| Basic Information | |
|---|---|
| Family ID | F067000 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MLRSLLVLCLVCITAPTLAQEYQSKELADAARDWRQELIDSVPAN |
| Number of Associated Samples | 98 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 94.44 % |
| % of genes near scaffold ends (potentially truncated) | 98.41 % |
| % of genes from short scaffolds (< 2000 bps) | 91.27 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.46 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (75.397 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (56.349 % of family members) |
| Environment Ontology (ENVO) | Unclassified (61.905 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (55.556 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 53.42% β-sheet: 0.00% Coil/Unstructured: 46.58% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.46 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF03446 | NAD_binding_2 | 24.60 |
| PF14833 | NAD_binding_11 | 15.08 |
| PF11251 | DUF3050 | 7.14 |
| PF03466 | LysR_substrate | 4.76 |
| PF12840 | HTH_20 | 3.97 |
| PF01934 | HepT-like | 3.17 |
| PF01548 | DEDD_Tnp_IS110 | 2.38 |
| PF09130 | DUF1932 | 2.38 |
| PF13847 | Methyltransf_31 | 1.59 |
| PF04586 | Peptidase_S78 | 1.59 |
| PF01925 | TauE | 1.59 |
| PF03916 | NrfD | 0.79 |
| PF00805 | Pentapeptide | 0.79 |
| PF07883 | Cupin_2 | 0.79 |
| PF01400 | Astacin | 0.79 |
| PF03061 | 4HBT | 0.79 |
| PF02371 | Transposase_20 | 0.79 |
| PF00498 | FHA | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 3.17 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 3.17 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 3.17 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 2.38 |
| COG0730 | Sulfite exporter TauE/SafE/YfcA and related permeases, UPF0721 family | Inorganic ion transport and metabolism [P] | 1.59 |
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 1.59 |
| COG1357 | Uncharacterized conserved protein YjbI, contains pentapeptide repeats | Function unknown [S] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 75.40 % |
| Unclassified | root | N/A | 24.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003505|JGIcombinedJ51221_10473723 | Not Available | 505 | Open in IMG/M |
| 3300005167|Ga0066672_10967647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 522 | Open in IMG/M |
| 3300005184|Ga0066671_10612490 | Not Available | 707 | Open in IMG/M |
| 3300005518|Ga0070699_100689984 | Not Available | 933 | Open in IMG/M |
| 3300005610|Ga0070763_10072848 | All Organisms → cellular organisms → Bacteria | 1683 | Open in IMG/M |
| 3300006175|Ga0070712_100064181 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2603 | Open in IMG/M |
| 3300006796|Ga0066665_10797020 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300007258|Ga0099793_10098384 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1351 | Open in IMG/M |
| 3300009143|Ga0099792_10558956 | Not Available | 724 | Open in IMG/M |
| 3300010046|Ga0126384_11098743 | Not Available | 729 | Open in IMG/M |
| 3300010361|Ga0126378_10172451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2223 | Open in IMG/M |
| 3300010376|Ga0126381_101895927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 860 | Open in IMG/M |
| 3300010376|Ga0126381_104509063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
| 3300010398|Ga0126383_13023620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 549 | Open in IMG/M |
| 3300011270|Ga0137391_10229621 | Not Available | 1611 | Open in IMG/M |
| 3300012362|Ga0137361_10809566 | Not Available | 852 | Open in IMG/M |
| 3300012362|Ga0137361_11318946 | Not Available | 646 | Open in IMG/M |
| 3300012363|Ga0137390_11383282 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 648 | Open in IMG/M |
| 3300012363|Ga0137390_11591995 | Not Available | 591 | Open in IMG/M |
| 3300012685|Ga0137397_10291158 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1217 | Open in IMG/M |
| 3300012917|Ga0137395_10347932 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1056 | Open in IMG/M |
| 3300012923|Ga0137359_11424711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300012971|Ga0126369_11792180 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
| 3300016294|Ga0182041_11497887 | Not Available | 621 | Open in IMG/M |
| 3300016319|Ga0182033_10408102 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1150 | Open in IMG/M |
| 3300016319|Ga0182033_11737697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 565 | Open in IMG/M |
| 3300016371|Ga0182034_11328111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 628 | Open in IMG/M |
| 3300016404|Ga0182037_10230216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1455 | Open in IMG/M |
| 3300016404|Ga0182037_11767495 | Not Available | 552 | Open in IMG/M |
| 3300016422|Ga0182039_11000191 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
| 3300018433|Ga0066667_10409636 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1098 | Open in IMG/M |
| 3300020579|Ga0210407_10517745 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300021170|Ga0210400_11633123 | Not Available | 508 | Open in IMG/M |
| 3300021362|Ga0213882_10176283 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300021478|Ga0210402_10518041 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1107 | Open in IMG/M |
| 3300021560|Ga0126371_10291670 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0088 | 1756 | Open in IMG/M |
| 3300021560|Ga0126371_10292736 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Ai1a-2 | 1753 | Open in IMG/M |
| 3300021560|Ga0126371_10644614 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1208 | Open in IMG/M |
| 3300021560|Ga0126371_12739566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 598 | Open in IMG/M |
| 3300025915|Ga0207693_10160848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1766 | Open in IMG/M |
| 3300025929|Ga0207664_11495270 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 597 | Open in IMG/M |
| 3300026312|Ga0209153_1247137 | Not Available | 577 | Open in IMG/M |
| 3300026489|Ga0257160_1026144 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300026547|Ga0209156_10131106 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1223 | Open in IMG/M |
| 3300027297|Ga0208241_1036318 | Not Available | 767 | Open in IMG/M |
| 3300027603|Ga0209331_1081049 | Not Available | 804 | Open in IMG/M |
| 3300027603|Ga0209331_1084509 | Not Available | 784 | Open in IMG/M |
| 3300027783|Ga0209448_10136904 | Not Available | 819 | Open in IMG/M |
| 3300027874|Ga0209465_10413481 | Not Available | 675 | Open in IMG/M |
| 3300028047|Ga0209526_10469819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 825 | Open in IMG/M |
| 3300029636|Ga0222749_10185371 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 1032 | Open in IMG/M |
| 3300031446|Ga0170820_12253478 | Not Available | 626 | Open in IMG/M |
| 3300031543|Ga0318516_10073540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1899 | Open in IMG/M |
| 3300031545|Ga0318541_10036712 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2463 | Open in IMG/M |
| 3300031545|Ga0318541_10290741 | Not Available | 910 | Open in IMG/M |
| 3300031545|Ga0318541_10490798 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 687 | Open in IMG/M |
| 3300031561|Ga0318528_10152269 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1232 | Open in IMG/M |
| 3300031564|Ga0318573_10174311 | Not Available | 1134 | Open in IMG/M |
| 3300031564|Ga0318573_10244739 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 955 | Open in IMG/M |
| 3300031564|Ga0318573_10307429 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 849 | Open in IMG/M |
| 3300031572|Ga0318515_10247027 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 957 | Open in IMG/M |
| 3300031668|Ga0318542_10149064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1161 | Open in IMG/M |
| 3300031668|Ga0318542_10412154 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
| 3300031679|Ga0318561_10199955 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 1084 | Open in IMG/M |
| 3300031679|Ga0318561_10648039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 581 | Open in IMG/M |
| 3300031682|Ga0318560_10086084 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1608 | Open in IMG/M |
| 3300031719|Ga0306917_10849373 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 715 | Open in IMG/M |
| 3300031724|Ga0318500_10528928 | Not Available | 594 | Open in IMG/M |
| 3300031736|Ga0318501_10178074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1105 | Open in IMG/M |
| 3300031736|Ga0318501_10387693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 754 | Open in IMG/M |
| 3300031736|Ga0318501_10844420 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300031763|Ga0318537_10111969 | Not Available | 1012 | Open in IMG/M |
| 3300031768|Ga0318509_10446362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 723 | Open in IMG/M |
| 3300031770|Ga0318521_10570237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 683 | Open in IMG/M |
| 3300031771|Ga0318546_10294990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1121 | Open in IMG/M |
| 3300031777|Ga0318543_10100738 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1241 | Open in IMG/M |
| 3300031778|Ga0318498_10377695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 631 | Open in IMG/M |
| 3300031779|Ga0318566_10298656 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 797 | Open in IMG/M |
| 3300031781|Ga0318547_11020751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
| 3300031793|Ga0318548_10360663 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 713 | Open in IMG/M |
| 3300031795|Ga0318557_10321959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 710 | Open in IMG/M |
| 3300031795|Ga0318557_10380410 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
| 3300031796|Ga0318576_10133792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 1150 | Open in IMG/M |
| 3300031797|Ga0318550_10449249 | Not Available | 623 | Open in IMG/M |
| 3300031798|Ga0318523_10026515 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
| 3300031798|Ga0318523_10282590 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 828 | Open in IMG/M |
| 3300031799|Ga0318565_10189140 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1001 | Open in IMG/M |
| 3300031805|Ga0318497_10344680 | Not Available | 832 | Open in IMG/M |
| 3300031805|Ga0318497_10610212 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 612 | Open in IMG/M |
| 3300031819|Ga0318568_10512860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 748 | Open in IMG/M |
| 3300031820|Ga0307473_11369792 | Not Available | 532 | Open in IMG/M |
| 3300031833|Ga0310917_10324985 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1042 | Open in IMG/M |
| 3300031835|Ga0318517_10255023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 792 | Open in IMG/M |
| 3300031860|Ga0318495_10269108 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata | 761 | Open in IMG/M |
| 3300031879|Ga0306919_11532318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
| 3300031890|Ga0306925_10885391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 919 | Open in IMG/M |
| 3300031897|Ga0318520_10719238 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300031897|Ga0318520_10776421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 601 | Open in IMG/M |
| 3300031912|Ga0306921_10027777 | Not Available | 6280 | Open in IMG/M |
| 3300031941|Ga0310912_10019300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4487 | Open in IMG/M |
| 3300031941|Ga0310912_10232806 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1414 | Open in IMG/M |
| 3300031942|Ga0310916_10049290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3211 | Open in IMG/M |
| 3300031942|Ga0310916_11268719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 607 | Open in IMG/M |
| 3300031946|Ga0310910_10507481 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 957 | Open in IMG/M |
| 3300031946|Ga0310910_10596014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas aeruginosa group → Pseudomonas aeruginosa | 876 | Open in IMG/M |
| 3300031947|Ga0310909_10062522 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2899 | Open in IMG/M |
| 3300031947|Ga0310909_10119006 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
| 3300031959|Ga0318530_10442733 | Not Available | 539 | Open in IMG/M |
| 3300031981|Ga0318531_10023515 | All Organisms → cellular organisms → Bacteria | 2481 | Open in IMG/M |
| 3300032009|Ga0318563_10744741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
| 3300032039|Ga0318559_10066913 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1539 | Open in IMG/M |
| 3300032041|Ga0318549_10092057 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1313 | Open in IMG/M |
| 3300032042|Ga0318545_10024867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1929 | Open in IMG/M |
| 3300032043|Ga0318556_10156082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1179 | Open in IMG/M |
| 3300032043|Ga0318556_10421194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → Methyloferula → Methyloferula stellata | 698 | Open in IMG/M |
| 3300032043|Ga0318556_10455384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 669 | Open in IMG/M |
| 3300032054|Ga0318570_10410546 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300032055|Ga0318575_10087864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1490 | Open in IMG/M |
| 3300032055|Ga0318575_10451066 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300032064|Ga0318510_10111689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1050 | Open in IMG/M |
| 3300032065|Ga0318513_10079697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1510 | Open in IMG/M |
| 3300032174|Ga0307470_10205467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1263 | Open in IMG/M |
| 3300032205|Ga0307472_101444614 | Not Available | 669 | Open in IMG/M |
| 3300032261|Ga0306920_102526032 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium archetypum | 706 | Open in IMG/M |
| 3300033289|Ga0310914_10012941 | Not Available | 6264 | Open in IMG/M |
| 3300033290|Ga0318519_10608573 | Not Available | 664 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 56.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.97% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.38% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.38% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.79% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026312 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027297 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF047 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032042 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f26 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ51221_104737231 | 3300003505 | Forest Soil | MLRALLVFCLVFAAAPAMAQEYQSKDLSDAARDWRRELIDG |
| Ga0066672_109676471 | 3300005167 | Soil | MLRSLLVLCLVCIAAPAMAQEYKSKELADAARDWRQELIDGIPANKKQPNL |
| Ga0066671_106124901 | 3300005184 | Soil | MLRAFLVLFLVSVAASALGQEYQSKELAQAASDWRRELIE |
| Ga0070699_1006899841 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRSLLVLCLVCIAAPAMAQEYKSKELADAARDWRQELID |
| Ga0070763_100728481 | 3300005610 | Soil | MLRALLVLCLVSVAAPALGQEYQSKELAQAASDWRRELIERIPA |
| Ga0070712_1000641815 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRALLLFCLVSAAAPAVAQEYQSKELADAARDWRRELIDSVPANKKQ |
| Ga0066665_107970201 | 3300006796 | Soil | MLRALLVLCLVSIAAPGLAQEYQSKELADAAGGWRRELI |
| Ga0099793_100983842 | 3300007258 | Vadose Zone Soil | MLRSLLVLWLVCIAAPTLAQEYTSRDLADAARDWRREVIDGIPANKKQ |
| Ga0099792_105589563 | 3300009143 | Vadose Zone Soil | MLRGLLVFCLVCVAGPALAQEYQSKELADAARDWRQELI |
| Ga0126384_110987432 | 3300010046 | Tropical Forest Soil | MLRTLLFLVVFAAAPAAAQEYQSKELADAAHEWRQELIDTVPANKKQP |
| Ga0126378_101724512 | 3300010361 | Tropical Forest Soil | MLRALLLLLVFAAAPVVAQEYQSKELADAARDWRRELIDSIPANKK |
| Ga0126381_1018959272 | 3300010376 | Tropical Forest Soil | MLRSLLVLCLVFAAPALAQEYQSKELADAARDWRQELIDSVPANKKQP |
| Ga0126381_1045090631 | 3300010376 | Tropical Forest Soil | MLRSLLVLCLVFASPALAQEYQSKELADAARDWRQELIDS |
| Ga0126383_130236201 | 3300010398 | Tropical Forest Soil | MLRSLLLLCLVCVATPVRGQEYQSKELADAAREWRQQLITSVPANKK |
| Ga0137391_102296214 | 3300011270 | Vadose Zone Soil | MLRALLVFCLVCVAGPALAQEYQSKELADAARDWRQQLIDSVPANK |
| Ga0137361_108095662 | 3300012362 | Vadose Zone Soil | VLRALLVFCLVCVAGPALAQEYQSKELADAARAWRQELIDSIPANKKQPG |
| Ga0137361_113189462 | 3300012362 | Vadose Zone Soil | MLRALLVFCLVCVAAPAPAQEYQSKELADAARDWRQQLIDSIP |
| Ga0137390_113832822 | 3300012363 | Vadose Zone Soil | MLRGLLVFCLVCVAAPALAQEYQSKELADAARNQQQDLS |
| Ga0137390_115919951 | 3300012363 | Vadose Zone Soil | MLRSLLVFCLVWVTVPALAQEYQSKELADAARDWRQELI |
| Ga0137397_102911582 | 3300012685 | Vadose Zone Soil | MLRSLLVLCLVCIAAPTLAQEYTSRDLADAARDWRRELIDGIPA |
| Ga0137395_103479322 | 3300012917 | Vadose Zone Soil | MLRALLVLCLVSAAAPAVGQEYQSKELADAARDWRRELINSVPA |
| Ga0137359_114247111 | 3300012923 | Vadose Zone Soil | MLRLLLVLCLVCVAAPAMAQEYTSKELADAARDWRRELIDGIPANRKQ |
| Ga0126369_117921801 | 3300012971 | Tropical Forest Soil | MLRSLLVLCLVCVAAPTLAQEYRSQDLADAARGWRQELIDGIPA |
| Ga0182041_114978872 | 3300016294 | Soil | MLRSLLVLCLITVASPALAQDYQSKELADAARDWRQQLIDSIPA |
| Ga0182033_104081022 | 3300016319 | Soil | MLRSLFVFCLVCFTASALAQEYQSKELADAARDWRQELIDSIPAN |
| Ga0182033_117376971 | 3300016319 | Soil | MLRLLMVFCLVCFSAPTLAQEYQSKELADAALDWRQE |
| Ga0182034_113281111 | 3300016371 | Soil | MLRALLLLVFAAAPAAAQDYQSKELADAAREWRQELINSIPANKKQPNL |
| Ga0182037_102302161 | 3300016404 | Soil | MLRLLLVFCLVCFTAPALAQEYQSKELAEAARDWRQEL |
| Ga0182037_117674951 | 3300016404 | Soil | MLRSLLVFCLVCVGAPALAQEYQPRELADAARVWRQELIDSI |
| Ga0182039_110001912 | 3300016422 | Soil | MLRALLLLFVFAAAPAAAQEYQSKELADAARDWRQELIDSVPAN |
| Ga0066667_104096361 | 3300018433 | Grasslands Soil | MLRASLVFCLVSIAAPALAQEYQSKELADAARDWRREL |
| Ga0210407_105177451 | 3300020579 | Soil | MLRALLLFVVLAVAPAAAQEYQSKELADAARDWRQELIGSVPA |
| Ga0210400_116331232 | 3300021170 | Soil | MLRALLVLCLVSTATPALAQEYQSKELTDAAADWRRELI |
| Ga0213882_101762831 | 3300021362 | Exposed Rock | MLRALLVLCLVSLAAPALGQEFQPKNLADAAKDWRRELIERIPANKRQPA |
| Ga0210402_105180412 | 3300021478 | Soil | MLRSLLVFCLLWVTVPALAQEYQSKELADAARDWRQELIDGIPANKKQP |
| Ga0126371_102916703 | 3300021560 | Tropical Forest Soil | MLRTLLVVCLVGIVSPVLAQEYQSKELADAARDWRRQLIDSIRANK |
| Ga0126371_102927361 | 3300021560 | Tropical Forest Soil | MLRALLLLAVFAALPAVAQEYQSKELADAARDWRRELIDSVPANR |
| Ga0126371_106446142 | 3300021560 | Tropical Forest Soil | MLRSLLVLCLVFTSPALAQEYQSKELADAARDWRQEL |
| Ga0126371_127395662 | 3300021560 | Tropical Forest Soil | MLRSLLVLCLVFASPALAQEYQSKELADAARDWRQELID |
| Ga0207693_101608483 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MLRALLVFCLVSVAAPALAQEYQSKELADAARDWRRELIDSVPANKKQPALI |
| Ga0207664_114952701 | 3300025929 | Agricultural Soil | MLRALLVLCLVSLAAPALGQEYQSKDLAEAANNWRRE |
| Ga0209153_12471372 | 3300026312 | Soil | LRAFLVLFLVSVAASALGQEYQSKELAQAASDWRRELIE |
| Ga0257160_10261441 | 3300026489 | Soil | MLRALLVLCLVSTAAPGMAQEYQSKELADAARDWRRELIDSVPANKKQPALIA |
| Ga0209156_101311061 | 3300026547 | Soil | MLRALLVFCLVSMAAPALAQEYQSKELADAARDWRRGLIDSI |
| Ga0208241_10363181 | 3300027297 | Forest Soil | MLRALLVLCLVSTAAPAVAQEYQSKDLSDAARDWRRE |
| Ga0209331_10810491 | 3300027603 | Forest Soil | MLRALLVLCLVSTAAPGMAQEYQSKELADAARDWRRELIDSV |
| Ga0209331_10845092 | 3300027603 | Forest Soil | MLRSLLVLCLVCIAAPAMAQEYKSKELADAARDWRQEL |
| Ga0209448_101369041 | 3300027783 | Bog Forest Soil | MLRALLVLCLVSVAAAAVAQEYQSKELSDAARDWRRELIDSVPANKK |
| Ga0209465_104134811 | 3300027874 | Tropical Forest Soil | MLRSLLVLCLVFASPALAQEYQSKELADAARDWRQELIDSVPAH |
| Ga0209526_104698191 | 3300028047 | Forest Soil | MLRALLVFCLVSVAAPAMAQEYQSKELADAARDWRRELIDSVPANKKQ |
| Ga0222749_101853711 | 3300029636 | Soil | MLRALLVLCLVSTAAPAVTQEYQSKDLSDAARDWRRELIDSVPA |
| Ga0170820_122534782 | 3300031446 | Forest Soil | MLRALLVLCLVSIGAPGLAQEYKSKELADAASGWRRELID |
| Ga0318516_100735402 | 3300031543 | Soil | MLRSLLLVFVFAAAPALAQEYRSKELADAARDWRQELIDSLPANKKQPSV |
| Ga0318541_100367126 | 3300031545 | Soil | MLRALLLLFVFVAAPAAAQEYQSKELADAARDWRQELIDSVPANKKQ |
| Ga0318541_102907413 | 3300031545 | Soil | MLRALLLLFVFAAAPAAAQEYQSKELADAARDWRQEL |
| Ga0318541_104907982 | 3300031545 | Soil | MLRPLLVFCLVCVASPALAQDYQSRELADAARDWRQQLID |
| Ga0318528_101522692 | 3300031561 | Soil | MLRALLLLVFAAAPAAAQDYQSKELADAAREWRQELINGTAR |
| Ga0318573_101743112 | 3300031564 | Soil | MLRLLMVFCLVCVTAPTLAQEYQSKELADAALDWRQELIDSVPAN |
| Ga0318573_102447391 | 3300031564 | Soil | MLRLPSVFCLICFTVSALAQEYQSKELADAARDWRQELIDSVPANKK |
| Ga0318573_103074291 | 3300031564 | Soil | MLRALLLVLVFAATPAAAQEYQSKELADAARDWRRELIDS |
| Ga0318515_102470271 | 3300031572 | Soil | MLRLLMVFCLVCFSAPTLAQEYQSKELADAARDWWQELIDSVPANKKQPN |
| Ga0318542_101490642 | 3300031668 | Soil | MLRLPSVFCLICFTVSALAQEYQSKELADAARDWRQELIDSVP |
| Ga0318542_104121542 | 3300031668 | Soil | MLRALLVLCLVSTAAPGLTQEYQSKELAAAASSLD |
| Ga0318561_101999551 | 3300031679 | Soil | MLRALLVLCLVSTAAPGLTQEYQSKELAAAASDWRRELGDRIP |
| Ga0318561_106480391 | 3300031679 | Soil | MLRSLFVICLVCVASPALAQEYQSKELADAARDWRRELIDSVPANKKQPS |
| Ga0318560_100860841 | 3300031682 | Soil | MLRLLLVFCLVCFTAPALAQEYQSKELAEAARDWRQELIDIV |
| Ga0306917_108493731 | 3300031719 | Soil | LRALLLLFVFVAAPAAAQEYQSKELADAARDWRQELI |
| Ga0318500_105289281 | 3300031724 | Soil | LRALLLLFVFVAAPAAAQEYQSKELADAARDWRQELID |
| Ga0318501_101780742 | 3300031736 | Soil | MLRSLLLVFVFAAAPALAQEYRSKELADAARDWRQELIDS |
| Ga0318501_103876931 | 3300031736 | Soil | MLRALLLLVFAAAPAAAQDYQSKELADAAREWRQELINSIPANKKK |
| Ga0318501_108444201 | 3300031736 | Soil | MLRALLVLCLVSTAAPGLTQEYQSKELAAAASDWRRELGDRL |
| Ga0318537_101119692 | 3300031763 | Soil | MLRSLLVLCLVCIASPALAQEYQSKELADTARDWRQQLIDSVPANKKQPG |
| Ga0318509_104463621 | 3300031768 | Soil | LRLLSVFLLVCVAVPALAQEYQSKELADAAREWRQQ |
| Ga0318521_105702372 | 3300031770 | Soil | MLRSLLLVFVFAAAPALAQEYRSKEPADAARDWRQELIDSLPANKKQAS |
| Ga0318546_102949903 | 3300031771 | Soil | MLRALLLLFVFAAAPAAAQEYQSKELADAARDWRQE |
| Ga0318543_101007382 | 3300031777 | Soil | MLRLLMVFCLVCVTAPTLAQEYQSKELADAALDWRQELIDSVPANKKRPNLS |
| Ga0318498_103776952 | 3300031778 | Soil | MLRLPSVFCLICFTVSALAQEYQSKELADAARDWRQELIDSVPAN |
| Ga0318566_102986562 | 3300031779 | Soil | MLRLLMVFCLVCVTAPTLAQEYQSKELADAALDWRQELID |
| Ga0318547_110207511 | 3300031781 | Soil | MLRLLMVFCLVCVTAPTLAQEYQSKELADAALDWRQ |
| Ga0318548_103606631 | 3300031793 | Soil | MLRSLFVFCLVCFTASALAQEYQSKELADAALDWRQELIDSVPANKKQ |
| Ga0318557_103219591 | 3300031795 | Soil | LRSLLVLCLVCITAPTLAQEYQSKELADAARDWRQELIDSVPANKKQAN |
| Ga0318557_103804101 | 3300031795 | Soil | MLRALLLLFVFAAAPAAAQEYQSKELADAARDWRQELIDSVPANKKQP |
| Ga0318576_101337922 | 3300031796 | Soil | MLRALLVLCLVSTAAPGLTQEYQSKELAAAASSLDWYS |
| Ga0318550_104492491 | 3300031797 | Soil | MLRSLFVFCLVCFTASALAQEYQSKELADAALDWR |
| Ga0318523_100265155 | 3300031798 | Soil | MLRLLMVFCLVCVTAPTLAQEYQSKELADAARDWRQELIDSVPANKKQPN |
| Ga0318523_102825901 | 3300031798 | Soil | MLRLLMVFCLVCFSAPTLAQEYQSKELADAALDWRQELIDS |
| Ga0318565_101891402 | 3300031799 | Soil | MLRLLMVFCLVCFSAPTLAQEYQSKELADAALDWRQELIDSVPANKKQP |
| Ga0318497_103446802 | 3300031805 | Soil | MLRPLLVFCLVCVASPALAQDYQSRELADAARDWRQQLIDSIP |
| Ga0318497_106102122 | 3300031805 | Soil | MLRSLLVLCLVCAASALAQEYQSKELADPARDWRQELINGVPANKKQP |
| Ga0318568_105128602 | 3300031819 | Soil | MLRSLFVICLVCVASPALAQEYQSKELADAARDWRRELIDSVPANKKQPSL |
| Ga0307473_113697922 | 3300031820 | Hardwood Forest Soil | MLRSLLVLCLVCIAAPAMAQEYKSKELADAARDWR |
| Ga0310917_103249851 | 3300031833 | Soil | LRSLLVLCLVCITAPTLAQEYQSKELADAARDWRQELIDSVP |
| Ga0318517_102550231 | 3300031835 | Soil | MLRSLLLVFVFAAAPALAQEYRSKELADAARDWRQELIDSLPANKKQASVVAA |
| Ga0318495_102691082 | 3300031860 | Soil | MLRALLVVCLICASAPVPAQEYQSKELADAARDWRRELIDSIPANKK |
| Ga0306919_115323181 | 3300031879 | Soil | MLRLLMVFCLVCFSAPTLAQEYQSKELADAALDWRQELI |
| Ga0306925_108853911 | 3300031890 | Soil | MLRSLLVLCLVFASPALAQEYQSKELADAARDWRQELIDSVPA |
| Ga0318520_107192381 | 3300031897 | Soil | MLRALLVLCLVSVVSPALAQEYRSKELADAARDWRQELIDSVPANKKQPAQIAG |
| Ga0318520_107764212 | 3300031897 | Soil | MLRSLLVLCLVCIASPALAQEYQSKELADTARDWRQQLIDSVPANKKQ |
| Ga0306921_1002777710 | 3300031912 | Soil | MLRSLLVLCLVCITAPTLAQEYQSKELADAARDWRQELIDSVPAN |
| Ga0310912_100193001 | 3300031941 | Soil | MLRSLLVLCLVCITAPTLAQEYQSKELADAARDWR |
| Ga0310912_102328061 | 3300031941 | Soil | MLRSLLVLCLVCITAPTLAQEYQSKELADAARDWRQELIDSVPTN |
| Ga0310916_100492901 | 3300031942 | Soil | MLRSLFVICLVCFTAPALGQEYQSKELADAARDWRQELIDSIPANKK |
| Ga0310916_112687191 | 3300031942 | Soil | LRLLSVFLLVCVAVPALAQEYQSKELADAAREWRQQLID |
| Ga0310910_105074811 | 3300031946 | Soil | MLRSLLVLCLITVASPALAQDYQSKELADAARDWRQQLIDSIP |
| Ga0310910_105960141 | 3300031946 | Soil | MLRALLVLCLVSTAAPGLTQEYQSKELAAAASDWRREL |
| Ga0310909_100625221 | 3300031947 | Soil | MLRSLFVICLVCFTAPALGQEYQSKELADAARDWRQELIDSVPATKKQP |
| Ga0310909_101190061 | 3300031947 | Soil | MLRLLMVFCLVCFSAPTLAQEYQSKELADAALDWRQELIDSVPANK |
| Ga0318530_104427332 | 3300031959 | Soil | MLRALLLLFVFAGAPALAQEYQSKELADTARDWRQE |
| Ga0318531_100235155 | 3300031981 | Soil | MLRLLMVFCLVCVTAPTLAQEYQSKELADAARDWRQELIDSVPANKKQ |
| Ga0318563_107447411 | 3300032009 | Soil | LRSLLVLCLVCITAPTLAQEYQSKELADAARDWRQELIDSVPANKKQANLIAG |
| Ga0318559_100669133 | 3300032039 | Soil | MLRLLMVFCLVCVTAPTLAQEYQSKELADAARDWWQ |
| Ga0318549_100920573 | 3300032041 | Soil | MLRSLLVLCLVCIASPALAQEYQSKELADTARDWRQQLIDSVPA |
| Ga0318545_100248671 | 3300032042 | Soil | MLRLPSVFCLICFTVSALAQEYQSKELADAARDWRQELIDSVPANKKQL |
| Ga0318556_101560821 | 3300032043 | Soil | MLRSLLLVFVFAAAPALAQEYRSKEPADAARDWRQE |
| Ga0318556_104211942 | 3300032043 | Soil | MLRALLVVCLICASAPVPAQEYQSKELADAARDWRRELIDSIPANKKQPGVVTG |
| Ga0318556_104553841 | 3300032043 | Soil | MLRSLFVICLVCFTAPALGQEYQSKELADAAKDWRQEL |
| Ga0318570_104105461 | 3300032054 | Soil | MLRALLVLCLVSTAAPGLTQEYQSKELAEAASDWRRELGDRIPANKRQP |
| Ga0318575_100878642 | 3300032055 | Soil | MLRSLFVICLVCFTAPALGQEYQSKELADAAREWRQ |
| Ga0318575_104510661 | 3300032055 | Soil | MLRALLVLCLVSTAAPGLTQEYQSKELAAAASSLDWY |
| Ga0318510_101116891 | 3300032064 | Soil | LRSLLVLCLVCITAPTLAQEYQSKELADAARDWRQELID |
| Ga0318513_100796971 | 3300032065 | Soil | MLRSLLVLCLVCIASPALAQEYQSKELADTARDWRQQ |
| Ga0307470_102054671 | 3300032174 | Hardwood Forest Soil | MLRALLVFCLVSVAAPALAQEYQSKELADAARDWRRELIDSVPAIK |
| Ga0307472_1014446142 | 3300032205 | Hardwood Forest Soil | MLRSLVVLYLICVAAPAVAQGYTSKELADAARDWRQEQIAGVPANKKQPNLAA |
| Ga0306920_1025260322 | 3300032261 | Soil | MLRLLLVCCLVCVTAPTLAQEYQSKELADAARDWRQELIDSVPA |
| Ga0310914_100129411 | 3300033289 | Soil | MLRSLLVLCLVCITAPTLAQEYQSKELADAARDWRQELI |
| Ga0318519_106085732 | 3300033290 | Soil | MLRALLVFCLVCVAAPSLAQEYQSKELSDAARDWRRELVESVPVNRK |
| ⦗Top⦘ |