| Basic Information | |
|---|---|
| Family ID | F066945 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VASVASTYARAFADVVLSAHLDANRAIGGLRRIAGLLSESTEL |
| Number of Associated Samples | 119 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.21 % |
| % of genes from short scaffolds (< 2000 bps) | 96.83 % |
| Associated GOLD sequencing projects | 114 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.67 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.651 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.111 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.190 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.762 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.30% β-sheet: 0.00% Coil/Unstructured: 50.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.67 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF00430 | ATP-synt_B | 92.06 |
| PF03160 | Calx-beta | 0.79 |
| PF09285 | Elong-fact-P_C | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 92.06 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.65 % |
| Unclassified | root | N/A | 6.35 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104752834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 940 | Open in IMG/M |
| 3300000731|JGI12381J11899_1012267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 692 | Open in IMG/M |
| 3300001471|JGI12712J15308_10107788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300001661|JGI12053J15887_10261650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 856 | Open in IMG/M |
| 3300001867|JGI12627J18819_10207837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300004091|Ga0062387_100340959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 984 | Open in IMG/M |
| 3300004092|Ga0062389_102766916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 654 | Open in IMG/M |
| 3300004152|Ga0062386_101647150 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 535 | Open in IMG/M |
| 3300005467|Ga0070706_100310862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1470 | Open in IMG/M |
| 3300005468|Ga0070707_100636322 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1029 | Open in IMG/M |
| 3300005533|Ga0070734_10555894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300005538|Ga0070731_10391862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 923 | Open in IMG/M |
| 3300005559|Ga0066700_11062916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 530 | Open in IMG/M |
| 3300005587|Ga0066654_10053267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1796 | Open in IMG/M |
| 3300005764|Ga0066903_104653483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 731 | Open in IMG/M |
| 3300005889|Ga0075290_1045720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300005921|Ga0070766_11282357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 508 | Open in IMG/M |
| 3300006028|Ga0070717_10370307 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1283 | Open in IMG/M |
| 3300006162|Ga0075030_100550385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 916 | Open in IMG/M |
| 3300006176|Ga0070765_100684823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 968 | Open in IMG/M |
| 3300006854|Ga0075425_101868153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 673 | Open in IMG/M |
| 3300009088|Ga0099830_10128304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1928 | Open in IMG/M |
| 3300009672|Ga0116215_1166610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 976 | Open in IMG/M |
| 3300009759|Ga0116101_1067410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 793 | Open in IMG/M |
| 3300010043|Ga0126380_11151595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300010048|Ga0126373_10277016 | All Organisms → cellular organisms → Bacteria | 1663 | Open in IMG/M |
| 3300010339|Ga0074046_10058960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2530 | Open in IMG/M |
| 3300010379|Ga0136449_100932875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1409 | Open in IMG/M |
| 3300010396|Ga0134126_10567796 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1301 | Open in IMG/M |
| 3300010398|Ga0126383_11351641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 802 | Open in IMG/M |
| 3300010876|Ga0126361_10723168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300011269|Ga0137392_10608246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300012096|Ga0137389_11690574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300012199|Ga0137383_10835399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300012359|Ga0137385_11326549 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300012363|Ga0137390_10087009 | All Organisms → cellular organisms → Bacteria | 3078 | Open in IMG/M |
| 3300012683|Ga0137398_10176291 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1400 | Open in IMG/M |
| 3300012683|Ga0137398_10459031 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 872 | Open in IMG/M |
| 3300012971|Ga0126369_10567043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1202 | Open in IMG/M |
| 3300013100|Ga0157373_11231892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300014165|Ga0181523_10189348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1195 | Open in IMG/M |
| 3300014200|Ga0181526_10453480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 813 | Open in IMG/M |
| 3300014969|Ga0157376_10985612 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 865 | Open in IMG/M |
| 3300015372|Ga0132256_101744222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300016341|Ga0182035_11783744 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300016357|Ga0182032_11798820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300017822|Ga0187802_10424782 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300017932|Ga0187814_10401752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300017934|Ga0187803_10409724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300017943|Ga0187819_10100179 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1731 | Open in IMG/M |
| 3300017948|Ga0187847_10630519 | Not Available | 600 | Open in IMG/M |
| 3300017959|Ga0187779_10556282 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
| 3300017970|Ga0187783_11090348 | Not Available | 575 | Open in IMG/M |
| 3300017995|Ga0187816_10097326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1261 | Open in IMG/M |
| 3300018042|Ga0187871_10514385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300018088|Ga0187771_10897482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300019278|Ga0187800_1095618 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300019278|Ga0187800_1296613 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300020580|Ga0210403_10200393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1638 | Open in IMG/M |
| 3300020582|Ga0210395_10942931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300021171|Ga0210405_11334195 | Not Available | 525 | Open in IMG/M |
| 3300021401|Ga0210393_10567803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 927 | Open in IMG/M |
| 3300021433|Ga0210391_10424966 | Not Available | 1043 | Open in IMG/M |
| 3300021475|Ga0210392_10470892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| 3300021477|Ga0210398_11261178 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300021479|Ga0210410_11821641 | Not Available | 503 | Open in IMG/M |
| 3300021560|Ga0126371_13815714 | Not Available | 508 | Open in IMG/M |
| 3300022509|Ga0242649_1010771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 970 | Open in IMG/M |
| 3300022523|Ga0242663_1028861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 884 | Open in IMG/M |
| 3300022722|Ga0242657_1126455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300024225|Ga0224572_1013357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1566 | Open in IMG/M |
| 3300025604|Ga0207930_1072730 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300025928|Ga0207700_10085673 | All Organisms → cellular organisms → Bacteria | 2474 | Open in IMG/M |
| 3300025928|Ga0207700_10209581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1647 | Open in IMG/M |
| 3300026514|Ga0257168_1147141 | Not Available | 525 | Open in IMG/M |
| 3300026538|Ga0209056_10410763 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
| 3300027604|Ga0208324_1168770 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300027629|Ga0209422_1036355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1204 | Open in IMG/M |
| 3300027660|Ga0209736_1062213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1046 | Open in IMG/M |
| 3300027676|Ga0209333_1027701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1591 | Open in IMG/M |
| 3300027701|Ga0209447_10143177 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300027737|Ga0209038_10026949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1701 | Open in IMG/M |
| 3300027824|Ga0209040_10181168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1109 | Open in IMG/M |
| 3300027889|Ga0209380_10882414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 503 | Open in IMG/M |
| 3300027895|Ga0209624_10687326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300027905|Ga0209415_10224268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1733 | Open in IMG/M |
| 3300027908|Ga0209006_10064874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3261 | Open in IMG/M |
| 3300028536|Ga0137415_11313615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300028746|Ga0302233_10240023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 688 | Open in IMG/M |
| 3300028768|Ga0307280_10250402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300028789|Ga0302232_10285981 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 815 | Open in IMG/M |
| 3300028800|Ga0265338_10162888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1720 | Open in IMG/M |
| 3300028906|Ga0308309_11606247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
| 3300029882|Ga0311368_10833568 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300029913|Ga0311362_10378590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1404 | Open in IMG/M |
| 3300029953|Ga0311343_10254449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1752 | Open in IMG/M |
| 3300029999|Ga0311339_11688344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300030007|Ga0311338_10383661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1515 | Open in IMG/M |
| 3300030058|Ga0302179_10318304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 685 | Open in IMG/M |
| 3300030490|Ga0302184_10081053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1501 | Open in IMG/M |
| 3300030580|Ga0311355_11573594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300030617|Ga0311356_11888984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300030743|Ga0265461_10189555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1239 | Open in IMG/M |
| 3300031057|Ga0170834_112812234 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300031236|Ga0302324_101878747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300031525|Ga0302326_10499429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1844 | Open in IMG/M |
| 3300031715|Ga0307476_10350058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300031715|Ga0307476_10512918 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300031753|Ga0307477_10121733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1819 | Open in IMG/M |
| 3300031868|Ga0316038_112824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300031996|Ga0308176_10364565 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1430 | Open in IMG/M |
| 3300032160|Ga0311301_10587807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1611 | Open in IMG/M |
| 3300032160|Ga0311301_12088972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 656 | Open in IMG/M |
| 3300032180|Ga0307471_102686164 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300032205|Ga0307472_101101126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 752 | Open in IMG/M |
| 3300032828|Ga0335080_11731956 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
| 3300032892|Ga0335081_11409848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300033004|Ga0335084_10340477 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1548 | Open in IMG/M |
| 3300033134|Ga0335073_11890143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300033158|Ga0335077_11244569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300033158|Ga0335077_11778224 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 580 | Open in IMG/M |
| 3300033158|Ga0335077_11796751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300033289|Ga0310914_10974232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300033402|Ga0326728_10831107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300033807|Ga0314866_108883 | Not Available | 505 | Open in IMG/M |
| 3300034163|Ga0370515_0392992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.11% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.14% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.35% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.56% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.76% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.76% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.97% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.17% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 2.38% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.38% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.59% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.59% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.59% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.79% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.79% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.79% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.79% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.79% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.79% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000731 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005889 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_201 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022509 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-27-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU5 | Host-Associated | Open in IMG/M |
| 3300025604 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027629 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029953 | II_Bog_E3 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030743 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assembly | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031868 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLA1 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1047528341 | 3300000364 | Soil | MASVASTYARAFADVVFDSHLDAAHAIGGLRQIATLFSQS |
| JGI12381J11899_10122671 | 3300000731 | Tropical Forest Soil | MASVASTYARAFADVVFEAHLDANRAIGGLRRISG |
| JGI12712J15308_101077882 | 3300001471 | Forest Soil | MASVASTYARAFADVVLGAHLDANRAIAELRAIASL |
| JGI12053J15887_102616502 | 3300001661 | Forest Soil | MASVGSTYARAFVDVVLSAKLDANRAIAELHTLAGLLADS |
| JGI12627J18819_102078371 | 3300001867 | Forest Soil | MASVASTYARAFADVVFDAHLDAARALGALRQIATL |
| Ga0062387_1003409591 | 3300004091 | Bog Forest Soil | VASVASTYARAFADVVLSAHLDANRAIGGLRRIAGLLSESTEL |
| Ga0062389_1027669161 | 3300004092 | Bog Forest Soil | MASVASTYARAFADVVMSAHLNADSSIAELRAIASLLTESAE |
| Ga0062386_1016471501 | 3300004152 | Bog Forest Soil | VASVASTYARAFADVVLDEHLDANRAIGGLRGIAELFSGSVELR |
| Ga0070706_1003108623 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VASVASTYARAFADVVFSAHLDASRAVGGLRRIAGLLAESAELRR |
| Ga0070707_1006363221 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VASVASTYARAFADVVLSARLDANVAIGGLREISRLLTESSDLRR |
| Ga0070734_105558941 | 3300005533 | Surface Soil | MASVASTYARAFAEVVFDTRMDANRAIGGLRRISGLL |
| Ga0070731_103918622 | 3300005538 | Surface Soil | MASVASTYARAFADVVFEQRLDAARAAAGLRSIATLFKESVD |
| Ga0066700_110629162 | 3300005559 | Soil | MASVASSYARAFADVVLSAKLDADRAISELRTLARLLEESV |
| Ga0066654_100532674 | 3300005587 | Soil | VASVASTYARAFADVVFNARLDAAHASAGLREIAR |
| Ga0066903_1046534831 | 3300005764 | Tropical Forest Soil | VASVASTYARAFADVVFDTHLDAGRAIAGLRQIAGLFNQSIELRR |
| Ga0075290_10457202 | 3300005889 | Rice Paddy Soil | MASVASTYARAFADVVFAAQLDAARAMAGLRQIAAL |
| Ga0070766_112823572 | 3300005921 | Soil | MASVASTYARAFADVVMSKHLDADRSIGELRTISSLLA |
| Ga0070717_103703071 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MASVPSTYARAFADVVFSAHLDAARAVGGLRQIAALVEQSADL |
| Ga0075030_1005503851 | 3300006162 | Watersheds | MASVASTYARAFADVVFDAHLDAGRAVDGLLRITS |
| Ga0070765_1006848232 | 3300006176 | Soil | VASVASTYARAFADVVLSAHLDANRALAGLGRIRTLL |
| Ga0075425_1018681532 | 3300006854 | Populus Rhizosphere | MASVASTYARAFADVVFDAHLDAGRAVGSLRQIAGLFNQSIELRR |
| Ga0099830_101283045 | 3300009088 | Vadose Zone Soil | MASVASSYARAFADVVLSAKLDADRAISELRTLARLL |
| Ga0116215_11666102 | 3300009672 | Peatlands Soil | MASVASTYARAFADVVLDEHLDADRSVAQLRTIATLLNESSD |
| Ga0116101_10674102 | 3300009759 | Peatland | MASVANTYARAFADVVLSSHLDADRSIAELRTIAQLLDESSD |
| Ga0126380_111515951 | 3300010043 | Tropical Forest Soil | MASVASAYARAFADVVLEAHLDPQRAVGGLRRIEGLLDQSEELRRV |
| Ga0126373_102770163 | 3300010048 | Tropical Forest Soil | MASVASTYARAFADVVFDAHLDAGRAINGLRRIASLFSQSLD |
| Ga0074046_100589601 | 3300010339 | Bog Forest Soil | MASVASTYARAFADVVLSDHLDAERSVAELRAIANLLAESPELR |
| Ga0136449_1009328751 | 3300010379 | Peatlands Soil | MASVASAYARAFADVVLSSHLDADRSIAELRTIASLL |
| Ga0134126_105677963 | 3300010396 | Terrestrial Soil | MASVASTYARAFADVVFAAHLDAARASGGLRQIAALSE |
| Ga0126383_113516411 | 3300010398 | Tropical Forest Soil | MATVASTYARAFADVVFDARLDAAKAVDGLRQIASLFGESVELRR |
| Ga0126361_107231682 | 3300010876 | Boreal Forest Soil | MASVASTYARAFADVVLGEHLDVNRAIADLRTLASLLSESSE |
| Ga0137392_106082462 | 3300011269 | Vadose Zone Soil | MASVASTYARAFADVVLDTHLDAGRSISELRAIANLLAESPELR |
| Ga0137389_116905741 | 3300012096 | Vadose Zone Soil | MASVASSYARAFVDVVLSAKLDANRAIAELRTLAGLLAESAD |
| Ga0137383_108353992 | 3300012199 | Vadose Zone Soil | MASVASTYARAFADVVFDAHLDAARALGALRQIATLL |
| Ga0137385_113265492 | 3300012359 | Vadose Zone Soil | VSSVASTYARAFADVVLSAHLDANRSVGGLRRIAGLLQESADL |
| Ga0137390_100870091 | 3300012363 | Vadose Zone Soil | MASVASSYARAFVDVVLSAKLDANRAIAELRTLAGLLAESADLRRVWEN |
| Ga0137398_101762913 | 3300012683 | Vadose Zone Soil | MASVASTYARAFANVVLSSRLNPDRSITELRTVATLLS |
| Ga0137398_104590312 | 3300012683 | Vadose Zone Soil | VASVASTYSRAFADVVLSARLNADRSVAELPSIATLMA |
| Ga0126369_105670433 | 3300012971 | Tropical Forest Soil | MATVASTYARAFADVVFDARLDAAKAVGGLRQIAGLFGESA |
| Ga0157373_112318922 | 3300013100 | Corn Rhizosphere | MASVPSTYARAFADVVFSAHLDAARAVGGLRQIAALVEQ |
| Ga0181523_101893483 | 3300014165 | Bog | MASVASTYARAFADVVLGSHLDVNRALGELYAIAGLLTESSEL |
| Ga0181526_104534802 | 3300014200 | Bog | MASVASTYARAFADVVLGSHLDVNRALGELYAIAGL |
| Ga0157376_109856122 | 3300014969 | Miscanthus Rhizosphere | MSSVASTYARAFADVVLSAHLDANRAVGGLGRVADLLHESTNLRRV* |
| Ga0132256_1017442222 | 3300015372 | Arabidopsis Rhizosphere | MASVASTYARAFADVVFSAHLDAGRAVDGLRRLASLFAGSVELRRVWENPA |
| Ga0182035_117837441 | 3300016341 | Soil | MASVASTYARAFADVVFETRLDAGRAVGGLQRITAL |
| Ga0182032_117988202 | 3300016357 | Soil | MASVASTYARAFADVVFETRLDAGRAVGGLQRITALFTESVELRRVW |
| Ga0187802_104247821 | 3300017822 | Freshwater Sediment | MASVASTYARAFADVVLEAHLDVQRATGGLRRIAGLLAESTELRRVW |
| Ga0187814_104017521 | 3300017932 | Freshwater Sediment | MASVASTYARAFADVVFEERLDAARATAGLRSIAALFEESIELRRVW |
| Ga0187803_104097242 | 3300017934 | Freshwater Sediment | LASVASTYARAFADVVLEAHLDVQRATGGLRRIAGLLAE |
| Ga0187819_101001791 | 3300017943 | Freshwater Sediment | VASVASTYARAFADVVLDEHLDAGRAIGGLRRISGLLDESTEL |
| Ga0187847_106305191 | 3300017948 | Peatland | MASVASTYSRAFADVVLSAHLDVNRALLDLRAIATL |
| Ga0187779_105562822 | 3300017959 | Tropical Peatland | MASVASTYARAFADVVLEAHLDPERAVGGLRRMEGLLKESVQLRRVW |
| Ga0187783_110903482 | 3300017970 | Tropical Peatland | VASVASTYARAFADVVIAKQLDANRALGGLRRIAGLMD |
| Ga0187816_100973261 | 3300017995 | Freshwater Sediment | MASVASTYARAFADVVFDEHLDAARATAGLRSIAAL |
| Ga0187871_105143851 | 3300018042 | Peatland | MASVASTYARAFADVVLGSHLDADRSIAELRTIADLLSESSDLRRVWEN |
| Ga0187771_108974822 | 3300018088 | Tropical Peatland | MASIASTYARAFADVVLSAHLDADRSIAELRTIAGLLAESAELRR |
| Ga0187800_10956181 | 3300019278 | Peatland | VASVASTYARAFADVVVDLHLDASRAIAGLRRIAALLAESIE |
| Ga0187800_12966131 | 3300019278 | Peatland | VASVASTYARAFADVVLDMRLDASRAIGGLRSIAD |
| Ga0210403_102003931 | 3300020580 | Soil | MASVASTYARAFADVVFDTHLDADRSLAELRAIAGLLAESLEL |
| Ga0210395_109429311 | 3300020582 | Soil | VASVASTYARAFADVVFSARLDANAAIGGLQVISSLLAENAPLRRVWEN |
| Ga0210405_113341952 | 3300021171 | Soil | VASVASTYARAFADVVFRAQLDANRAVGGLREIAGLLAESDDLRR |
| Ga0210393_105678032 | 3300021401 | Soil | VASVASVYARAFADVVLDKHLDANRAIGGLRVIAGLVAESADLRRV |
| Ga0210391_104249661 | 3300021433 | Soil | MASVASTYARAFADVIFDTHFDANRAITELQSIAG |
| Ga0210392_104708921 | 3300021475 | Soil | VASVASTYARAFADVVFSADLDANREVGGLRRIAGLLTESA |
| Ga0210398_112611781 | 3300021477 | Soil | MASVASTYARAFADVVMSARLDANGVLGGLYRILD |
| Ga0210410_118216411 | 3300021479 | Soil | VASVANTYARAFADVVLDTHLDAARAIAGLRRITTLLGESVELRRVW |
| Ga0126371_138157142 | 3300021560 | Tropical Forest Soil | MASVASTYARAFADVVFDAHLDAGRAVGGLRRISGLFTESLELRRVW |
| Ga0242649_10107712 | 3300022509 | Soil | MASVASTYARAFADVVLGAHLDANRALTELRAIASLLSESLELR |
| Ga0242663_10288611 | 3300022523 | Soil | VASVASTYARAFADVVLAAHLDVNRAIAELRTIASLLSQSSEL |
| Ga0242657_11264551 | 3300022722 | Soil | MASVASTYARAFADVVLSARLNAGRSIAELRAIASLLAES |
| Ga0224572_10133571 | 3300024225 | Rhizosphere | MASVASTYARAFADVVLSTKLDAQRATGELRRIAGLLAESSDL |
| Ga0207930_10727302 | 3300025604 | Arctic Peat Soil | VASVASTYARAFADVVLSAHLDADRAVGGLREIAGLLAESADLRRV |
| Ga0207700_100856734 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MASVASTYARAFADVVMSGRLDAARSVSGLRAIAGLLSESVDL |
| Ga0207700_102095813 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MASVASTYARAFADVVFDAHLDAAKAVGGLREIASLYGESMELRR |
| Ga0257168_11471412 | 3300026514 | Soil | MPSVASTYARAFADVVLSARLNADRSIAELRMIADLLAQSSDLRRVWE |
| Ga0209056_104107632 | 3300026538 | Soil | MASVPSTYARAFADVILEKHLDAGKVLQELHTLVQLL |
| Ga0208324_11687702 | 3300027604 | Peatlands Soil | VASVASTYGRAFAEVVFSAHLDANRALGGLHRILDLLAES |
| Ga0209422_10363553 | 3300027629 | Forest Soil | MASVASTYARAFADVVLSARLNADRSIAELRTIASLLAQSSDLRRVWEN |
| Ga0209736_10622133 | 3300027660 | Forest Soil | MASVASTYARAFADVVLSARLNADRSIAELRMIASLLAESSDLRRVWE |
| Ga0209333_10277013 | 3300027676 | Forest Soil | MASVASTYARAFADVIFNTHFDANRAITELQSIAGLLAESSD |
| Ga0209447_101431772 | 3300027701 | Bog Forest Soil | MASVASTYARAFADVVMSKHLDADRSIAELRTIASLLDESSVL |
| Ga0209038_100269493 | 3300027737 | Bog Forest Soil | MASVASTYARAFADVVLDKHLDADRSVAQLRMIATLLDESSDLRR |
| Ga0209040_101811683 | 3300027824 | Bog Forest Soil | MASVASTYSRAFADVVLGSHLDADRCVAELRTIAGLLAESSDL |
| Ga0209380_108824141 | 3300027889 | Soil | VASVASTYARAFADVVLSAHLDANRAVGGLLQIVGLLAESEDL |
| Ga0209624_106873261 | 3300027895 | Forest Soil | MASVASIYARAFVDVVFDAHLDPGRAIDELSGIVSLMKE |
| Ga0209415_102242681 | 3300027905 | Peatlands Soil | MASVASTYARAFADVVLSAHLDANRAIGGLRRISG |
| Ga0209006_100648745 | 3300027908 | Forest Soil | MASVASTYARAFADVVLGAHLDANRAIAELRAIASLLNE |
| Ga0137415_113136151 | 3300028536 | Vadose Zone Soil | VASVASTYARAFADVVLSSRLNADRSVAELRAIATLLAQSSDLRRV |
| Ga0302233_102400231 | 3300028746 | Palsa | MASVANTYARAFADVVLGAHLNADRSIAELRTIAQLLDESSDLR |
| Ga0307280_102504021 | 3300028768 | Soil | VASVASTYARAFADVVLSARLDANGAIGGLREISR |
| Ga0302232_102859812 | 3300028789 | Palsa | MASVAGTYARAFADVVLSSHLDADRSIAELRTIASLLAESPELRRV |
| Ga0265338_101628883 | 3300028800 | Rhizosphere | VASVASTYARAFADVVFSAHLDANRAVGGLRRIASLLAESQDLRRVWEN |
| Ga0308309_116062471 | 3300028906 | Soil | MASVASTYARAFADVVLGAHLDANRALAELRAIASLLNQSSE |
| Ga0311368_108335681 | 3300029882 | Palsa | MASVAGTYARAFADVVLGSHLDADRSIAELRTIAT |
| Ga0311362_103785903 | 3300029913 | Bog | MASVASTYARAFADVVLSAHLDADRSIAELRAIASLLAESPELRR |
| Ga0311343_102544491 | 3300029953 | Bog | MASVANTYARAFADVVLSSHLDADRSIAELRTIAQLLDESSDLRRV |
| Ga0311339_116883442 | 3300029999 | Palsa | MASVAGTYARAFADVVLTDHLDADRSIAELRAIAGLL |
| Ga0311338_103836613 | 3300030007 | Palsa | VASVASTYARAFADVILSAHLDANRAIGGLRRIAALLAESTDL |
| Ga0302179_103183041 | 3300030058 | Palsa | MASVASTYARAFADVVLSDHLDAGGSTAQLRAIASLLAESSDLRR |
| Ga0302184_100810531 | 3300030490 | Palsa | MASVASTYARAFADVVLGAHLDVNRAIAELRTIASLLSESPELRR |
| Ga0311355_115735941 | 3300030580 | Palsa | MASVASTYARAFADVVLSAHLDAGGSTAQLRAVASLLAESSELRRVWE |
| Ga0311356_118889841 | 3300030617 | Palsa | MASVASTYARAFADVVLSDRLDAGGSTAQLRAISSLLAESSELRRVWD |
| Ga0265461_101895553 | 3300030743 | Soil | MASVASTYARAFADVVLSTKLDAQRATGELRRIAGLLKGKRKKN |
| Ga0170834_1128122341 | 3300031057 | Forest Soil | MASVASTYARAFADVVLSSRLDADRSITELRTIAA |
| Ga0302324_1018787472 | 3300031236 | Palsa | MASVASTYARAFADVVLSAHLDADRSIAELRAIASLLG |
| Ga0302326_104994293 | 3300031525 | Palsa | MASVASTYSRAFADVVLSAHLDADASIAELRSIASLLSESSEL |
| Ga0307476_103500583 | 3300031715 | Hardwood Forest Soil | VASVASTYARAFADVVFSAHLDANRAVGGLRRIVELLAESADLR |
| Ga0307476_105129182 | 3300031715 | Hardwood Forest Soil | MASVANTYARAFADVILNTHLDAGRSIAELRAIAGLLAES |
| Ga0307477_101217334 | 3300031753 | Hardwood Forest Soil | MASVASTYARAFADVILDTHLDANRSIAELRAIASL |
| Ga0316038_1128241 | 3300031868 | Soil | MASVASTYARAFADVVLSAHLDADRSIAELRTIASLLAESSNLRRV |
| Ga0308176_103645653 | 3300031996 | Soil | MASVPSTYARAFADVVFSAHLDAARSVDGLRQIAALFE |
| Ga0311301_105878071 | 3300032160 | Peatlands Soil | MASVASTYARAFADVVLSERLDADRAVAELRDIANL |
| Ga0311301_120889721 | 3300032160 | Peatlands Soil | VASVASTYARAFADVVLSARLDANRAIGGLRGIAEN |
| Ga0307471_1026861641 | 3300032180 | Hardwood Forest Soil | MASVASTYARAFADVVLSARLDADRSITELRSIATLLS |
| Ga0307472_1011011262 | 3300032205 | Hardwood Forest Soil | MASVANTYARAFADVVFGAHLDAARALGGLRQIAALFSQSAE |
| Ga0335080_117319562 | 3300032828 | Soil | VASVASTYARAFADVVFDTRLDAAQATSGLRRIATLFAESIEL |
| Ga0335081_114098482 | 3300032892 | Soil | VASVASTYARAFADVVFDKHLDAAQATGGLHSIATLF |
| Ga0335084_103404771 | 3300033004 | Soil | MASVASTYARAFADVVFSAHLDAGRALSGLRQIADLFSAN |
| Ga0335073_118901432 | 3300033134 | Soil | MASVANTYARAFADVVFDAHLDAARAIGALRQIATLFSQSIELR |
| Ga0335077_112445691 | 3300033158 | Soil | VASFANTYARAFADVVLDARLDANRATGGLRRIAKLTAESQDLRR |
| Ga0335077_117782241 | 3300033158 | Soil | MASVANTYARAFADVVFDARLDAGRAIGGLRQIASLFSQSIELR |
| Ga0335077_117967511 | 3300033158 | Soil | MASVASTYARAFADVVIDSRLDANRAVGGLRRISGLLAES |
| Ga0310914_109742322 | 3300033289 | Soil | MASVASTYARAFADVVFETRLDAGRAVGGLQRITALFTESVELRRVWEN |
| Ga0326728_108311071 | 3300033402 | Peat Soil | MASVASTYARAFADVVLDMRLDANRAIGGLRRLAELFGENA |
| Ga0314866_108883_1_129 | 3300033807 | Peatland | VASVASTYARAFADVVLDTRLDAGKAVGALYQISDMLQGSVEL |
| Ga0370515_0392992_1_123 | 3300034163 | Untreated Peat Soil | MASVANTYARAFADVVLGAHLNADRSIAELRTIAQLLDESS |
| ⦗Top⦘ |