NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F066950

Metagenome / Metatranscriptome Family F066950

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066950
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 44 residues
Representative Sequence TTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVSGL
Number of Associated Samples 113
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 7.94 %
% of genes near scaffold ends (potentially truncated) 92.06 %
% of genes from short scaffolds (< 2000 bps) 93.65 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.69

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (62.698 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(30.952 % of family members)
Environment Ontology (ENVO) Unclassified
(28.571 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(35.714 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 38.03%    β-sheet: 0.00%    Coil/Unstructured: 61.97%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.69
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF03588Leu_Phe_trans 4.76
PF13280WYL 4.76
PF13460NAD_binding_10 3.17
PF13207AAA_17 2.38
PF08818DUF1801 2.38
PF08327AHSA1 2.38
PF01548DEDD_Tnp_IS110 2.38
PF00903Glyoxalase 1.59
PF08448PAS_4 1.59
PF13787HXXEE 1.59
PF00296Bac_luciferase 1.59
PF11716MDMPI_N 1.59
PF01638HxlR 0.79
PF04672Methyltransf_19 0.79
PF09995MPAB_Lcp_cat 0.79
PF13751DDE_Tnp_1_6 0.79
PF01799Fer2_2 0.79
PF02738MoCoBD_1 0.79
PF02687FtsX 0.79
PF07883Cupin_2 0.79
PF04402SIMPL 0.79
PF04185Phosphoesterase 0.79
PF01370Epimerase 0.79
PF12833HTH_18 0.79
PF04266ASCH 0.79
PF04978DUF664 0.79
PF13581HATPase_c_2 0.79
PF04191PEMT 0.79
PF02371Transposase_20 0.79
PF00766ETF_alpha 0.79
PF00440TetR_N 0.79
PF01042Ribonuc_L-PSP 0.79
PF12802MarR_2 0.79
PF13458Peripla_BP_6 0.79
PF00196GerE 0.79
PF04607RelA_SpoT 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 126 Family Scaffolds
COG2360Leu/Phe-tRNA-protein transferasePosttranslational modification, protein turnover, chaperones [O] 4.76
COG3547TransposaseMobilome: prophages, transposons [X] 3.17
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 2.38
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 2.38
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 2.38
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 1.59
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.79
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.79
COG2025Electron transfer flavoprotein, alpha subunit FixBEnergy production and conversion [C] 0.79
COG2411Predicted RNA-binding protein, contains PUA-like ASCH domainGeneral function prediction only [R] 0.79
COG2859Outer membrane channel-forming protein BP26/OMP28, SIMPL familyCell wall/membrane/envelope biogenesis [M] 0.79
COG2968Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domainFunction unknown [S] 0.79
COG3097Uncharacterized conserved protein YqfB, UPF0267 familyFunction unknown [S] 0.79
COG3471Predicted secreted (periplasmic) proteinFunction unknown [S] 0.79
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.79
COG4405Predicted RNA-binding protein YhfF, contains PUA-like ASCH domainGeneral function prediction only [R] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms62.70 %
UnclassifiedrootN/A37.30 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908016|OU_2_1_1_newblercontig00634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1742Open in IMG/M
2166559006|FI_contig26644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces582Open in IMG/M
3300001356|JGI12269J14319_10009596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia7958Open in IMG/M
3300002245|JGIcombinedJ26739_101590429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300005177|Ga0066690_10181584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1395Open in IMG/M
3300005179|Ga0066684_10897599All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia579Open in IMG/M
3300005329|Ga0070683_102230884All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005334|Ga0068869_101898559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia534Open in IMG/M
3300005337|Ga0070682_100541259All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales909Open in IMG/M
3300005435|Ga0070714_100428199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1254Open in IMG/M
3300005436|Ga0070713_100264378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1573Open in IMG/M
3300005439|Ga0070711_101217604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia652Open in IMG/M
3300005439|Ga0070711_101563946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia576Open in IMG/M
3300005455|Ga0070663_100074535All Organisms → cellular organisms → Bacteria2478Open in IMG/M
3300005537|Ga0070730_10910550All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria551Open in IMG/M
3300005602|Ga0070762_11157659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia534Open in IMG/M
3300005718|Ga0068866_10496583Not Available807Open in IMG/M
3300005764|Ga0066903_100582419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1932Open in IMG/M
3300005764|Ga0066903_101467867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1285Open in IMG/M
3300006028|Ga0070717_11098180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae724Open in IMG/M
3300006028|Ga0070717_11249924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia675Open in IMG/M
3300006176|Ga0070765_100419628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1251Open in IMG/M
3300009683|Ga0116224_10403595Not Available650Open in IMG/M
3300010048|Ga0126373_10738624All Organisms → cellular organisms → Bacteria → Terrabacteria group1044Open in IMG/M
3300010048|Ga0126373_12044428Not Available635Open in IMG/M
3300010048|Ga0126373_12640391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces560Open in IMG/M
3300010329|Ga0134111_10213907Not Available782Open in IMG/M
3300010360|Ga0126372_11961545All Organisms → cellular organisms → Bacteria → Terrabacteria group631Open in IMG/M
3300010366|Ga0126379_10499277Not Available1288Open in IMG/M
3300010366|Ga0126379_11299205All Organisms → cellular organisms → Bacteria834Open in IMG/M
3300010366|Ga0126379_11581196Not Available761Open in IMG/M
3300010396|Ga0134126_12195909Not Available602Open in IMG/M
3300010396|Ga0134126_12619103Not Available548Open in IMG/M
3300010400|Ga0134122_10700453Not Available952Open in IMG/M
3300012199|Ga0137383_10576707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Leekyejoonella → Leekyejoonella antrihumi823Open in IMG/M
3300012207|Ga0137381_11170716All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia661Open in IMG/M
3300012210|Ga0137378_11061823All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Dermacoccaceae → Leekyejoonella → Leekyejoonella antrihumi724Open in IMG/M
3300012349|Ga0137387_10694104All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria737Open in IMG/M
3300012356|Ga0137371_11430160Not Available506Open in IMG/M
3300012987|Ga0164307_10369056Not Available1048Open in IMG/M
3300013306|Ga0163162_11256798All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria841Open in IMG/M
3300013307|Ga0157372_11497609Not Available777Open in IMG/M
3300015359|Ga0134085_10457602Not Available579Open in IMG/M
3300015373|Ga0132257_101889032Not Available768Open in IMG/M
3300016294|Ga0182041_10939236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces779Open in IMG/M
3300016357|Ga0182032_11572706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces572Open in IMG/M
3300017924|Ga0187820_1058279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1055Open in IMG/M
3300017933|Ga0187801_10407349Not Available566Open in IMG/M
3300017937|Ga0187809_10144541Not Available820Open in IMG/M
3300017966|Ga0187776_10962587Not Available624Open in IMG/M
3300017972|Ga0187781_10228503All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Rubellimicrobium → Rubellimicrobium aerolatum1315Open in IMG/M
3300017973|Ga0187780_10992323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia612Open in IMG/M
3300018007|Ga0187805_10056482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1764Open in IMG/M
3300020069|Ga0197907_11353825All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Ornithinimicrobiaceae → Ornithinimicrobium → unclassified Ornithinimicrobium → Ornithinimicrobium sp. CNJ-824692Open in IMG/M
3300020070|Ga0206356_11483307All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300020070|Ga0206356_11885623Not Available1196Open in IMG/M
3300020082|Ga0206353_10851390All Organisms → cellular organisms → Bacteria → Terrabacteria group623Open in IMG/M
3300020580|Ga0210403_11286875Not Available559Open in IMG/M
3300021178|Ga0210408_10641048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura formosensis839Open in IMG/M
3300021180|Ga0210396_10584975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia972Open in IMG/M
3300021403|Ga0210397_10298921Not Available1182Open in IMG/M
3300021404|Ga0210389_11550683Not Available503Open in IMG/M
3300021406|Ga0210386_10567597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium → Mycobacterium haemophilum980Open in IMG/M
3300021445|Ga0182009_10579687Not Available599Open in IMG/M
3300021560|Ga0126371_13186686Not Available555Open in IMG/M
3300024181|Ga0247693_1025042Not Available809Open in IMG/M
3300025906|Ga0207699_11241518Not Available552Open in IMG/M
3300025908|Ga0207643_10580199Not Available721Open in IMG/M
3300025912|Ga0207707_11124097Not Available639Open in IMG/M
3300025916|Ga0207663_11701031Not Available507Open in IMG/M
3300025919|Ga0207657_10174115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1742Open in IMG/M
3300025928|Ga0207700_12020790Not Available503Open in IMG/M
3300025929|Ga0207664_10569549Not Available1017Open in IMG/M
3300025932|Ga0207690_11165166All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300025934|Ga0207686_10057083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2456Open in IMG/M
3300026035|Ga0207703_11708998Not Available605Open in IMG/M
3300026088|Ga0207641_12054099Not Available572Open in IMG/M
3300026374|Ga0257146_1067904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300026557|Ga0179587_10168813Not Available1372Open in IMG/M
3300027905|Ga0209415_10287872All Organisms → cellular organisms → Bacteria1432Open in IMG/M
3300028872|Ga0307314_10036152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1194Open in IMG/M
3300028906|Ga0308309_10354589All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1251Open in IMG/M
3300031152|Ga0307501_10029830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1107Open in IMG/M
3300031544|Ga0318534_10648270All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia598Open in IMG/M
3300031572|Ga0318515_10672081Not Available549Open in IMG/M
3300031573|Ga0310915_10408146All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria965Open in IMG/M
3300031640|Ga0318555_10180602Not Available1135Open in IMG/M
3300031681|Ga0318572_10739490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium585Open in IMG/M
3300031682|Ga0318560_10152581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1223Open in IMG/M
3300031708|Ga0310686_104455914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales2104Open in IMG/M
3300031713|Ga0318496_10168842Not Available1198Open in IMG/M
3300031713|Ga0318496_10599644Not Available608Open in IMG/M
3300031747|Ga0318502_10413659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria803Open in IMG/M
3300031765|Ga0318554_10844357All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces puniciscabiei511Open in IMG/M
3300031771|Ga0318546_10823298All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300031792|Ga0318529_10448491Not Available600Open in IMG/M
3300031795|Ga0318557_10472683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium576Open in IMG/M
3300031797|Ga0318550_10279072Not Available811Open in IMG/M
3300031799|Ga0318565_10077327All Organisms → cellular organisms → Bacteria1578Open in IMG/M
3300031819|Ga0318568_10787382Not Available590Open in IMG/M
3300031832|Ga0318499_10199537Not Available780Open in IMG/M
3300031845|Ga0318511_10020332All Organisms → cellular organisms → Bacteria2420Open in IMG/M
3300031880|Ga0318544_10113914All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1025Open in IMG/M
3300031893|Ga0318536_10393809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium699Open in IMG/M
3300031894|Ga0318522_10029081All Organisms → cellular organisms → Bacteria1856Open in IMG/M
3300031894|Ga0318522_10151830Not Available873Open in IMG/M
3300031896|Ga0318551_10485908Not Available707Open in IMG/M
3300031897|Ga0318520_10487524All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia760Open in IMG/M
3300031938|Ga0308175_101625015All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300031942|Ga0310916_11140297All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces646Open in IMG/M
3300031947|Ga0310909_10256871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Actinopolymorphaceae → Actinopolymorpha1460Open in IMG/M
3300031954|Ga0306926_10761029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1170Open in IMG/M
3300032066|Ga0318514_10111279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1397Open in IMG/M
3300032068|Ga0318553_10296368All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia846Open in IMG/M
3300032089|Ga0318525_10656102Not Available534Open in IMG/M
3300032090|Ga0318518_10722838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia506Open in IMG/M
3300032261|Ga0306920_102197094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300032261|Ga0306920_103334159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae598Open in IMG/M
3300032783|Ga0335079_11323041Not Available719Open in IMG/M
3300032893|Ga0335069_10051394All Organisms → cellular organisms → Bacteria5406Open in IMG/M
3300032896|Ga0335075_10018797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia10241Open in IMG/M
3300032896|Ga0335075_10955151Not Available776Open in IMG/M
3300032897|Ga0335071_10671905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia986Open in IMG/M
3300033134|Ga0335073_11354581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia699Open in IMG/M
3300033158|Ga0335077_10536909Not Available1231Open in IMG/M
3300033289|Ga0310914_10117192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2312Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil30.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.35%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.35%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil5.56%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.97%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.17%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere3.17%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.38%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.38%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.38%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil2.38%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.38%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.38%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.59%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.59%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.79%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.79%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.79%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.79%
Environmental → Unclassified → Unclassified → Unclassified → Unclassified → 0.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908016Sample 642EnvironmentalOpen in IMG/M
2166559006Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembledEnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026374Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-AEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031894Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
OU_024599702124908016MPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL
FI_004583302166559006Grass SoilPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIIGAL
JGI12269J14319_1000959623300001356Peatlands SoilMANTGIGSPDQIRSDLSARLDRFGLSYLVAGEDSLPGLAEIVGGL*
JGIcombinedJ26739_10159042923300002245Forest SoilTIYIGSPDQIRADLQARRQRFGLSYLVVGEDGLPALAEIVSGL*
Ga0066690_1018158433300005177SoilFIGSPAQIRDDLIARRARFGLSYLVASESNLPALAEVVSAL*
Ga0066684_1089759923300005179SoilFIGSPAQIRDDLIARRARFGLSYLVAGEGALPALAAVTGAL*
Ga0070683_10223088423300005329Corn RhizosphereTAWQMPTVFIGSAAQIREDLHARRERFGLSYLVAAEDARPALTEIISGL*
Ga0068869_10189855913300005334Miscanthus RhizosphereTVWQMPTIFVGSAEQIRHDLRDRQERHGLSYLIGSDRDLATLTDIISGL*
Ga0070682_10054125913300005337Corn RhizosphereTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL*
Ga0070714_10042819913300005435Agricultural SoilIGSAAQIREDLHARRERFGLSYLVAAEDARPALTEIISGL*
Ga0070713_10026437833300005436Corn, Switchgrass And Miscanthus RhizosphereETAWQMPTIFIGSAAQIREDLHARRERFGLSYLVAPETARPALTEIISGL*
Ga0070711_10121760423300005439Corn, Switchgrass And Miscanthus RhizosphereFIGSPAQIRDDLIARRARFGLSYLVASESALPALAAVTGAL*
Ga0070711_10156394613300005439Corn, Switchgrass And Miscanthus RhizosphereWTGISAEQVWQMPTVFVGSPDQIRADLRERRQRFGLSYLVAGEDSRGALAEVISGL*
Ga0070663_10007453513300005455Corn RhizosphereIDAETVWEMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL*
Ga0070730_1091055023300005537Surface SoilVWQMPTIFIGSPEQIRADLSARRDRFGLSYLVVGEDGWPALAEIVSGL*
Ga0070762_1115765913300005602SoilQIRLDLLARRERFGLSYLVVGEDSQPALAEIISGL*
Ga0068866_1049658313300005718Miscanthus RhizosphereAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL*
Ga0066903_10058241913300005764Tropical Forest SoilAVWQMPTIFIGSLDQIRADLLARRERFGLSYLVVGEGEQPALAEIISGL*
Ga0066903_10146786733300005764Tropical Forest SoilGIDVEAVWQMPTIFIGSLGQIRADLRARRERFGLSYLVVGEDGLPSLAEIVSGL*
Ga0070717_1109818013300006028Corn, Switchgrass And Miscanthus RhizosphereQIREDLHARRERFGLSYLVAAEDARPALTEIISGL*
Ga0070717_1124992423300006028Corn, Switchgrass And Miscanthus RhizosphereWQMPTIFIGSAAQIREDLHARRERFGLSYLVAPETARPALTEIISGL*
Ga0070765_10041962833300006176SoilWQMPTIFIGSAEQIRSDLQQRQQRYGLSYLVAGEDALPVLAEIASGL*
Ga0116224_1040359523300009683Peatlands SoilWQMPTIFIGSLDQIRSDLQERQQRFGLSYLVAGEDGLPVLAEIASGL*
Ga0126373_1073862413300010048Tropical Forest SoilDAEEVWQMPTIFIGSLDQIRADLQARRERFGLSYLVVGEEGLPVLTEIISGL*
Ga0126373_1204442823300010048Tropical Forest SoilEQIRSDLQERRERFGLSYLVVGEDSLPTLTEIITGL*
Ga0126373_1264039113300010048Tropical Forest SoilPEQIRSDLRARRERFGLSYLVVGEDGLPALAEIVSGL*
Ga0134111_1021390723300010329Grasslands SoilDAETVWEMPTTFIGSPAQIRDDLLARRARFGLSYLVAAENALPALAEIIGAL*
Ga0126372_1196154523300010360Tropical Forest SoilIFIGSPQQIRSDLRARQDRFGLSYLVAGENDLPTLAAIVSVL*
Ga0126379_1049927743300010366Tropical Forest SoilFIGSLDQIRADLLARRERFSLSYLVVGEDGLPALAEIVSGL*
Ga0126379_1129920513300010366Tropical Forest SoilTIFIGSPDQIRADLHARRERFGLSYLVAGEDNLPALAEIIGGL*
Ga0126379_1158119623300010366Tropical Forest SoilIRSDLRARRERFGLSYLVVGEDGLPALAEIVSGL*
Ga0134126_1219590913300010396Terrestrial SoilAETVWQMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVSAL*
Ga0134126_1261910313300010396Terrestrial SoilSPAQIRDDLIARRARFGLSYLVAPESALPALADIISAL*
Ga0134122_1070045333300010400Terrestrial SoilAQIRDDLLARRARFGLSYLVAAEDALPALAEIVGVR*
Ga0137383_1057670713300012199Vadose Zone SoilQIRADLRARRERFGLSYLVAGEEALAALAEIVSGL*
Ga0137381_1117071623300012207Vadose Zone SoilDPETVWEMPVIFIGSPAQIRDDLIARRARFGLSYLVASESTLPALAEIVSAL*
Ga0137378_1106182313300012210Vadose Zone SoilWTGVDVEAVWQMPTMFIGSLDQIRADLRARRERFGLSYLVAGEEALAALAEIVSGL*
Ga0137387_1069410413300012349Vadose Zone SoilVWEMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALSEIIGAL*
Ga0137371_1143016013300012356Vadose Zone SoilVFIGSPAQIREDLLARRARFGLSYLVAAESALPALADVVGVL*
Ga0164307_1036905613300012987SoilGSPAQIRDDLLARRARFGLSYLVAAENALPALAEIVGAL*
Ga0163162_1125679813300013306Switchgrass RhizosphereAETVWEMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVSAL*
Ga0157372_1149760923300013307Corn RhizosphereWEMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL*
Ga0134085_1045760213300015359Grasslands SoilIHEDLLTRRARFGLSYLVAAESALPALSEVIGAL*
Ga0132257_10188903223300015373Arabidopsis RhizosphereGSPAQIRDDLLARRARFGLSYLVAAESALPALGEIVGAL*
Ga0182041_1093923613300016294SoilMPTIFIGSLEQIRSDLQARRERFGLSYLVVGEDGLPALAEIVSGL
Ga0182032_1157270613300016357SoilVETVWQMPTIFIGSPQQIRSDLRARQERFGLSYLVVGENDLPAIAEIVSDL
Ga0187820_105827913300017924Freshwater SedimentVWQLPTIFIGSAEQIRSDLLERRDRSGLSYRVAGDSALPALAEIAGGL
Ga0187801_1040734923300017933Freshwater SedimentWQMPTIFIGSAAQIRADLRERREIFGLSYLVAGEAALPALAEIASGL
Ga0187809_1014454113300017937Freshwater SedimentMPTIFIGSTEQIRSDLLERRDRCGLSYLVAGAGALPALAEIASGL
Ga0187776_1096258723300017966Tropical PeatlandMADADDLHRSPDQIRSDLQDRHQRFGLSYLVAGEDALPMLAEIASGL
Ga0187781_1022850313300017972Tropical PeatlandSPDQIRSDLHVRRDRFGLSYLVAGEDNLPALAEIVSGL
Ga0187780_1099232313300017973Tropical PeatlandVEALWQMPTVFIGSLDQIRSDLQARRERFGLSYLVAGEDNLPALAEIVSGL
Ga0187805_1005648243300018007Freshwater SedimentTIFIGSAAQIRADLRERREIFGLSYLVAGEAALPALAEIASGL
Ga0197907_1135382523300020069Corn, Switchgrass And Miscanthus RhizosphereVWQMPTIFIGSPDQVRSDLQERRERFGLSYLVAGEDSLPVLAEVIRGL
Ga0206356_1148330733300020070Corn, Switchgrass And Miscanthus RhizosphereGTPDQIRADLRARQERFGLSYLVAGQDALPALTSIISGL
Ga0206356_1188562313300020070Corn, Switchgrass And Miscanthus RhizosphereIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL
Ga0206353_1085139023300020082Corn, Switchgrass And Miscanthus RhizosphereDAVWEMPTIFIGTPDQIRADLRARQERFGLSYLVAGQDALPALTSIISGL
Ga0210403_1128687523300020580SoilGSPAQIRDDLLARRARFGLSYLVAAESALPALTKIVSAL
Ga0210408_1064104823300021178SoilSPAQIRDDLIARRARFGLSYLVASESSLPALAEVVSAL
Ga0210396_1058497523300021180SoilSPAQIRDDLLARRARFGLSYLVAAESALPALTKIVSAL
Ga0210397_1029892113300021403SoilAETVWEMPTIFIGSPAQIRDDLLARRARFGLSYLVAGESALPALTEIVSAL
Ga0210389_1155068323300021404SoilTPPVFIGSPAQIRDDLLARRPRFGLSYLVAPESALPALADIVSAL
Ga0210386_1056759733300021406SoilIFIGSPEQIRTDLQARLERFGLSYLVAGEDVRPALAEIIGGLKKDI
Ga0182009_1057968713300021445SoilTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVSGL
Ga0126371_1318668613300021560Tropical Forest SoilSLDQIRADLLARRERFCLSYLVVGEDGLPALAEIVSGL
Ga0247693_102504223300024181SoilTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL
Ga0207699_1124151823300025906Corn, Switchgrass And Miscanthus RhizosphereGIDAEAAWQMPTIFIGSAAQIREDLHARRERFGLSYLVAAESARPALTEIISGL
Ga0207643_1058019913300025908Miscanthus RhizosphereFIGSPAQIRDDLLARRARFGLSYLVAAEDALPALAEIVGAL
Ga0207707_1112409713300025912Corn RhizosphereTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL
Ga0207663_1170103123300025916Corn, Switchgrass And Miscanthus RhizosphereVCSPAQIRDDLIARRARFGLSYLVAGESALPALAAVTGAL
Ga0207657_1017411533300025919Corn RhizosphereIDVEQVWQMPTVFIGSPDQIRADLHARRERFGLSYLVAGEDSQPALAEVISGL
Ga0207700_1202079013300025928Corn, Switchgrass And Miscanthus RhizosphereDAETAWQMPTIFIGSAAQIREDLHARRERFGLSYLVAAETARPALTEIISGL
Ga0207664_1056954933300025929Agricultural SoilFIGSAAQIREDLHARRERFGLSYLVAAEDARPALTEIISGL
Ga0207690_1116516613300025932Corn RhizosphereEQVWQMPTVFIGSPDQIRADLHARRERFGLSYLVAGEDSQSALAEVISGL
Ga0207686_1005708353300025934Miscanthus RhizosphereMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVSAL
Ga0207703_1170899813300026035Switchgrass RhizosphereTSFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL
Ga0207641_1205409923300026088Switchgrass RhizosphereSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVGAL
Ga0257146_106790423300026374SoilVWQMPTVFIGSPAQIRDDLLARRARFGLSYLVAAESALPALADIVSAL
Ga0179587_1016881323300026557Vadose Zone SoilAWQMPTVFIGSPAQIRDDLLARRARFGLSYLVAAESALPALADIVGAL
Ga0209415_1028787223300027905Peatlands SoilMANTGIGSPDQIRSDLSARLDRFGLSYLVAGEDSLPGLAEIVGGL
Ga0307314_1003615233300028872SoilAETVWQMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVSAL
Ga0308309_1035458913300028906SoilGSAEQIRSDLQQRQQRYGLSYLVAGEDALPVLAEIASGL
Ga0307501_1002983013300031152SoilWEMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIIGAL
Ga0318534_1064827013300031544SoilVWQMPTIFIGSPDQIRSDLHARRERSGLSYLVAGQDNLPALAEIAGGL
Ga0318515_1067208113300031572SoilFIGSPAQIRDDLRARRDRFGLSYLVVGEDTLPALTGIVGAL
Ga0310915_1040814633300031573SoilETVWEMPTIFIGSPAQIRDDLMARRARFGLSYLVASESALPALAEIVSAL
Ga0318555_1018060233300031640SoilPTIFIGSPAQIRDDLMARRARFGLSYLVAGESALPALAKIVSAL
Ga0318572_1073949013300031681SoilLDVEAVWQMPTIFIGSPDQIRSDLQARRERFGLSYLVAGEDNLPALAEIIGGL
Ga0318560_1015258123300031682SoilIFIGSPDQIRSDLHARRERFGLSYLVAGEGNLPALAEIAGGL
Ga0310686_10445591443300031708SoilMANTGIGTPDQIRSDLSARLDRFGLSYLVAGEDSLPGLAEIVGGL
Ga0318496_1016884213300031713SoilVWEMPTIFIGSLAQIRDDLMARRARFGLSYLVAGESALPALAEIVSAL
Ga0318496_1059964413300031713SoilTIFIGSPAQIRDDLMARRARFGLSYLVASESALPALTQVVSAL
Ga0318502_1041365913300031747SoilAETVWQMPTIFIGSPGQIRDDLRARAQRFGLSYLVAPDRDLPTLATIISGL
Ga0318554_1084435723300031765SoilVEAVWQMPTIFIGSPEQIRSDLRARRERFGLSYLVVGEDGLPALTEIVGGL
Ga0318546_1082329823300031771SoilIWQMPTIFIGSPDQIRSDLHARRERFGLSYLVAGEGNLPALAEIAGGL
Ga0318529_1044849113300031792SoilAQIRDDLMARRARFGLSYLVAGESALPALAKIVNAL
Ga0318557_1047268313300031795SoilMPTIFIGSPDQIRSDLQARRERFGLSYLVAGEDNLPALAEIISGL
Ga0318550_1027907223300031797SoilVWQMPTIFVGSLEQIRSDLRARRERFGLSYLVVGEDGLPALAEIVSGL
Ga0318565_1007732733300031799SoilMPTMFIGSPAQIRDDLMARRARFGLSYLVAGESALPALAKIVNAL
Ga0318568_1078738213300031819SoilVWQMPTIFIGSPQQIRSDLRARQERFGLSYLVAGENDLPTLAEIVIDL
Ga0318499_1019953733300031832SoilIFIGSPAQIRDDLMARRARFGLSYLVASESALPALAEIVSAL
Ga0318511_1002033243300031845SoilMPTIFIGSPAQIRDDLMARRARFGLSYLVASESALPALAEIVSAL
Ga0318544_1011391413300031880SoilFVGSLEQIRSDLRARRERFGLSYLVVGEDGLPALAEIVSGL
Ga0318536_1039380913300031893SoilAVWQMPTIFIGSPDQIRSDLQARRERFGLSYLVAGEDNLPALPEIIGGL
Ga0318522_1002908113300031894SoilQMPTIFIGSPDQIRSDLQARRERFGLSYLVAGEDNLPALAEIISGL
Ga0318522_1015183013300031894SoilQIRDDLMARRARFGLSYLVASESALPALAEIVSAL
Ga0318551_1048590823300031896SoilEQIRSDLRARRERFGLSYLVVGEDGLPALAEIVSGL
Ga0318520_1048752433300031897SoilVWQMPTIFIGSPDQIRSDLQARRERFGLSYLVAGEDNLPALAEIVGGL
Ga0308175_10162501513300031938SoilDAETVWQMPTTFIGSPAQIRDDLLARRARFGLSYLVAAESALPALAEIVSAF
Ga0310916_1114029723300031942SoilIDVETVWQMPTIFIGSPQQIRSDLRARQERFGLSYLVVGENDLPAIAEIVSDL
Ga0310909_1025687113300031947SoilMPTIFIGSLEQIRSDLRARRERFGLSYLVVGEDGLPALAEIVSGL
Ga0306926_1076102913300031954SoilGVDVEAIWQMPTIFIGSPDQIRSDLHARRERFGLSYLVAGEGNLPALAEIAGGL
Ga0318514_1011127923300032066SoilVWQMPTIFIGSPQQIRSDLRARQERFGLSYLVVGENDLPAIAEIVSDL
Ga0318553_1029636813300032068SoilDQIRSDLHARRERSGLSYLVAGQDNLPALAEIAGGL
Ga0318525_1065610213300032089SoilDQIRSDLHARRERFGLSYLVAGEGNLPALAEIAGGL
Ga0318518_1072283823300032090SoilPDQIRSDLQARRERFGLSYLVAGEDNLPALAEIVGGL
Ga0306920_10219709423300032261SoilEMPTIFIGSPAQIRDDLMARRARFGLSYLVAGESALPALAKIVNAL
Ga0306920_10333415923300032261SoilQIRSDLQERRQRFGLSYLVAGEDGLPALAEIVSGP
Ga0335079_1132304123300032783SoilAQIRDDLLARQARFGLSYLVAGESALPALTEIVSAL
Ga0335069_1005139423300032893SoilMPTIFIGSPAQIRNDLMARRARFGLSYLVAGESALPALAEIVSAL
Ga0335075_10018797133300032896SoilFIGSPDQIRADLRERQERFGLSYLVATETALPALAEIASGL
Ga0335075_1095515113300032896SoilWGGIEAEAVWEMPTIFTGSPDQIRTDLHARREQSGLSYLVVGEDSQPVLAEIITGL
Ga0335071_1067190513300032897SoilMPTIVIGSPAQIRNDLMARRARFGLSYLVAGESALPALAEIVSAL
Ga0335073_1135458113300033134SoilEMPTIFIGSPAQIRDDLMARRARFGLSYLVVGESTLPALAEIVSAL
Ga0335077_1053690933300033158SoilIFIGSPAQIRDDLMARRARFGLSYLVVGESALPALAEIVSAL
Ga0310914_1011719243300033289SoilDQIRSDLQARREQFGLSYLVAGEDNLPALAEIVGGL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.