884 | 3300010148 | Marine | MKLTKKALREIIKEVISENDGHPQIIKKNKEVAHN* |
| Ga0098049_12337662 | 3300010149 | Marine | MKITKSVLRKLVKEVLSETDGHPQILKKNKEVAHN* |
| Ga0098061_11308301 | 3300010151 | Marine | MKITRSKLKKIVKEVMNENDGHPQIIKKNKEVPHN* |
| Ga0098061_11585253 | 3300010151 | Marine | MKITKETLRELVREVIAETDAHPQILKKNKEVAHN* |
| Ga0098059_10878813 | 3300010153 | Marine | MKLTKSQLKEIIKEVIAEADGHPNMVKHNKEVSHN* |
| Ga0098059_11415712 | 3300010153 | Marine | MKLTKTRLKEIIKEVITETDGYPNMVKKNKEISHN* |
| Ga0098059_11696702 | 3300010153 | Marine | MKLTKSKLRKIVNEVIAETDGYPQILKKNKEVAHN* |
| Ga0098059_12069432 | 3300010153 | Marine | MKLTKSQLKEIIREVIAETDAHPNMLNHNKEVPHN* |
| Ga0098059_13995282 | 3300010153 | Marine | MKLTKQTLKEMIKEVISENDGHPQILKKNKEVAHN* |
| Ga0098047_100589824 | 3300010155 | Marine | MKLTKSVLRKLVKEVLSETDGHPQILKKNKEVAHN* |
| Ga0114934_102656353 | 3300011013 | Deep Subsurface | MKITKSELRKIVKEVLSEDDGHPQIIKKNKEVAHN* |
| Ga0114934_104555232 | 3300011013 | Deep Subsurface | MKLTKSTLRKLVQEVIAETDGHPKLLNKNKEIAHK* |
| Ga0151672_1060736 | 3300011129 | Marine | MKLTKETLREIIKEVIAENDGHPQILRKNKEVAHN* |
| Ga0151671_10016481 | 3300011253 | Marine | MKLTKETLREIIKEVIAETDGHPQILKKNKEVAHN* |
| Ga0160422_101867883 | 3300012919 | Seawater | MKLTKSVLREIIKEVIAENDGHPQILKKNKEVAHN* |
| Ga0160422_110186302 | 3300012919 | Seawater | MKLTKEKLREIIKEVIAENDAHPQILKKNKEVAHN* |
| Ga0160423_108859543 | 3300012920 | Surface Seawater | MKLTKETLREIIREVIAENDGHPQIIKKNKEVAHN* |
| Ga0160423_109452922 | 3300012920 | Surface Seawater | MKLTKETLREIIREVIAENDGHPQLIKKNKEVAHN* |
| Ga0163110_110838323 | 3300012928 | Surface Seawater | MIINGEIVMKITKKQLKEIIREVITETDGHPQIVKKNKEITHN* |
| Ga0163110_111441482 | 3300012928 | Surface Seawater | MKLTKKVLREIIKEVITENDGHPQIIKKNKEVAHN* |
| Ga0163179_102231012 | 3300012953 | Seawater | MKLTKEALKDIIKEVLAEVDGHPQILKKNKEVAHN* |
| Ga0163111_118272541 | 3300012954 | Surface Seawater | MKLTKEALKEIIKEVIAENDGHPQIIKKNKEVAHN* |
| Ga0181383_11252621 | 3300017720 | Seawater | TMKLTKESLREIIKEVLAETDAHPQILKKNKEVAHN |
| Ga0181381_10883311 | 3300017726 | Seawater | MKLTKESLREIIKEVLAESDAHPQILKKNKEVAHNXATHM |
| Ga0181417_11036751 | 3300017730 | Seawater | MKLTKETLREIIKEVIAEADGHPQILKKNKEVAHNXATHM |
| Ga0181432_10520142 | 3300017775 | Seawater | MKLTKSMLKEIIKEVITETDGFSNLVKKNKEVPHN |
| Ga0181553_102650493 | 3300018416 | Salt Marsh | SRIRSQTMKLTKETLREIIKEVIAENDGHPQILKKNKEVAHN |
| Ga0211707_10059995 | 3300020246 | Marine | MKLTKETLREIIKEVIAENDGHPQILKKNKEVAHN |
| Ga0211658_10240974 | 3300020274 | Marine | MKLTKETLREIIKEVIAETDAHPQILKKNKEVAHN |
| Ga0211497_101848624 | 3300020394 | Marine | MIINGEIVMKITKKQLREIIREVITETDGHPQIVKKNKEVPHN |
| Ga0211659_100204883 | 3300020404 | Marine | MKITKNELRKIVKEVIAENDGHPQILKKNKEVAHN |
| Ga0211516_103677492 | 3300020413 | Marine | MKLTKESLREIIKEVLAETDAHPQILKKNKEVAHNXATHM |
| Ga0211644_102323331 | 3300020416 | Marine | MKLTKKALREIIKEVIAENDGHPQIIKKNKEVAHNXAT |
| Ga0211708_100251304 | 3300020436 | Marine | MKLTKETLREIIKEVIAENDAHPQLVKKNKEVAHN |
| Ga0211708_101730712 | 3300020436 | Marine | MIINGEIVMKITKKQLKEIIREVITETDGHPQIVKKNKEVAHN |
| Ga0211708_103183712 | 3300020436 | Marine | MKLTKETLREIIKEVIAENDGHPQIIKKNKEVAHNXATHMEWK |
| Ga0211576_100114122 | 3300020438 | Marine | MKLTKESLREIIKEVLDETDGHPQILKKNKEVAHN |
| Ga0211559_101140104 | 3300020442 | Marine | MIINGEIVMKITKKQLKEIIREVITETDGHPQIVKKNKEVPHN |
| Ga0211559_102197081 | 3300020442 | Marine | MKLTKKALREIIKEVIAENDGHPQIIKKNKEVAHNXATHMEW |
| Ga0211641_100143364 | 3300020450 | Marine | MKLTKKVLREIIKEVIAENDGHPQILKKNKEVAHN |
| Ga0211473_100273636 | 3300020451 | Marine | MKLTKESLREIIKEVLAETDAHPQILKKNKEVAHN |
| Ga0211473_100483044 | 3300020451 | Marine | MKLTKESLREIIKEVIAEADGHPQILKKNKEVAHN |
| Ga0211640_102219983 | 3300020465 | Marine | QTMKLTKKVLREIIKEVIAENDGHPQILKKNKEVAHN |
| Ga0211713_100474864 | 3300020467 | Marine | MKLTKESLREIIKEVIAETDGHPQIIKKNKEVAHN |
| Ga0211543_100012582 | 3300020470 | Marine | MKLTKKVIKELIEEVISESDGFPQIIKKNKEVAHN |
| Ga0211543_100206365 | 3300020470 | Marine | MKLTKSKLREIIKEVIAEVDGYPQILKKNKEVAHN |
| Ga0211543_100422474 | 3300020470 | Marine | MKLTKSVLRKLVKEVLSENDGHPQIIKKNKEVAHN |
| Ga0211543_101620352 | 3300020470 | Marine | MKLTKETLRKLVKEVLAETDGHPQILKKNKEVPHN |
| Ga0211503_100452746 | 3300020478 | Marine | MKLTKKELTEIIKEVLTETDGHPQILKKNKEVAHN |
| Ga0206126_1000512011 | 3300020595 | Seawater | MKLTKETLREIIKEVIAETDGHPQIVKKNKEVAHN |
| Ga0206126_100302063 | 3300020595 | Seawater | MKLTKETLREIIKEVIAEADGHPQILKKNKEVAHN |
| Ga0208669_10238965 | 3300025099 | Marine | MKLTKESLREIIKEVLAEADGHPQIIKKNKEVAHN |
| Ga0208159_10018061 | 3300025101 | Marine | MKLTKETLREIIKEVIAENDAHPQILKKNKEVAHN |
| Ga0209535_10285644 | 3300025120 | Marine | MKLTKESLRKIIKEVIAEVDGHPQILKKNKEVAHN |
| Ga0208919_11630852 | 3300025128 | Marine | MKLTKESLREIIKEVLAEADGHPQILKKNKEVAHN |
| Ga0209128_10392823 | 3300025131 | Marine | VKISKDRLMEIIREVIAETDGFPKILNKNKEIEHN |
| Ga0209128_11190342 | 3300025131 | Marine | MKLTKFKLREIIKEVIAETDAHPQILKKNKEVAHN |
| Ga0209232_10282243 | 3300025132 | Marine | MKLTKESLREIIKEVIAETDAHPQILKKNKEVAHN |
| Ga0209645_10210394 | 3300025151 | Marine | MKITKSELREIIREVIAETDAHPNMLNHNKEVPHN |
| Ga0209337_10104607 | 3300025168 | Marine | MKLTKQSLRKIVKEVLAEADGHPQILKKNKEVAHN |
| Ga0209091_101187991 | 3300027801 | Marine | MKLTKQSLRKIIKEVITEVDGHPQILKKNKEVAHN |
| Ga0185543_10797951 | 3300029318 | Marine | MKLTKETLREIIKEVIAENDGHPEILRKNKEVPHNXAT |
| Ga0183748_10009254 | 3300029319 | Marine | MKLTKKALREIIKEVITETDAHPQIVKKNKEVAHN |
| Ga0183748_10026662 | 3300029319 | Marine | MKLTKKVLRKIINEVIEENDGHPQILKKNREVAHN |
| Ga0183748_10074247 | 3300029319 | Marine | MKITKSELREIIREVLAETDAHPNMVKHNQEVPHN |
| Ga0183748_10094075 | 3300029319 | Marine | MKLTKETIKEIIREVLSESDGHPQMLRKNKEVAHN |
| Ga0183748_10384391 | 3300029319 | Marine | MKLTKETLREIIREVIAENDGHPQIIRKNKEVAHN |
| Ga0183748_10779671 | 3300029319 | Marine | MTINGEIVMKITKKQLKEIIREVIAETDGHPQIVKKNKEVPHN |
| Ga0315326_105265083 | 3300031775 | Seawater | MKLTKESLREIIKEVLAETDAHPQILKKNKEVAHNXAT |
| ⦗Top⦘ |