| Basic Information | |
|---|---|
| Family ID | F066982 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MIYTGYSMDPQTFEASPIEEMDPIECPACHQTHRWSKKDARFERDPNE |
| Number of Associated Samples | 108 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 37.30 % |
| % of genes near scaffold ends (potentially truncated) | 42.86 % |
| % of genes from short scaffolds (< 2000 bps) | 73.02 % |
| Associated GOLD sequencing projects | 99 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.206 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.635 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.683 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.444 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.16% β-sheet: 7.89% Coil/Unstructured: 78.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF00571 | CBS | 6.35 |
| PF02633 | Creatininase | 3.97 |
| PF11074 | DUF2779 | 3.97 |
| PF02518 | HATPase_c | 3.17 |
| PF11329 | DUF3131 | 2.38 |
| PF07732 | Cu-oxidase_3 | 2.38 |
| PF00248 | Aldo_ket_red | 1.59 |
| PF13091 | PLDc_2 | 1.59 |
| PF01432 | Peptidase_M3 | 1.59 |
| PF00355 | Rieske | 0.79 |
| PF00069 | Pkinase | 0.79 |
| PF14342 | DUF4396 | 0.79 |
| PF10518 | TAT_signal | 0.79 |
| PF14322 | SusD-like_3 | 0.79 |
| PF05635 | 23S_rRNA_IVP | 0.79 |
| PF13493 | DUF4118 | 0.79 |
| PF00672 | HAMP | 0.79 |
| PF00072 | Response_reg | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 3.97 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.17 |
| COG2132 | Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) | Cell cycle control, cell division, chromosome partitioning [D] | 2.38 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 1.59 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 1.59 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.21 % |
| Unclassified | root | N/A | 0.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090008|P3_DRAFT_NODE_99891_len_12829_cov_15_743394 | All Organisms → cellular organisms → Bacteria | 12879 | Open in IMG/M |
| 2124908029|A2_v1_NODE_41704_len_594_cov_6_269360 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 644 | Open in IMG/M |
| 2140918006|ConsensusfromContig62151 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 726 | Open in IMG/M |
| 2140918007|ConsensusfromContig151183 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2237 | Open in IMG/M |
| 2140918007|ConsensusfromContig31470 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1242 | Open in IMG/M |
| 2162886012|MBSR1b_contig_1382380 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2909 | Open in IMG/M |
| 3300001305|C688J14111_10265468 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 540 | Open in IMG/M |
| 3300001535|A3PFW1_10327525 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300001664|P5cmW16_1038963 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 860 | Open in IMG/M |
| 3300001686|C688J18823_10018672 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4646 | Open in IMG/M |
| 3300001686|C688J18823_11003135 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 529 | Open in IMG/M |
| 3300004114|Ga0062593_100035798 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2902 | Open in IMG/M |
| 3300004153|Ga0063455_100762969 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 663 | Open in IMG/M |
| 3300004157|Ga0062590_100347633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1185 | Open in IMG/M |
| 3300004643|Ga0062591_100836658 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 854 | Open in IMG/M |
| 3300005179|Ga0066684_10460147 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 855 | Open in IMG/M |
| 3300005179|Ga0066684_10776249 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 635 | Open in IMG/M |
| 3300005187|Ga0066675_10269555 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1222 | Open in IMG/M |
| 3300005336|Ga0070680_100001480 | All Organisms → cellular organisms → Bacteria | 17062 | Open in IMG/M |
| 3300005450|Ga0066682_10841882 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 551 | Open in IMG/M |
| 3300005457|Ga0070662_101386676 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 605 | Open in IMG/M |
| 3300005458|Ga0070681_10118075 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2589 | Open in IMG/M |
| 3300005458|Ga0070681_10479307 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1157 | Open in IMG/M |
| 3300005563|Ga0068855_102118259 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 566 | Open in IMG/M |
| 3300005566|Ga0066693_10095073 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1068 | Open in IMG/M |
| 3300005578|Ga0068854_100574438 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 959 | Open in IMG/M |
| 3300005578|Ga0068854_101759090 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 568 | Open in IMG/M |
| 3300005616|Ga0068852_101870800 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 622 | Open in IMG/M |
| 3300005896|Ga0075282_1037916 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 668 | Open in IMG/M |
| 3300005938|Ga0066795_10024349 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1738 | Open in IMG/M |
| 3300005938|Ga0066795_10130751 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 748 | Open in IMG/M |
| 3300005938|Ga0066795_10136485 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 731 | Open in IMG/M |
| 3300005947|Ga0066794_10115593 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 804 | Open in IMG/M |
| 3300006046|Ga0066652_100423960 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1218 | Open in IMG/M |
| 3300006055|Ga0097691_1000321 | All Organisms → cellular organisms → Bacteria | 43666 | Open in IMG/M |
| 3300006175|Ga0070712_100883622 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 770 | Open in IMG/M |
| 3300006797|Ga0066659_11008368 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 696 | Open in IMG/M |
| 3300006864|Ga0066797_1065181 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1279 | Open in IMG/M |
| 3300006881|Ga0068865_100548882 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 970 | Open in IMG/M |
| 3300006894|Ga0079215_10908826 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 633 | Open in IMG/M |
| 3300006903|Ga0075426_10494042 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 909 | Open in IMG/M |
| 3300007265|Ga0099794_10439790 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 683 | Open in IMG/M |
| 3300009012|Ga0066710_100524454 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
| 3300009012|Ga0066710_102849754 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 681 | Open in IMG/M |
| 3300009029|Ga0066793_10197345 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1172 | Open in IMG/M |
| 3300009093|Ga0105240_10054889 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4991 | Open in IMG/M |
| 3300009143|Ga0099792_10017360 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3149 | Open in IMG/M |
| 3300009143|Ga0099792_11030014 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 551 | Open in IMG/M |
| 3300009147|Ga0114129_10049008 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 5937 | Open in IMG/M |
| 3300009148|Ga0105243_12306709 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 576 | Open in IMG/M |
| 3300010227|Ga0136219_1001158 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3548 | Open in IMG/M |
| 3300010320|Ga0134109_10065368 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1224 | Open in IMG/M |
| 3300010322|Ga0134084_10301092 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 596 | Open in IMG/M |
| 3300010371|Ga0134125_12056964 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 621 | Open in IMG/M |
| 3300010373|Ga0134128_12312609 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 592 | Open in IMG/M |
| 3300010399|Ga0134127_10130220 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2254 | Open in IMG/M |
| 3300011332|Ga0126317_10975572 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 792 | Open in IMG/M |
| 3300011444|Ga0137463_1047989 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1587 | Open in IMG/M |
| 3300011444|Ga0137463_1075275 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1265 | Open in IMG/M |
| 3300011998|Ga0120114_1003009 | All Organisms → cellular organisms → Bacteria | 4579 | Open in IMG/M |
| 3300012201|Ga0137365_10664154 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 763 | Open in IMG/M |
| 3300012203|Ga0137399_11029009 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 693 | Open in IMG/M |
| 3300012208|Ga0137376_10200904 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1724 | Open in IMG/M |
| 3300012211|Ga0137377_10023674 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5472 | Open in IMG/M |
| 3300012285|Ga0137370_10308340 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 946 | Open in IMG/M |
| 3300012469|Ga0150984_109431812 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 685 | Open in IMG/M |
| 3300012927|Ga0137416_10408998 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300012930|Ga0137407_11684790 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 604 | Open in IMG/M |
| 3300012951|Ga0164300_11049008 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 528 | Open in IMG/M |
| 3300012955|Ga0164298_10646315 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 734 | Open in IMG/M |
| 3300012955|Ga0164298_11281725 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 560 | Open in IMG/M |
| 3300012958|Ga0164299_10774195 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 681 | Open in IMG/M |
| 3300012960|Ga0164301_10640742 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 791 | Open in IMG/M |
| 3300012985|Ga0164308_11001306 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 743 | Open in IMG/M |
| 3300013100|Ga0157373_10051772 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2923 | Open in IMG/M |
| 3300013102|Ga0157371_10443986 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 953 | Open in IMG/M |
| 3300014056|Ga0120125_1068043 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 801 | Open in IMG/M |
| 3300014745|Ga0157377_10855385 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 676 | Open in IMG/M |
| 3300014829|Ga0120104_1120996 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300015084|Ga0167654_1021153 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300015192|Ga0167646_1011475 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2432 | Open in IMG/M |
| 3300015192|Ga0167646_1030361 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1325 | Open in IMG/M |
| 3300015371|Ga0132258_13375211 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1097 | Open in IMG/M |
| 3300015373|Ga0132257_100340934 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1810 | Open in IMG/M |
| 3300018056|Ga0184623_10170021 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1006 | Open in IMG/M |
| 3300018482|Ga0066669_10030493 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3178 | Open in IMG/M |
| 3300019879|Ga0193723_1028355 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1695 | Open in IMG/M |
| 3300019881|Ga0193707_1001258 | All Organisms → cellular organisms → Bacteria | 9202 | Open in IMG/M |
| 3300019881|Ga0193707_1107506 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 826 | Open in IMG/M |
| 3300019890|Ga0193728_1002413 | All Organisms → cellular organisms → Bacteria | 9596 | Open in IMG/M |
| 3300020004|Ga0193755_1037957 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1585 | Open in IMG/M |
| 3300020006|Ga0193735_1002878 | All Organisms → cellular organisms → Bacteria | 5559 | Open in IMG/M |
| 3300020021|Ga0193726_1011196 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 4812 | Open in IMG/M |
| 3300020021|Ga0193726_1043612 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2166 | Open in IMG/M |
| 3300020022|Ga0193733_1091842 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 849 | Open in IMG/M |
| 3300020060|Ga0193717_1043902 | Not Available | 1630 | Open in IMG/M |
| 3300020061|Ga0193716_1004581 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7427 | Open in IMG/M |
| 3300021339|Ga0193706_1213583 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 519 | Open in IMG/M |
| 3300021363|Ga0193699_10117742 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
| 3300021408|Ga0193708_1015030 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1878 | Open in IMG/M |
| 3300021411|Ga0193709_1005155 | All Organisms → cellular organisms → Bacteria | 3355 | Open in IMG/M |
| 3300021411|Ga0193709_1097421 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 635 | Open in IMG/M |
| 3300022756|Ga0222622_10494442 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 873 | Open in IMG/M |
| 3300025505|Ga0207929_1000225 | All Organisms → cellular organisms → Bacteria | 16005 | Open in IMG/M |
| 3300025912|Ga0207707_10031676 | All Organisms → cellular organisms → Bacteria | 4628 | Open in IMG/M |
| 3300025912|Ga0207707_10652532 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 887 | Open in IMG/M |
| 3300025917|Ga0207660_10017723 | All Organisms → cellular organisms → Bacteria | 4737 | Open in IMG/M |
| 3300025919|Ga0207657_10674605 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 804 | Open in IMG/M |
| 3300025939|Ga0207665_10686615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 804 | Open in IMG/M |
| 3300025949|Ga0207667_11611246 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 618 | Open in IMG/M |
| 3300025981|Ga0207640_12112026 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 511 | Open in IMG/M |
| 3300026271|Ga0209880_1020928 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1605 | Open in IMG/M |
| 3300026271|Ga0209880_1075826 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 704 | Open in IMG/M |
| 3300026271|Ga0209880_1089485 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 633 | Open in IMG/M |
| 3300026316|Ga0209155_1022440 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2629 | Open in IMG/M |
| 3300027565|Ga0209219_1008736 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2294 | Open in IMG/M |
| 3300027903|Ga0209488_10036930 | All Organisms → cellular organisms → Bacteria | 3572 | Open in IMG/M |
| 3300028536|Ga0137415_10057107 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 3770 | Open in IMG/M |
| 3300028824|Ga0307310_10057472 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1640 | Open in IMG/M |
| 3300028828|Ga0307312_10292195 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1060 | Open in IMG/M |
| 3300030510|Ga0268243_1169237 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 535 | Open in IMG/M |
| 3300031716|Ga0310813_10097159 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2282 | Open in IMG/M |
| 3300031720|Ga0307469_10039912 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2839 | Open in IMG/M |
| 3300032002|Ga0307416_101106383 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 897 | Open in IMG/M |
| 3300033412|Ga0310810_10319545 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300034820|Ga0373959_0068962 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 796 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.63% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.52% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 6.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.56% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.76% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 3.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 3.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.97% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.38% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.38% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.59% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.59% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.59% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.59% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.79% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.79% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.79% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.79% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.79% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.79% |
| Soil | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 2124908029 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active Layer A2 | Environmental | Open in IMG/M |
| 2140918006 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001664 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - 5cm_reassembled | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005896 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_204 | Environmental | Open in IMG/M |
| 3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
| 3300005947 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010227 | Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 2 | Engineered | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011332 | Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300015084 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-5a, rocky medial moraine) | Environmental | Open in IMG/M |
| 3300015192 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2a, rock/snow interface) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020004 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2 | Environmental | Open in IMG/M |
| 3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300021339 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1 | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021408 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c1 | Environmental | Open in IMG/M |
| 3300021411 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3c2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025505 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026271 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300030510 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG (v2) | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P3_DRAFT_00294030 | 2088090008 | Soil | MIYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWNKRDARFERDPNE |
| A2_v1_00267570 | 2124908029 | Soil | PQTFDASPIEEMDPVECPACHQMHRWNKKDARFERDPNE |
| P1_C_00124110 | 2140918006 | Soil | MIYTGFSMDPQTFEASPIEEMDPVECPACHQTHRWNKRDARFERDPNE |
| A_all_C_00328410 | 2140918007 | Soil | MIYTGFSMDPQTFDASPIEEMDPVECPACHQMHRWNKKDARFERDPNE |
| A_all_C_01459770 | 2140918007 | Soil | MIYTGFSMDPQTFEDSPIEQMDPVECPACRQMHRWNKKDARFERDPNE |
| MBSR1b_0235.00005960 | 2162886012 | Miscanthus Rhizosphere | MIYTGFSMDPLTFEASPIEEMDPIVCPACHKTHKWSKKDARFERDPNE |
| C688J14111_102654682 | 3300001305 | Soil | GKMIYTGYSMDPQTFEASPIEEMDPIECPACHQTHRWSKKDARFERDPNE* |
| A3PFW1_103275251 | 3300001535 | Permafrost | FEASPIEEMDPIECPACHQTHRWNKRDARFERDPNE* |
| P5cmW16_10389633 | 3300001664 | Permafrost | MIYTGFSMDPQTFEASPIEEMDPIICPACHQTHKWSKKDARFERDPNE* |
| C688J18823_100186722 | 3300001686 | Soil | MIYTGYSMDPQTFEASPIEEMDPIECPACHQTHRWSKKDARFERDPNE* |
| C688J18823_110031352 | 3300001686 | Soil | MIYTGYSMDPIIFEASPIEEMDPVECPACHQTHRWSKRDARFERDPNE* |
| Ga0062593_1000357984 | 3300004114 | Soil | MIYTGYAMDPQTFEASPIEEMDPIECPACHQVHRWTKRDARFERDPNE* |
| Ga0063455_1007629692 | 3300004153 | Soil | MIYTGYSMDPQTFDASPIEEMDPIQCPACRQVHSWSKRDARFERDPNE* |
| Ga0062590_1003476332 | 3300004157 | Soil | MDPATFDASPVEENPIECPVCKQTHRWSKKDAFLERDDSAERAH* |
| Ga0062591_1008366581 | 3300004643 | Soil | MIYTGFSMDPQTFEASPIEEMDPIECPACHKTHRWSKKDARFERDPNE* |
| Ga0066684_104601473 | 3300005179 | Soil | MIYTGYSMDPQTFEASPIEEMDPIECPACHQMHRWSKRDARFERDPNE* |
| Ga0066684_107762493 | 3300005179 | Soil | KMIYTGYSMDPAIFEASPIEEMDPVVCPACHQTHRWSKRDARFERDPNE* |
| Ga0066675_102695551 | 3300005187 | Soil | MIYTGYSMDPAIFEASPIEEMDPVVCPACHQTHRWSKRDARFERDPNE* |
| Ga0070680_1000014807 | 3300005336 | Corn Rhizosphere | MIYTGYAMDPLTFEASPIEEMDPIECPACHQLHHWTKKDARFERDPNE* |
| Ga0066682_108418821 | 3300005450 | Soil | MIYTGYSMDPQTFEASPIEEMDPIECPACHQMHRWTKRDARFERDPNE* |
| Ga0070662_1013866762 | 3300005457 | Corn Rhizosphere | GYSMDPQTFELSPIEEMDPVECPACHQTHRWTKRQALFERDPNE* |
| Ga0070681_101180753 | 3300005458 | Corn Rhizosphere | MIYTGYSMDPAIFEASPIEEMDPIQCPVCHQTHRWTKRDARFERDPNE* |
| Ga0070681_104793071 | 3300005458 | Corn Rhizosphere | DPQTFEASPIEEMDPIQCPACHQVHAWSKRDARFERDPNE* |
| Ga0068855_1021182591 | 3300005563 | Corn Rhizosphere | FEASPIEEMDPIECPACHQLHHWTKKDARFERDPNE* |
| Ga0066693_100950731 | 3300005566 | Soil | GYSMDPAIFEASPIEEMDPVVCPACHQTHRWSKRDARFERDPNE* |
| Ga0068854_1005744382 | 3300005578 | Corn Rhizosphere | MIYTGYAMDPQTFEASPIEEMDPIECPACHQVHRWTKRDARFEREPNE* |
| Ga0068854_1017590901 | 3300005578 | Corn Rhizosphere | YTGFSMDPLTFEASPIEEMDPIVCPACHKTHKWSKKDARFERDPNE* |
| Ga0068852_1018708001 | 3300005616 | Corn Rhizosphere | ASPIEEMDPIECPACHQVHRWTKRDARFERDPNE* |
| Ga0075282_10379161 | 3300005896 | Rice Paddy Soil | MIYTGYAMDPQTFEASPIEEMDPIECPACHQIHRWT |
| Ga0066795_100243493 | 3300005938 | Soil | MIYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWNKRDA |
| Ga0066795_101307513 | 3300005938 | Soil | TGKMIYTGFSMDPQTFDASPIEEMDPVECPACHQMHRWSKKDARFERDPNE* |
| Ga0066795_101364852 | 3300005938 | Soil | TGKMIYTGFSMDPQTFDASPIEEMDPVECPACHQMHRWSKADARFERDPNE* |
| Ga0066794_101155931 | 3300005947 | Soil | MIYTGFSMDPQTFEDSPIEEMDPVECSACHQMHRWNKKDARFERDPNE* |
| Ga0066652_1004239603 | 3300006046 | Soil | TGKMIYTGYSMDPAIFEASPIEEMDPVVCPACHQTHRWSKRDARFERDPNE* |
| Ga0097691_100032125 | 3300006055 | Arctic Peat Soil | MIYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWNKRDARFERDPNE* |
| Ga0070712_1008836223 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TFEASPIEEMDPIECPACHQTHRWSKRDARFERDPNE* |
| Ga0066659_110083683 | 3300006797 | Soil | TFEASPIDEMDPIECPACHQTHRWTKRDARFERDPNE* |
| Ga0066797_10651812 | 3300006864 | Soil | MIYTGFSMDPQTFDASPIEEMDPVECPACHQMHRWSKKDARFERDPNE* |
| Ga0068865_1005488821 | 3300006881 | Miscanthus Rhizosphere | MIYTGYSMDPQTFDLSPIEEMDPVECPACHQVHRWSKRDARFERDPNE* |
| Ga0079215_109088262 | 3300006894 | Agricultural Soil | MDQATFTASPIEQMDPIECPACHKMHRWAKKDALFEREDPKENRR* |
| Ga0075426_104940421 | 3300006903 | Populus Rhizosphere | FELSPIEEMDPVECPACHQTHRWTKKQALFERDPNE* |
| Ga0099794_104397901 | 3300007265 | Vadose Zone Soil | MIYTGFSMDPQTFEASPIEEMDPVQCPACRQLHRWTKKDARFERDPNE* |
| Ga0066710_1005244541 | 3300009012 | Grasslands Soil | TTGKMIYTGYSMDPQTFEASPIEEMDPIECPACHQTHRWTKRDARFERDPNE |
| Ga0066710_1028497541 | 3300009012 | Grasslands Soil | TFEASPIEEMDPIECPACHQTHRWTKRDARFERDPNE |
| Ga0066793_101973453 | 3300009029 | Prmafrost Soil | MIYTGFSMDPQTFDASPIEEMDPVECPACHQMHRWSKADARFERDPNE* |
| Ga0105240_100548896 | 3300009093 | Corn Rhizosphere | MIYTGFSMDPLTFEASPIEEMDPIVCPACHKTHKWSKKDARFERDPNE* |
| Ga0099792_100173601 | 3300009143 | Vadose Zone Soil | MIYTGFSMDPQTFEASPIEEMDPIVCPACHQTHKWSKKDA |
| Ga0099792_110300141 | 3300009143 | Vadose Zone Soil | MIYTGFSMDPQTFEASPIEEMDPIVCPACHQTHKWSKKDARFERDPNE* |
| Ga0114129_100490084 | 3300009147 | Populus Rhizosphere | MVYTGYSMDPQTFELSPIEEMDPVVCPACHQTHRWTKKQALFERDPNE* |
| Ga0105243_123067091 | 3300009148 | Miscanthus Rhizosphere | QTFEASPIEEMDPIPCPACHQTHRWTKKDALFKRDPNE* |
| Ga0136219_10011584 | 3300010227 | Soil | MIYTGYAMDPQTFEASPIEEMDPIECPACHQIHRWTKRDARFERDPNE* |
| Ga0134109_100653682 | 3300010320 | Grasslands Soil | MIYTGYSMDPQTFEASPIEEMDPIECPACHQTHRWTKRDARFERDPNE* |
| Ga0134084_103010922 | 3300010322 | Grasslands Soil | MDPQTFELSPIEEMDPVECPACHQMHRWTKKQALFERDPNE* |
| Ga0134125_120569642 | 3300010371 | Terrestrial Soil | MIYTGYSMDPQTFEASPIEEMDPIQCPACHQVHSWSKRDARFERDPNE* |
| Ga0134128_123126091 | 3300010373 | Terrestrial Soil | IKCPNTGKMIYTGYSMDPQTFELSPIEEMDPVECPACHQMHRWTKRQALFERDPNE* |
| Ga0134127_101302202 | 3300010399 | Terrestrial Soil | MIYTGYSMDPQTFEASPIEEMDPIQCPACHQVHAWSKRDARFERDPNE* |
| Ga0126317_109755721 | 3300011332 | Soil | IKCPNTGKMIYTGFSMDPLIFEASPVEEMDPIECPACHQTHRWSKKDSRFERDPNE* |
| Ga0137463_10479892 | 3300011444 | Soil | MIYTGFSMDPSTFDASPIEEMDPIECPACHQMHRWSKKDARFERDPNE* |
| Ga0137463_10752752 | 3300011444 | Soil | MIYTGFSMDPQTFEASPIEEMDPIECPACHQTHKWNKRDARFERDPNE* |
| Ga0120114_10030091 | 3300011998 | Permafrost | TGFSMDPQTFEASPIEEMDPIECPACHQTHRWNKRDARFERDPNE* |
| Ga0137365_106641542 | 3300012201 | Vadose Zone Soil | MIYTGYSMDPQTFEASPIEEMDPIQCPACHQTHRWTKRDARFERDPNE* |
| Ga0137399_110290092 | 3300012203 | Vadose Zone Soil | MIYTGYSMDPETFEGSPIEEMDPVECPACHQVHRWSKRDARFERDPNE* |
| Ga0137376_102009042 | 3300012208 | Vadose Zone Soil | MIYTGYSMDPQTFEASPIEEMDPIECPACHQVHRWSKRDARFERDPNE* |
| Ga0137377_100236743 | 3300012211 | Vadose Zone Soil | MIYTGYSMDPQTFDASPIEEMDPIECPACHQTHRWSKRDARFERDPNE* |
| Ga0137370_103083403 | 3300012285 | Vadose Zone Soil | MIYTGYSMDPQTFELSPIEEMDPVECPACHQTHRWTKRQALFERDPNE* |
| Ga0150984_1094318121 | 3300012469 | Avena Fatua Rhizosphere | ASPIEEMDPIECPACHQVHAWSKRDARFERDPNE* |
| Ga0137416_104089983 | 3300012927 | Vadose Zone Soil | YSMDPQTFEASPIEEMDPIQCPACHQMHRWSKREARFERDPNE* |
| Ga0137407_116847902 | 3300012930 | Vadose Zone Soil | YTGYSMDPQTFEASPIEEMDPIECPACHQTHRWSKRDARFERDPNE* |
| Ga0164300_110490081 | 3300012951 | Soil | MIYTGYSMDPQTFELSPIEEMDPVVCPACHQTHRWTKKQALFERDPNE* |
| Ga0164298_106463152 | 3300012955 | Soil | MIYTGYSMDPAIFEASPIEEMDPIVCPACRQTHTWTNKDA |
| Ga0164298_112817251 | 3300012955 | Soil | ATGKMIYTGYSMDPAIFEASPIEEMDPIECPACRQTHTWTKKDARFERDPNE* |
| Ga0164299_107741951 | 3300012958 | Soil | MIYTGYSMDPQTFELSPIEEMDPVECPACHQMHRWTKRQALFERDPNE* |
| Ga0164301_106407422 | 3300012960 | Soil | MIYTGYSMDPAIFEASPIEEMDPIVCPACRQTHTWTKKDARFERDPNE* |
| Ga0164308_110013062 | 3300012985 | Soil | MIYTGYSMDPQTFEAAPIEEMDPIQCPACHQVHAWSKRDARFERDPNE* |
| Ga0157373_100517725 | 3300013100 | Corn Rhizosphere | MIYTGYAMDPQTFEASPIEEMDPIECPACHQVHRWTKRDARF |
| Ga0157371_104439862 | 3300013102 | Corn Rhizosphere | QTFELSPIEEMDPVECPACHQVHRWSKRDARFERDPNE* |
| Ga0120125_10680432 | 3300014056 | Permafrost | MIYTGFSMDPQTFEASPIEEMDPIVCPACHQTHRWSKKDARFERDPNE* |
| Ga0157377_108553852 | 3300014745 | Miscanthus Rhizosphere | EPEVLHTWALSPIEEMDPVECPACHQVHRWSKRDARFERDPNE* |
| Ga0120104_11209961 | 3300014829 | Permafrost | QTFEASPIEEMDPIICPACHQTHKWSKKDARFERDPNE* |
| Ga0167654_10211532 | 3300015084 | Glacier Forefield Soil | MIYTGYSMDPTTFGAIPIEQMDPIECPACKRMHRWGKKDALFEREDPKEGEKKAK* |
| Ga0167646_10114752 | 3300015192 | Glacier Forefield Soil | MIYTGFSMDPQTFDASPIEEMDPIECPACHQMHRWSKKDARFERDPNE* |
| Ga0167646_10303612 | 3300015192 | Glacier Forefield Soil | MIYTGFSMDPQTFEASPIEEMDPVECPACHQTHRWNKRDARFERDPNE* |
| Ga0132258_133752112 | 3300015371 | Arabidopsis Rhizosphere | DPETFELSPIEEMDPVECPACHQVHRWSKRDARFERDPNE* |
| Ga0132257_1003409343 | 3300015373 | Arabidopsis Rhizosphere | MIYTGYSMDPQTFEASPIEEMDPIQCPACHQVHAWSKRDA |
| Ga0184623_101700213 | 3300018056 | Groundwater Sediment | VNRIFIKCPTTGKLVYTGFEMDQDTFTAIPIEQMDPIECPACHEMHRWAKKDALFEREDPKERSR |
| Ga0066669_100304935 | 3300018482 | Grasslands Soil | CPNTGKMIYTGYSMDPAIFEASPVEEMDPIECPACRQTHRWSKRDARFERDPNE |
| Ga0193723_10283552 | 3300019879 | Soil | MIYTGFSMDPITFDAAPIEEMDPIECPACHKMHRWTKKDARFERDPNE |
| Ga0193707_10012584 | 3300019881 | Soil | MIYTGFSMDPQTFEASPIEEMDPIECPACHQMHRWNKRDARFERDPNE |
| Ga0193707_11075062 | 3300019881 | Soil | MIYTGFSMDPITFDASPIEEMDPIECPACHKMHRWTKKDALFERDPNE |
| Ga0193728_10024139 | 3300019890 | Soil | MIYTGFSMDPLTFEASPIEEMDPIVCPACHQTHKWSKKDARFERDPNE |
| Ga0193755_10379573 | 3300020004 | Soil | YTGFAMDPETFGALPIEEMDPLECPACHKIHRWQKKDALFEREDPRAAS |
| Ga0193735_10028786 | 3300020006 | Soil | MIYTGFSMDPQTFEASPIEEMDPIVCPACHQTHKWSKKDARFERDPNE |
| Ga0193726_10111964 | 3300020021 | Soil | MIYTGFSMDPATFDAAPIEEMDPVECPACHQTHRWTKKDARFERDPNE |
| Ga0193726_10436123 | 3300020021 | Soil | MIYTGFSMDPITFDASPIEEMDPIECPACHKMHRWTKKDARFERDPNE |
| Ga0193733_10918422 | 3300020022 | Soil | MIYTGFSMDPQIFEASPIEEMDPIVCPACHQTHRWSKKDARFERDPNE |
| Ga0193717_10439021 | 3300020060 | Soil | GFAMDQATFGALPIEEMDPIECPACHKMHRWAKKDALFEREDPQSK |
| Ga0193716_10045811 | 3300020061 | Soil | MIYTGFSMDPQTFEASPIEEMDPVECPACHQMHRWSKKDARFERDPNE |
| Ga0193706_12135831 | 3300021339 | Soil | MIYTGFSMDPQTFDASPIEEMDPVECPACHQTHRWSKKDARFERDPNE |
| Ga0193699_101177423 | 3300021363 | Soil | YTGFSMDPQTFEASPIEEMDPIECPACHQTHRWSKKDARFERDPNE |
| Ga0193708_10150303 | 3300021408 | Soil | MIYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWSKKDARFERDPNE |
| Ga0193709_10051551 | 3300021411 | Soil | PTTGKMIYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWSKKDARFERDPNE |
| Ga0193709_10974212 | 3300021411 | Soil | MIYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWSKKDARFERD |
| Ga0222622_104944423 | 3300022756 | Groundwater Sediment | GKLIYTGFAMDPETFGALPIEEMDPLECPACHKVHRWQKKDALFEREDPRAAS |
| Ga0207929_100022510 | 3300025505 | Arctic Peat Soil | MIYTGFSMDPQTFEASPIEEMDPIECPACHQPHRWNKRDARFERDPNE |
| Ga0207707_100316762 | 3300025912 | Corn Rhizosphere | MIYTGYAMDPQTFEASPIEEMDPIECPACHQVHRWTKRDARFERDPNE |
| Ga0207707_106525322 | 3300025912 | Corn Rhizosphere | MIYTGYSMDPAIFEASPIEEMDPIQCPVCHQTHRWTKRDARFERDPNE |
| Ga0207660_100177231 | 3300025917 | Corn Rhizosphere | MIYTGYAMDPLTFEASPIEEMDPIECPACHQLHHWTKKDARFERDPNE |
| Ga0207657_106746052 | 3300025919 | Corn Rhizosphere | MIYTGYAMDPLTFEASPIEEMDPIECPACHQLHHWTKKDA |
| Ga0207665_106866151 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MIYTGYSMDPQTFEASPIEEMDPIECPACHQTHRWSKRDARFERDPNE |
| Ga0207667_116112462 | 3300025949 | Corn Rhizosphere | FEASPIEEMDPIECPACHQLHHWTKKDARFERDPNE |
| Ga0207640_121120261 | 3300025981 | Corn Rhizosphere | MIYTGYAMDPQTFEASPIEEMDPIECPACHQVHRWTKRDARFERD |
| Ga0209880_10209284 | 3300026271 | Soil | MIYTGFSMDPQTFDASPIEEMDPVECPACHQMHRWSK |
| Ga0209880_10758261 | 3300026271 | Soil | GFSMDPQTFDASPIEEMDPVECPACHQMHRWSKADARFERDPNE |
| Ga0209880_10894851 | 3300026271 | Soil | GFSMDPQTFDASPIEEMDPVECPACHQMHRWSKKDARFERDPNE |
| Ga0209155_10224403 | 3300026316 | Soil | MIYTGYSMDPAIFEASPIEEMDPVVCPACHQTHRWSKRDARFERDPNE |
| Ga0209219_10087364 | 3300027565 | Forest Soil | MIYTGFSMDPQTFEASPIEEMDPIQCPACRQMHRWTKRDARFERDPNE |
| Ga0209488_100369304 | 3300027903 | Vadose Zone Soil | MIYTGYSMDPQTFGAIPIEQMDPIECPACHKMHRWGKEDALFERDSQDPKKSSR |
| Ga0137415_100571071 | 3300028536 | Vadose Zone Soil | MIYTGYSMDPQTFEASPIEEMDPIQCPACHQMHRWSKRDARFERDPNE |
| Ga0307310_100574722 | 3300028824 | Soil | MIYTGYSMDPKTFGAIPIEQMDPIECPACHRMHRWGKQDALFEREGPDPKQK |
| Ga0307312_102921952 | 3300028828 | Soil | MIYTGFSMDPQTFEASPIEEMDPIECPACHKTHRWNKRDARFERDPNE |
| Ga0268243_11692371 | 3300030510 | Soil | MIYTGYSMDPQTFESSPIEEMDPIECPACHQTHRWTKKQALF |
| Ga0310813_100971593 | 3300031716 | Soil | MIYTGFSMDPLTFEASPIEEMDPLVCPACHQTHKWSKKDARFERDPNE |
| Ga0307469_100399123 | 3300031720 | Hardwood Forest Soil | MIYTGFSMDPQTFEASPIEEMDPIECPACHQTHRWSKRDARFERDPNE |
| Ga0307416_1011063832 | 3300032002 | Rhizosphere | MIYTGYSMDPEIFAASPIEELDPIQCPICHKTHRWTKKDARFERDPNE |
| Ga0310810_103195452 | 3300033412 | Soil | YTGFSMDPLTFEASPIEEMDPLVCPACHQTHKWSKKDARFERDPNE |
| Ga0373959_0068962_626_772 | 3300034820 | Rhizosphere Soil | MIYTGYSMDPAIFEASPIEEMDPIECPACRQTHTWTKKDARFERDPNE |
| ⦗Top⦘ |