NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F067024

Metagenome / Metatranscriptome Family F067024

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F067024
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 41 residues
Representative Sequence MKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKV
Number of Associated Samples 110
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 99.21 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.06 %
Associated GOLD sequencing projects 106
AlphaFold2 3D model prediction Yes
3D model pTM-score0.54

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (53.175 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(17.460 % of family members)
Environment Ontology (ENVO) Unclassified
(29.365 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(54.762 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 39.71%    β-sheet: 0.00%    Coil/Unstructured: 60.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.54
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF02881SRP54_N 3.97
PF13620CarboxypepD_reg 1.59
PF00083Sugar_tr 0.79
PF00376MerR 0.79
PF07593UnbV_ASPIC 0.79
PF08241Methyltransf_11 0.79
PF13599Pentapeptide_4 0.79
PF00210Ferritin 0.79
PF02517Rce1-like 0.79
PF01261AP_endonuc_2 0.79
PF05167DUF711 0.79
PF13517FG-GAP_3 0.79
PF01909NTP_transf_2 0.79
PF13604AAA_30 0.79
PF01609DDE_Tnp_1 0.79
PF05050Methyltransf_21 0.79
PF13087AAA_12 0.79
PF00486Trans_reg_C 0.79
PF00535Glycos_transf_2 0.79
PF13602ADH_zinc_N_2 0.79
PF04357TamB 0.79
PF00873ACR_tran 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 126 Family Scaffolds
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.79
COG2848Uncharacterized conserved protein, UPF0210 familyCell cycle control, cell division, chromosome partitioning [D] 0.79
COG2911Phospholipid transport to the outer membrane protein TamBCell wall/membrane/envelope biogenesis [M] 0.79
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.79
COG3293TransposaseMobilome: prophages, transposons [X] 0.79
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.79
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.79
COG5421TransposaseMobilome: prophages, transposons [X] 0.79
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.79
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms53.17 %
UnclassifiedrootN/A46.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001172|JGI12681J13546_1008106Not Available579Open in IMG/M
3300001661|JGI12053J15887_10188796All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300003372|JGI26336J50218_1009518Not Available666Open in IMG/M
3300004082|Ga0062384_101148110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Eubacteriaceae → Eubacterium → Eubacterium callanderi562Open in IMG/M
3300005467|Ga0070706_101448827Not Available628Open in IMG/M
3300005537|Ga0070730_10714429Not Available634Open in IMG/M
3300005554|Ga0066661_10858514Not Available531Open in IMG/M
3300005566|Ga0066693_10418261Not Available546Open in IMG/M
3300006041|Ga0075023_100132635All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium899Open in IMG/M
3300006050|Ga0075028_100708097Not Available607Open in IMG/M
3300006173|Ga0070716_101672099Not Available524Open in IMG/M
3300006174|Ga0075014_100753475Not Available571Open in IMG/M
3300006914|Ga0075436_100750904Not Available724Open in IMG/M
3300009012|Ga0066710_103056121All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300009088|Ga0099830_11339653All Organisms → cellular organisms → Bacteria595Open in IMG/M
3300009089|Ga0099828_10036660All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3993Open in IMG/M
3300009137|Ga0066709_101905006All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300009649|Ga0105855_1164415All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300009662|Ga0105856_1354499All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300010358|Ga0126370_11774218Not Available596Open in IMG/M
3300010359|Ga0126376_12084963Not Available610Open in IMG/M
3300010360|Ga0126372_10667836All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1009Open in IMG/M
3300010360|Ga0126372_10914195All Organisms → cellular organisms → Bacteria → Acidobacteria881Open in IMG/M
3300010360|Ga0126372_12296322Not Available589Open in IMG/M
3300010361|Ga0126378_10727377All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1104Open in IMG/M
3300010366|Ga0126379_10842323All Organisms → cellular organisms → Bacteria → Acidobacteria1018Open in IMG/M
3300010376|Ga0126381_101245443All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1075Open in IMG/M
3300010376|Ga0126381_101368253All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1023Open in IMG/M
3300010376|Ga0126381_104960601Not Available511Open in IMG/M
3300010398|Ga0126383_11715104Not Available717Open in IMG/M
3300011269|Ga0137392_10260883All Organisms → cellular organisms → Bacteria1427Open in IMG/M
3300011269|Ga0137392_11253049Not Available600Open in IMG/M
3300011270|Ga0137391_10941951All Organisms → cellular organisms → Bacteria705Open in IMG/M
3300012203|Ga0137399_10290679All Organisms → cellular organisms → Bacteria1348Open in IMG/M
3300012205|Ga0137362_10923267All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300012362|Ga0137361_10594982All Organisms → cellular organisms → Bacteria → Acidobacteria1014Open in IMG/M
3300012925|Ga0137419_10593199All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300012929|Ga0137404_11495928Not Available625Open in IMG/M
3300014154|Ga0134075_10375099Not Available626Open in IMG/M
3300015078|Ga0167660_1012494Not Available933Open in IMG/M
3300015264|Ga0137403_10017092All Organisms → cellular organisms → Bacteria7834Open in IMG/M
3300015264|Ga0137403_10164818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2172Open in IMG/M
3300015373|Ga0132257_100630815All Organisms → cellular organisms → Bacteria → Acidobacteria1327Open in IMG/M
3300016270|Ga0182036_10315261All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300016270|Ga0182036_11289733Not Available609Open in IMG/M
3300016357|Ga0182032_10831612Not Available782Open in IMG/M
3300016445|Ga0182038_10362360Not Available1204Open in IMG/M
3300016445|Ga0182038_10828343Not Available812Open in IMG/M
3300017822|Ga0187802_10246299All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300017934|Ga0187803_10190919Not Available807Open in IMG/M
3300017942|Ga0187808_10035592All Organisms → cellular organisms → Bacteria2071Open in IMG/M
3300017946|Ga0187879_10780544Not Available533Open in IMG/M
3300017955|Ga0187817_10097522All Organisms → cellular organisms → Bacteria → Acidobacteria1848Open in IMG/M
3300017955|Ga0187817_11103912Not Available509Open in IMG/M
3300017970|Ga0187783_10451886Not Available932Open in IMG/M
3300017998|Ga0187870_1138328All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300018012|Ga0187810_10037565All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1796Open in IMG/M
3300018012|Ga0187810_10260892Not Available712Open in IMG/M
3300018037|Ga0187883_10190340All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300018090|Ga0187770_10336237Not Available1179Open in IMG/M
3300018431|Ga0066655_11343020Not Available515Open in IMG/M
3300018468|Ga0066662_11083219All Organisms → cellular organisms → Bacteria799Open in IMG/M
3300020581|Ga0210399_11079407Not Available643Open in IMG/M
3300021178|Ga0210408_10291663All Organisms → cellular organisms → Bacteria1300Open in IMG/M
3300021180|Ga0210396_10574900All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300021420|Ga0210394_10211903All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1691Open in IMG/M
3300021474|Ga0210390_11164756Not Available624Open in IMG/M
3300021479|Ga0210410_10004086All Organisms → cellular organisms → Bacteria12832Open in IMG/M
3300021479|Ga0210410_10010052All Organisms → cellular organisms → Bacteria8166Open in IMG/M
3300022507|Ga0222729_1058315Not Available548Open in IMG/M
3300024323|Ga0247666_1022645All Organisms → cellular organisms → Bacteria → Acidobacteria1339Open in IMG/M
3300024330|Ga0137417_1175998All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300025494|Ga0207928_1104193All Organisms → cellular organisms → Bacteria519Open in IMG/M
3300026490|Ga0257153_1111676All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300026528|Ga0209378_1165558All Organisms → cellular organisms → Bacteria → Acidobacteria840Open in IMG/M
3300026529|Ga0209806_1306320Not Available533Open in IMG/M
3300026557|Ga0179587_11152211All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300026959|Ga0207852_1002787All Organisms → cellular organisms → Bacteria2080Open in IMG/M
3300027042|Ga0207766_1023025All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_2_68_5702Open in IMG/M
3300027567|Ga0209115_1160082Not Available502Open in IMG/M
3300027604|Ga0208324_1169189Not Available589Open in IMG/M
3300027703|Ga0207862_1128018All Organisms → cellular organisms → Bacteria → Acidobacteria762Open in IMG/M
3300027727|Ga0209328_10174148Not Available652Open in IMG/M
3300027737|Ga0209038_10242541All Organisms → cellular organisms → Bacteria → Proteobacteria541Open in IMG/M
3300027795|Ga0209139_10089650All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1081Open in IMG/M
3300027846|Ga0209180_10101493All Organisms → cellular organisms → Bacteria → Proteobacteria1640Open in IMG/M
3300027853|Ga0209274_10621225Not Available559Open in IMG/M
3300027867|Ga0209167_10432817Not Available718Open in IMG/M
3300027874|Ga0209465_10289587All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300027874|Ga0209465_10497414Not Available609Open in IMG/M
3300027908|Ga0209006_11308723Not Available560Open in IMG/M
3300028776|Ga0302303_10189580All Organisms → cellular organisms → Bacteria715Open in IMG/M
3300028871|Ga0302230_10437753All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300028906|Ga0308309_10608992All Organisms → cellular organisms → Bacteria → Acidobacteria948Open in IMG/M
3300028906|Ga0308309_11904655Not Available501Open in IMG/M
3300029636|Ga0222749_10466095Not Available679Open in IMG/M
3300030677|Ga0302317_10415098Not Available592Open in IMG/M
3300030737|Ga0302310_10368296All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300031231|Ga0170824_119986383Not Available843Open in IMG/M
3300031234|Ga0302325_12936387Not Available554Open in IMG/M
3300031446|Ga0170820_14811026Not Available526Open in IMG/M
3300031668|Ga0318542_10465229Not Available656Open in IMG/M
3300031708|Ga0310686_109203899All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300031720|Ga0307469_11425346Not Available661Open in IMG/M
3300031720|Ga0307469_12166540Not Available541Open in IMG/M
3300031763|Ga0318537_10373310Not Available526Open in IMG/M
3300031764|Ga0318535_10021481All Organisms → cellular organisms → Bacteria2491Open in IMG/M
3300031770|Ga0318521_10697416All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300031771|Ga0318546_10661623Not Available735Open in IMG/M
3300031890|Ga0306925_10754270All Organisms → cellular organisms → Bacteria → Acidobacteria1014Open in IMG/M
3300031890|Ga0306925_11398758Not Available690Open in IMG/M
3300031910|Ga0306923_10753605All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300031946|Ga0310910_10657232All Organisms → cellular organisms → Bacteria → Acidobacteria830Open in IMG/M
3300031946|Ga0310910_10944086Not Available675Open in IMG/M
3300031962|Ga0307479_10173410All Organisms → cellular organisms → Bacteria2120Open in IMG/M
3300032051|Ga0318532_10181221Not Available748Open in IMG/M
3300032063|Ga0318504_10108313All Organisms → cellular organisms → Bacteria → Acidobacteria1251Open in IMG/M
3300032076|Ga0306924_10894190Not Available983Open in IMG/M
3300032091|Ga0318577_10344128Not Available713Open in IMG/M
3300032180|Ga0307471_103303561All Organisms → cellular organisms → Bacteria571Open in IMG/M
3300032205|Ga0307472_100926981Not Available809Open in IMG/M
3300032261|Ga0306920_102603518All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300032783|Ga0335079_10006671All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae13206Open in IMG/M
3300032954|Ga0335083_10261609All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Desulfuromonadaceae → Desulfuromonas → Desulfuromonas soudanensis1541Open in IMG/M
3300033290|Ga0318519_10867943Not Available557Open in IMG/M
3300033805|Ga0314864_0053843All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium922Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil17.46%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.73%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil7.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.56%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.97%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.97%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa3.97%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil3.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.17%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.17%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.38%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.38%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.38%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.59%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.59%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.59%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.59%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil1.59%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.79%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.79%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.79%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.79%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.79%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001172Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1EnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300003372Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1EnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009649Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-059EnvironmentalOpen in IMG/M
3300009662Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-060EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014154Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015EnvironmentalOpen in IMG/M
3300015078Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11a, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022507Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024323Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025494Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300026959Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027042Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes)EnvironmentalOpen in IMG/M
3300027567Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027703Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes)EnvironmentalOpen in IMG/M
3300027727Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027737Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027867Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300028776Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1EnvironmentalOpen in IMG/M
3300028871Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030677Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030737Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031446Fir Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033805Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12681J13546_100810623300001172Forest SoilMKTWQKVSIGVGAVVVLGSIAWYSVYQANKGVVQVQTGK
JGI12053J15887_1018879613300001661Forest SoilMKTWHKVTIGIGGAIVLGGIVLFGINQANKGVVTVQTA
JGI26336J50218_100951813300003372Bog Forest SoilMKTWKKVLIAVVAVLVLVGIVTFSVNQANKGVVTVQTAKVAAQETLVSQVT
Ga0062384_10114811013300004082Bog Forest SoilVKGNRMKTWKKVLIALAVVVVGGVIVMVSINQANKGVVTVQTVK
Ga0070706_10144882723300005467Corn, Switchgrass And Miscanthus RhizosphereMKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVAKQ
Ga0070730_1071442913300005537Surface SoilMKTWKKVVIGVVVAGVLIGIVLFSVHQANKGVVTVQ
Ga0066661_1085851413300005554SoilMKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVGKQDTL
Ga0066693_1041826113300005566SoilMKTWQKVAIGAAVVAVGAGIVLYSVNQANKGVTTVQTAKVA
Ga0075023_10013263523300006041WatershedsMKVWKKLAIGVGVVVVAGGIVLYSVKQANKDVVTVQSGKVSLEPLVTI
Ga0075028_10070809713300006050WatershedsMKAWKKLAIGVGVVVVAGGIVLYSVKQANKDVVTVQSAKVGLEPLVTIVTSSG
Ga0070716_10167209923300006173Corn, Switchgrass And Miscanthus RhizosphereMKMWQKVAIGATVVVVGAGIVLYSVNQANKGVVTVQTARVAK
Ga0075014_10075347523300006174WatershedsMKTWQKVGLGLGVAALLGGVVWFSINQANKGVVVVQTAKVAK
Ga0075436_10075090413300006914Populus RhizosphereMKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVAKQDTL
Ga0066710_10305612113300009012Grasslands SoilMKMWHKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAQ
Ga0099830_1133965323300009088Vadose Zone SoilMKTWQKVAIGVGAAVGLGGIVLFSVNQANKGVVTV
Ga0099828_1003666013300009089Vadose Zone SoilMKMWQKVAIGATVVVVGAGIVLYSVNQANKGVVTVQTARVAKQDTLL
Ga0066709_10190500613300009137Grasslands SoilMKMWHKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVAKQDTLVS
Ga0105855_116441523300009649Permafrost SoilMKTWQKVTIGVGGVVVLGGIVLFSINQANKGVTTVQTA
Ga0105856_135449913300009662Permafrost SoilMKTWQKVGIGVGTVAVLGGIVLFSVNQANKGVVTVQ
Ga0126370_1177421813300010358Tropical Forest SoilMKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKV
Ga0126376_1208496313300010359Tropical Forest SoilMKMWQKVTIGAAVVVVGAGIVLYSVNQANKGLTTVQTAKV
Ga0126372_1066783613300010360Tropical Forest SoilMKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVAKQDSLVSLVTA
Ga0126372_1091419513300010360Tropical Forest SoilMKMWQKVAIGAAVVVVGAGIVIYSVNQANKGVTTVQTAKV
Ga0126372_1229632213300010360Tropical Forest SoilMKTWQKVGSGFAAAAVVGGIVWFSVNQANKGVVTVQTAKV
Ga0126378_1072737713300010361Tropical Forest SoilMKTWHKVTIGAGVVLVLGGIVLFSVNQANKGVVAVQTAKVT
Ga0126379_1084232323300010366Tropical Forest SoilMKTWQKIGIGVGAAALLGAVVWFSINQANKGIVTVQTAKV
Ga0126381_10124544333300010376Tropical Forest SoilMKRWPKAAIAIGGAATLGGVVWFSVYQANKGLVTVQTAKVAKMETLVSQVT
Ga0126381_10136825333300010376Tropical Forest SoilMKRWQKAAIAIGGAATLGGVVWFSVYQANKGLVTVQTAKVAKMETLVSQVT
Ga0126381_10496060113300010376Tropical Forest SoilMKTWQKVAVGVAVAVVGAGIVLYSVNQANKGVTTVQTAKVAKQDTLVSLVTA
Ga0126383_1171510423300010398Tropical Forest SoilMKTWQKVGSGLAAAAVVGGIVWFSVNQANKGVVTVQT
Ga0137392_1026088323300011269Vadose Zone SoilMKTWQKVGIGLGGVAVLGGIVWFSINQANKGVVTVQTAK
Ga0137392_1125304913300011269Vadose Zone SoilMKMWQKVAIGATVVVVGAGIVLYSVNQANKGVVTVQTARVAKQDTLISL
Ga0137391_1094195113300011270Vadose Zone SoilMKTWQKVGIGVGAVVLLGGVMLFSVNQANKGVVTVQTAK
Ga0137399_1029067923300012203Vadose Zone SoilMRTWHKVTIGAGGSALLGGIVWFTVHQANKGVVTVQ
Ga0137362_1092326713300012205Vadose Zone SoilMKTWHKVAIGAGAVVVLGGIVLFSVNQAHKGVVTV
Ga0137361_1059498213300012362Vadose Zone SoilMKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVITVQTAKVAKQD
Ga0137419_1059319923300012925Vadose Zone SoilMKTWQKVGIGLGGVAVLGGIVWFSINQANKGVVTV
Ga0137404_1149592813300012929Vadose Zone SoilMKTWQKVCIGGGVAVAIAGIVGYSITAANKGVVTVQTAK
Ga0134075_1037509913300014154Grasslands SoilMKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVGKQDTLVSLVT
Ga0167660_101249433300015078Glacier Forefield SoilMKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVA
Ga0137403_1001709253300015264Vadose Zone SoilMKTWQKVCIGGGVAVAIAGIVGYSITAANKGVVTVQTAKVAKQDTLVSIVT
Ga0137403_1016481823300015264Vadose Zone SoilMKTWQKVCIGGGVAVVILGIVGYSITAANKGVVTVQTAKVAKQDTLVSIVT
Ga0132257_10063081513300015373Arabidopsis RhizosphereMKMWHKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVVKQDT
Ga0182036_1031526133300016270SoilMKTWHKVAIGLGGAAVLGGIIWFSINQANKGVVTVQTA
Ga0182036_1128973323300016270SoilMKMWQKVAIGAAVVVVGAGIVLYSVSQATKGVTTVQTAKVAKQD
Ga0182032_1083161213300016357SoilMKMWQKVAIGAAVVVVGAGIVLYSVSQATKGVTTVQTAKVAKQDTLVSLV
Ga0182038_1036236023300016445SoilMKTWHKVGIGLGGALVLGGIVIFSINQANKGVVTV
Ga0182038_1082834323300016445SoilMKMWQKVAIGAAVVVVGTGIILYSINQANKGVITVQTAKVAKQDSLISLVTA
Ga0187802_1024629913300017822Freshwater SedimentMKTWHKIAIGLGGAVLVGGIVWFSINQANKGVVTV
Ga0187803_1019091913300017934Freshwater SedimentMKVWKKVAIGVGVVLAGGGIVAYSVNQANKDVVTVQTAKVGHEHL
Ga0187808_1003559213300017942Freshwater SedimentMAMKTWHKVAIGAGAVAVLGGIVLFSVNQASKGVV
Ga0187879_1078054413300017946PeatlandMKPWKRIAIGVAAVVVLGAITWVSVYQANKGVMTVQTGFAKRED
Ga0187817_1009752223300017955Freshwater SedimentMKTWHKILIAVGGTALVGGIVWFSINQANKGVVTVQTAKVV
Ga0187817_1110391213300017955Freshwater SedimentMVERNSMKTWQKVGIGVGAAVVLGGIVWFSINQANK
Ga0187783_1045188623300017970Tropical PeatlandMKVWQKVGIGVGVAVILVGIVWFSVNQANKGVVTVQTA
Ga0187870_113832833300017998PeatlandMKTWHKVGIGLAGAAVLGGIVWFSINQANKGVVTV
Ga0187810_1003756513300018012Freshwater SedimentMKTWHKVTIGVGGAALLGGIVWFGVNQARKGVVTVQTAKVAT
Ga0187810_1026089213300018012Freshwater SedimentMKTWQKVAIGLGGAALVGGIVWVSINQANKGVVTVQTAK
Ga0187883_1019034013300018037PeatlandMKTWQKVGIGVGAAIALGLIVWFSINQANKGVVTVQTSKVAK
Ga0187770_1033623723300018090Tropical PeatlandMKTWQKVGIGAGVVAVLGGLVLFSVYQVNKGVETVQSGQ
Ga0066655_1134302013300018431Grasslands SoilMKMWHKRAIGAGGVVVAGGIVLFSVKQANKGVVTVQA
Ga0066662_1108321913300018468Grasslands SoilMKTWHKVLIGAGALVVLGGIVLFSVNQANKGVVTV
Ga0210399_1107940723300020581SoilMKTWQKIGIGVAGVLALGGIVWYSVNQANKGVVTVQ
Ga0210408_1029166313300021178SoilMKTWQKVGIGVGAVAVLGGIVLFSVNQANKGVVTV
Ga0210396_1057490013300021180SoilMKTWQKVGIGLGGVAVLGGIVWFSINQANKGVVTVQT
Ga0210394_1021190323300021420SoilMKTWQKAGIVVAGVLCLGGIVWYSVNQASKGVVTV
Ga0210390_1116475613300021474SoilMKTWQKVGIGVGAVVVLGAIVGISVNQANKGVVTVQ
Ga0210410_10004086113300021479SoilMKTWQKVGTGLGGVVVLGGIVLFSINQANKGVVTVQTA
Ga0210410_1001005213300021479SoilMKTWQKVGMGLGGVAVLGGIVWFSINQANKGVVTVQTAK
Ga0222729_105831523300022507SoilMKTWHKVAIGVGAVVVLGGIVLFSVNEANKGVETVQTAKVATQD
Ga0247666_102264523300024323SoilMKMWHKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVAKQ
Ga0137417_117599813300024330Vadose Zone SoilMKTWHKVAIGAGAVVVLGGIVLFSVNQANKGVVTTVQTAK
Ga0207928_110419313300025494Arctic Peat SoilMKTWQKVTIGVGGVVVLGGIVLFSINQANKGVTTVQTAKVASQDALISQVTASGE
Ga0257153_111167613300026490SoilMKMWQKVATGATVVVVGTGIVLYSVNQANKGVITVQTAKVAKQDSLVSLVTASGEIKPTT
Ga0209378_116555823300026528SoilMKTWQKVCIGGGVAVAIAGIVGYSITAANKGVVTVQTAKVAKQD
Ga0209806_130632013300026529SoilMKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVG
Ga0179587_1115221113300026557Vadose Zone SoilMKTWQKVGIAVAVVVVGAGIVLYSVNQANKGVITVQTAKVGKQDRLVSLVTASGEIKPTT
Ga0207852_100278713300026959Tropical Forest SoilMKTWQKVGIGLAAAAVVGGIVWFSVNQANKGVVTV
Ga0207766_102302523300027042Tropical Forest SoilMKTWQKVGIGLAAAAVVGGIVWFSVNQANKGVVTVQ
Ga0209115_116008213300027567Forest SoilMKTWQKVLIAVAVVAVLGGIVWYSVYQNNKGVVTVQTGH
Ga0208324_116918913300027604Peatlands SoilMKAWKKVTIGVGVVIVAGGIVLYSVKQANKDVVTVQSAK
Ga0207862_112801823300027703Tropical Forest SoilMKTWQKVLIGVGGAAILAGVVVVSINQANKGVITV
Ga0209328_1017414813300027727Forest SoilMKTWKKVVIGLVILAALGGIVMYSVNLANKDVVTVQTAKV
Ga0209038_1024254113300027737Bog Forest SoilMKTWQKVAIGVVAVVAIIGIVWFSVNLANKGVVTVQT
Ga0209139_1008965013300027795Bog Forest SoilMKTWKKAVIGVVVAGVLIGIVVFSVNQANKGVVTVQ
Ga0209180_1010149313300027846Vadose Zone SoilMKTWQKVAIGVGAAVGLGGIVLFSVNQANKGVITVQTAKVTPQETLVSQVTASG
Ga0209274_1062122513300027853SoilMKTWKKVVIGLVVAGALIGIVVFSVNQANKGVVTVQTAKVVTSDDLVSL
Ga0209167_1043281733300027867Surface SoilMKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQTAKVAKQDSLVSL
Ga0209465_1028958723300027874Tropical Forest SoilMKTWHKVAIGAGVVVVLGGIVLFSVNQANKGVVTV
Ga0209465_1049741413300027874Tropical Forest SoilMKMWQKVAIGAAVVVVGAGIVMYSVTQANKGVTTVQTAKVAKQDTL
Ga0209006_1130872313300027908Forest SoilMKTWQKVGIGVGAVVILGSISWYSIYQSNKGVVTVQSG
Ga0302303_1018958013300028776PalsaMKTWQKVAIGLGAVVVLGGIVLFSINQANKDVMTVQTAKVSPQPSLVSQ
Ga0302230_1043775313300028871PalsaMKTWQKVAIGLGAVVVLGGIVLFSINQANKDVMTVQTAK
Ga0308309_1060899213300028906SoilMKTWKKVVIGLVAAGVLIGIVVFSVNQANKGVVTVQT
Ga0308309_1190465513300028906SoilMKTWKKAVMGLVVAGVLIGIVVFSVNQANKGVVTVQ
Ga0222749_1046609513300029636SoilMKTWKKVTIGLVVVAALGTIVWISVNAANKGVVTV
Ga0302317_1041509813300030677PalsaMKTWQKVSIGVGAAVVLCSIAWYSVYQANKGVVQV
Ga0302310_1036829613300030737PalsaMKTWQKVAIGLGAVVVLGGIVLFSINQANKDVMTVQTAKVSPQPSLVSQVTASG
Ga0170824_11998638323300031231Forest SoilMKTWQKVGIGLCGAAALGGLVWFSINKANQGVVTVQTAKVAK
Ga0302325_1293638713300031234PalsaMKTWQKVSIGVGAVVVLGSIAWFSIYQANKGVVQVQT
Ga0170820_1481102613300031446Forest SoilMKMWQKVAIGVAVVAVGAGIVLYSVNQANKGVTTVQTAKV
Ga0318542_1046522913300031668SoilMKMWQKVAIGAAAVVVGAGIVLYSINQANKGVTTVQTAKVA
Ga0310686_10920389913300031708SoilMKTWQKVGIGAGVVLVLGGMAWFSAYQVNKGVVAVQ
Ga0307469_1142534613300031720Hardwood Forest SoilMKMWQKVAIGAAVVVVGAGIVIYSVNQANKGVTTVQTAKVAKQDTL
Ga0307469_1216654013300031720Hardwood Forest SoilMKMWQKVAIGAAVVVVGAGIVLYSVNQANKGVTTVQ
Ga0318537_1037331023300031763SoilMKMWQKVAIGAAVVVVGAGIVLYSVSQATKGVTTVQTAKVAKQDTLIS
Ga0318535_1002148133300031764SoilMKTWQKVGSGLAAAAVVGGIVWFSVNQANKGVVTVQTAKVA
Ga0318521_1069741633300031770SoilMKTWHKVTIGAGVLVVLGGIVLFSVNQANKGVVAVQTAK
Ga0318546_1066162323300031771SoilMKMWQKVAIGAAVAVVGAGIVLYSVNQASKGVTTV
Ga0306925_1075427023300031890SoilMKTWHKVGMGLGVAAVLGGVVLYSINQANKGVVTVQTAK
Ga0306925_1139875813300031890SoilMKMWQKVGSGLAAAAVVGGIVWFSVNQAHKGVVTVQTAKVAKQDS
Ga0306923_1075360523300031910SoilMKMWQKVGSGLAAAAVVGGIVWFSVNQAHKGVVTVQTAKVAKQDSLISLVT
Ga0310910_1065723223300031946SoilMKMWQKVAIGAAVVVVGAGIVLYSVSQATKGVTTVQTAKVAKQDTLVSLVT
Ga0310910_1094408613300031946SoilMKTWHKVLIGIGAAAVVSGVVWYSINQANKGVVTVQTAKV
Ga0307479_1017341013300031962Hardwood Forest SoilMKTWQKVLIGGAVVVVIGGVVMYSINAANKGVVTVQTAK
Ga0318532_1018122113300032051SoilMKMWQKVAIGAAVVVVGAGIVLYSVSQATKGVTTVQ
Ga0318504_1010831323300032063SoilMKMWQKVAIGAAVVVVAAGIVLYSVNQANKGVTTVQTAKVAKQDTLVS
Ga0306924_1089419013300032076SoilMKMWQKVAIGAAVVVVGTGIILYSINQANKGVITVQTAKVAKQDSLI
Ga0318577_1034412813300032091SoilMKTWQKVGSGLAAAAVVGGIVWFSVNQANKGVVTV
Ga0307471_10330356113300032180Hardwood Forest SoilMKTWQKVGIGVGGAVVLGGIVLFSVNQANKGVVTV
Ga0307472_10092698113300032205Hardwood Forest SoilMKTWQKVGIGVSAVVVLGGIVGYSVNKANKGVVTVQTAKVAPAETL
Ga0306920_10260351813300032261SoilMKTWHKVTIGAGVLVVLGGIVLFSVNQANKGVVAV
Ga0335079_1000667113300032783SoilMKVWKKVTIGVGVVVLGGGIVLYSVNQANKDVVTVQTAKVGREH
Ga0335083_1026160923300032954SoilMKTWQKVGIGIGVAALLAGLVVFSITQANKGVVTVQTAKVAKMDTLISQ
Ga0318519_1086794313300033290SoilMKTWQKVGIGLAAAAVVGGIVWFSVNQANKGVVTVQTAKVA
Ga0314864_0053843_810_9203300033805PeatlandMKTWQKVAIGLGGAAAIAIIAGISINQANKGVVTVQT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.