Metagenome / Metatranscriptome Family F066875

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F066875
Family Type	Metagenome / Metatranscriptome
Number of Sequences	126
Average Sequence Length	42 residues
Representative Sequence	VSTNKKRDGTVRKLKIDLADGVEKSQGKLVVKARKSYVAPKS
Number of Associated Samples	104
Number of Associated Scaffolds	126

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	99.21 %
% of genes from short scaffolds (< 2000 bps)	91.27 %
Associated GOLD sequencing projects	95
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (72.222 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.524 % of family members)
Environment Ontology (ENVO)	Unclassified (47.619 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (61.905 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.16
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 126 Family Scaffolds
PF01713	Smr	4.76
PF00654	Voltage_CLC	3.97
PF00753	Lactamase_B	3.17
PF03372	Exo_endo_phos	2.38
PF12708	Pectate_lyase_3	1.59
PF02518	HATPase_c	1.59
PF01850	PIN	1.59
PF13316	DUF4087	1.59
PF10531	SLBB	1.59
PF13620	CarboxypepD_reg	1.59
PF04055	Radical_SAM	1.59
PF00106	adh_short	1.59
PF16242	Pyrid_ox_like	0.79
PF01432	Peptidase_M3	0.79
PF12704	MacB_PCD	0.79
PF04906	Tweety	0.79
PF00210	Ferritin	0.79
PF14534	DUF4440	0.79
PF13181	TPR_8	0.79
PF09720	Unstab_antitox	0.79
PF00675	Peptidase_M16	0.79
PF06348	DUF1059	0.79
PF02412	TSP_3	0.79
PF00005	ABC_tran	0.79
PF02630	SCO1-SenC	0.79
PF03448	MgtE_N	0.79
PF01909	NTP_transf_2	0.79
PF08818	DUF1801	0.79
PF02633	Creatininase	0.79
PF01738	DLH	0.79
PF04405	ScdA_N	0.79
PF00282	Pyridoxal_deC	0.79
PF04343	DUF488	0.79
PF13432	TPR_16	0.79
PF00501	AMP-binding	0.79

COG ID	Name	Functional Category	% Frequency in 126 Family Scaffolds
COG0038	H+/Cl- antiporter ClcA	Inorganic ion transport and metabolism [P]	3.97
COG0076	Glutamate or tyrosine decarboxylase or a related PLP-dependent protein	Amino acid transport and metabolism [E]	0.79
COG0339	Zn-dependent oligopeptidase, M3 family	Posttranslational modification, protein turnover, chaperones [O]	0.79
COG1164	Oligoendopeptidase F	Amino acid transport and metabolism [E]	0.79
COG1225	Peroxiredoxin	Posttranslational modification, protein turnover, chaperones [O]	0.79
COG1402	Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis)	Coenzyme transport and metabolism [H]	0.79
COG1999	Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family	Posttranslational modification, protein turnover, chaperones [O]	0.79
COG2239	Mg/Co/Ni transporter MgtE (contains CBS domain)	Inorganic ion transport and metabolism [P]	0.79
COG2846	Iron-sulfur cluster repair protein YtfE, RIC family, contains ScdAN and hemerythrin domains	Posttranslational modification, protein turnover, chaperones [O]	0.79
COG3189	Uncharacterized conserved protein YeaO, DUF488 family	Function unknown [S]	0.79
COG4430	Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family	Function unknown [S]	0.79
COG5646	Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)	Posttranslational modification, protein turnover, chaperones [O]	0.79
COG5649	Uncharacterized conserved protein, DUF1801 domain	Function unknown [S]	0.79

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	72.22 %
Unclassified	root	N/A	27.78 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	72.22 %
Unclassified	root	N/A	27.78 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	72.22 %
Unclassified	root	N/A	27.78 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	34.92 %
Unclassified	root	N/A	27.78 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	5.56 %
environmental samples	no rank	All Organisms → cellular organisms → Bacteria → environmental samples	4.76 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.78 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	8.73 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	7.94 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	4.76 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.59 %
Cyanobacteria/Melainabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group	0.79 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.79 %
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	0.79 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.78 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.73 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	6.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	4.76 %
Blastocatellales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales	1.59 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.59 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.79 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	0.79 %
Cyanobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria	0.79 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.78 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.73 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	6.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	4.76 %
Pyrinomonadaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae	1.59 %
Chroococcidiopsidales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Chroococcidiopsidales	0.79 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	0.79 %
Burkholderiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae	0.79 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.79 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.78 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.73 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	6.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	4.76 %
unclassified Pyrinomonadaceae	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae	1.59 %
Chroococcidiopsidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Chroococcidiopsidales → Chroococcidiopsidaceae	0.79 %
Paraburkholderia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia	0.79 %
Syntrophaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	0.79 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.79 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.78 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.73 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	6.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	4.76 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.59 %
unclassified Paraburkholderia	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia	0.79 %
Aliterella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Chroococcidiopsidales → Chroococcidiopsidaceae → Aliterella	0.79 %
unclassified Sphingomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas	0.79 %
Smithella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella	0.79 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.78 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.73 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	6.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	4.76 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.59 %
Paraburkholderia sp. 4D117	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. 4D117	0.79 %
unclassified Smithella	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella	0.79 %
Sphingomonas sp. HDW15A	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. HDW15A	0.79 %
Aliterella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Chroococcidiopsidales → Chroococcidiopsidaceae → Aliterella	0.79 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.79 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	27.78 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.73 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	6.35 %
uncultured bacterium	species	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	4.76 %
Pyrinomonadaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1.59 %
Smithella sp.	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp.	0.79 %
Paraburkholderia sp. 4D117	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. 4D117	0.79 %
Sphingomonas sp. HDW15A	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. HDW15A	0.79 %
Aliterella	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Chroococcidiopsidales → Chroococcidiopsidaceae → Aliterella	0.79 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.79 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2162886012\|MBSR1b_contig_1547882	All Organisms → cellular organisms → Bacteria	2965	Open in IMG/M
3300000787\|JGI11643J11755_11761957	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	1769	Open in IMG/M
3300000956\|JGI10216J12902_102348427	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1581	Open in IMG/M
3300004156\|Ga0062589_101439665	All Organisms → cellular organisms → Bacteria → Acidobacteria	674	Open in IMG/M
3300004480\|Ga0062592_100585010	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. 4D117	945	Open in IMG/M
3300004643\|Ga0062591_101333015	All Organisms → cellular organisms → Bacteria → Acidobacteria	707	Open in IMG/M
3300005093\|Ga0062594_100367168	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1141	Open in IMG/M
3300005293\|Ga0065715_11131334	All Organisms → cellular organisms → Bacteria → Acidobacteria	513	Open in IMG/M
3300005332\|Ga0066388_101445597	All Organisms → cellular organisms → Bacteria	1198	Open in IMG/M
3300005334\|Ga0068869_100214986	All Organisms → cellular organisms → Bacteria	1521	Open in IMG/M
3300005334\|Ga0068869_101220212	Not Available	661	Open in IMG/M
3300005343\|Ga0070687_100942175	Not Available	622	Open in IMG/M
3300005366\|Ga0070659_101834993	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	543	Open in IMG/M
3300005543\|Ga0070672_100991358	Not Available	744	Open in IMG/M
3300005543\|Ga0070672_101015494	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	735	Open in IMG/M
3300005545\|Ga0070695_100331418	All Organisms → cellular organisms → Bacteria	1135	Open in IMG/M
3300005546\|Ga0070696_100499243	Not Available	968	Open in IMG/M
3300005547\|Ga0070693_100840414	All Organisms → cellular organisms → Bacteria	684	Open in IMG/M
3300005549\|Ga0070704_100390386	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	1185	Open in IMG/M
3300005556\|Ga0066707_10562059	Not Available	734	Open in IMG/M
3300005561\|Ga0066699_10295378	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1153	Open in IMG/M
3300005576\|Ga0066708_10922750	All Organisms → cellular organisms → Bacteria	544	Open in IMG/M
3300005577\|Ga0068857_100550858	All Organisms → cellular organisms → Bacteria	1086	Open in IMG/M
3300005577\|Ga0068857_101250501	All Organisms → cellular organisms → Bacteria	720	Open in IMG/M
3300005578\|Ga0068854_101475923	All Organisms → cellular organisms → Bacteria	617	Open in IMG/M
3300005616\|Ga0068852_100044736	All Organisms → cellular organisms → Bacteria → Acidobacteria	3763	Open in IMG/M
3300005618\|Ga0068864_101942636	Not Available	594	Open in IMG/M
3300005840\|Ga0068870_10673701	All Organisms → cellular organisms → Bacteria	711	Open in IMG/M
3300005841\|Ga0068863_100379792	All Organisms → cellular organisms → Bacteria	1379	Open in IMG/M
3300005841\|Ga0068863_100663270	All Organisms → cellular organisms → Bacteria	1035	Open in IMG/M
3300005842\|Ga0068858_101648153	All Organisms → cellular organisms → Bacteria	633	Open in IMG/M
3300005844\|Ga0068862_101115312	Not Available	784	Open in IMG/M
3300006032\|Ga0066696_10396771	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	900	Open in IMG/M
3300006034\|Ga0066656_10530759	Not Available	766	Open in IMG/M
3300006237\|Ga0097621_100766992	Not Available	892	Open in IMG/M
3300006755\|Ga0079222_10034483	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	2202	Open in IMG/M
3300006846\|Ga0075430_101760328	All Organisms → cellular organisms → Bacteria → Acidobacteria	508	Open in IMG/M
3300006852\|Ga0075433_11814179	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	524	Open in IMG/M
3300006871\|Ga0075434_101104637	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp.	806	Open in IMG/M
3300009012\|Ga0066710_101412132	All Organisms → cellular organisms → Bacteria → Acidobacteria	1078	Open in IMG/M
3300009038\|Ga0099829_10339636	All Organisms → cellular organisms → Bacteria → Acidobacteria	1235	Open in IMG/M
3300009101\|Ga0105247_10571405	Not Available	834	Open in IMG/M
3300009101\|Ga0105247_11521262	Not Available	546	Open in IMG/M
3300009101\|Ga0105247_11648148	Not Available	528	Open in IMG/M
3300009137\|Ga0066709_101888224	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	832	Open in IMG/M
3300009162\|Ga0075423_10068467	All Organisms → cellular organisms → Bacteria → Proteobacteria	3681	Open in IMG/M
3300009162\|Ga0075423_10281145	All Organisms → cellular organisms → Bacteria	1744	Open in IMG/M
3300009162\|Ga0075423_12439653	Not Available	570	Open in IMG/M
3300009174\|Ga0105241_10108743	Not Available	2217	Open in IMG/M
3300009174\|Ga0105241_10768457	Not Available	885	Open in IMG/M
3300009174\|Ga0105241_10830704	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	853	Open in IMG/M
3300009177\|Ga0105248_11063616	All Organisms → cellular organisms → Bacteria	914	Open in IMG/M
3300009177\|Ga0105248_11064993	All Organisms → cellular organisms → Bacteria → Acidobacteria	914	Open in IMG/M
3300009553\|Ga0105249_12203587	Not Available	624	Open in IMG/M
3300010037\|Ga0126304_10060501	All Organisms → cellular organisms → Bacteria	2322	Open in IMG/M
3300010042\|Ga0126314_10862364	Not Available	668	Open in IMG/M
3300010045\|Ga0126311_10326016	All Organisms → cellular organisms → Bacteria → Proteobacteria	1164	Open in IMG/M
3300010359\|Ga0126376_10173983	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1754	Open in IMG/M
3300010359\|Ga0126376_10372568	All Organisms → cellular organisms → Bacteria	1275	Open in IMG/M
3300010359\|Ga0126376_10933647	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	861	Open in IMG/M
3300010362\|Ga0126377_12834899	Not Available	559	Open in IMG/M
3300010373\|Ga0134128_12641688	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	553	Open in IMG/M
3300010375\|Ga0105239_11775221	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	715	Open in IMG/M
3300010375\|Ga0105239_12930793	Not Available	556	Open in IMG/M
3300010376\|Ga0126381_102640848	All Organisms → cellular organisms → Bacteria → Acidobacteria	718	Open in IMG/M
3300010397\|Ga0134124_10400496	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1306	Open in IMG/M
3300010397\|Ga0134124_12534759	All Organisms → cellular organisms → Bacteria → Acidobacteria	555	Open in IMG/M
3300010399\|Ga0134127_11209930	Not Available	822	Open in IMG/M
3300010400\|Ga0134122_10635167	Not Available	992	Open in IMG/M
3300010401\|Ga0134121_10700624	All Organisms → cellular organisms → Bacteria → Acidobacteria	960	Open in IMG/M
3300010403\|Ga0134123_10929629	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	878	Open in IMG/M
3300010403\|Ga0134123_11953780	All Organisms → cellular organisms → Bacteria	644	Open in IMG/M
3300010403\|Ga0134123_12516140	All Organisms → cellular organisms → Bacteria → Acidobacteria	581	Open in IMG/M
3300011269\|Ga0137392_11258600	All Organisms → cellular organisms → Bacteria → Acidobacteria	599	Open in IMG/M
3300011270\|Ga0137391_10859462	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium	744	Open in IMG/M
3300012189\|Ga0137388_10453810	All Organisms → cellular organisms → Bacteria	1189	Open in IMG/M
3300012205\|Ga0137362_10068869	All Organisms → cellular organisms → Bacteria	2926	Open in IMG/M
3300012210\|Ga0137378_11473548	Not Available	592	Open in IMG/M
3300012353\|Ga0137367_10334275	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1080	Open in IMG/M
3300012353\|Ga0137367_10433647	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	930	Open in IMG/M
3300012469\|Ga0150984_100643398	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	700	Open in IMG/M
3300012517\|Ga0157354_1010046	Not Available	933	Open in IMG/M
3300012918\|Ga0137396_10914546	All Organisms → cellular organisms → Bacteria	642	Open in IMG/M
3300012922\|Ga0137394_10017629	All Organisms → cellular organisms → Bacteria → Acidobacteria	5679	Open in IMG/M
3300012955\|Ga0164298_10874810	All Organisms → cellular organisms → Bacteria → Acidobacteria	651	Open in IMG/M
3300012977\|Ga0134087_10379601	All Organisms → cellular organisms → Bacteria → Acidobacteria	683	Open in IMG/M
3300013102\|Ga0157371_10637127	All Organisms → cellular organisms → Bacteria	795	Open in IMG/M
3300013296\|Ga0157374_10757073	All Organisms → cellular organisms → Bacteria	986	Open in IMG/M
3300013296\|Ga0157374_11805950	Not Available	637	Open in IMG/M
3300013307\|Ga0157372_12217274	Not Available	631	Open in IMG/M
3300014325\|Ga0163163_11685521	All Organisms → cellular organisms → Bacteria	695	Open in IMG/M
3300014326\|Ga0157380_10482538	All Organisms → cellular organisms → Bacteria	1199	Open in IMG/M
3300014326\|Ga0157380_13102518	All Organisms → cellular organisms → Bacteria	530	Open in IMG/M
3300015054\|Ga0137420_1433993	Not Available	1440	Open in IMG/M
3300015357\|Ga0134072_10112826	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	851	Open in IMG/M
3300015371\|Ga0132258_12134042	Not Available	1408	Open in IMG/M
3300015371\|Ga0132258_12181729	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1391	Open in IMG/M
3300018468\|Ga0066662_10009032	All Organisms → cellular organisms → Bacteria	5099	Open in IMG/M
3300024331\|Ga0247668_1066886	Not Available	726	Open in IMG/M
3300025885\|Ga0207653_10181544	All Organisms → cellular organisms → Bacteria → Proteobacteria	787	Open in IMG/M
3300025904\|Ga0207647_10073390	All Organisms → cellular organisms → Bacteria	2062	Open in IMG/M
3300025907\|Ga0207645_11044009	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. HDW15A	552	Open in IMG/M
3300025910\|Ga0207684_10000130	All Organisms → cellular organisms → Bacteria	137931	Open in IMG/M
3300025911\|Ga0207654_10969227	Not Available	618	Open in IMG/M
3300025918\|Ga0207662_10419497	All Organisms → cellular organisms → Bacteria → Acidobacteria	910	Open in IMG/M
3300025936\|Ga0207670_10417560	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1076	Open in IMG/M
3300025940\|Ga0207691_11051154	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	678	Open in IMG/M
3300025941\|Ga0207711_11383792	All Organisms → cellular organisms → Bacteria	646	Open in IMG/M
3300025941\|Ga0207711_11646455	Not Available	585	Open in IMG/M
3300025942\|Ga0207689_10762559	Not Available	816	Open in IMG/M
3300025945\|Ga0207679_12056666	Not Available	519	Open in IMG/M
3300025961\|Ga0207712_11793558	Not Available	550	Open in IMG/M
3300026035\|Ga0207703_10184605	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	1843	Open in IMG/M
3300026323\|Ga0209472_1196901	All Organisms → cellular organisms → Bacteria → Acidobacteria	694	Open in IMG/M
3300026332\|Ga0209803_1131099	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	991	Open in IMG/M
3300027674\|Ga0209118_1046699	All Organisms → cellular organisms → Bacteria → Acidobacteria	1289	Open in IMG/M
3300027846\|Ga0209180_10457424	All Organisms → cellular organisms → Bacteria → Acidobacteria	719	Open in IMG/M
3300027873\|Ga0209814_10052350	All Organisms → cellular organisms → Bacteria	1704	Open in IMG/M
3300028803\|Ga0307281_10240251	All Organisms → cellular organisms → Bacteria	663	Open in IMG/M
3300030991\|Ga0073994_12431039	All Organisms → cellular organisms → Bacteria → Acidobacteria	639	Open in IMG/M
3300031548\|Ga0307408_101567754	All Organisms → cellular organisms → Bacteria	625	Open in IMG/M
3300031716\|Ga0310813_12236123	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Chroococcidiopsidales → Chroococcidiopsidaceae → Aliterella	518	Open in IMG/M
3300031833\|Ga0310917_11179229	Not Available	510	Open in IMG/M
3300031908\|Ga0310900_10906752	All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium	719	Open in IMG/M
3300031939\|Ga0308174_11380678	All Organisms → cellular organisms → Bacteria → Acidobacteria	603	Open in IMG/M
3300032205\|Ga0307472_101442681	Not Available	669	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	54.76%
Host-Associated	Host-Associated	45.24%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	54.76%
Plants	Host-Associated → Plants	45.24%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	54.76%
Rhizosphere	Host-Associated → Plants → Rhizosphere	28.57%
Rhizoplane	Host-Associated → Plants → Rhizoplane	15.08%
Roots	Host-Associated → Plants → Roots	1.59%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	46.03%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	23.02%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	11.90%
Loam	Environmental → Terrestrial → Soil → Loam	8.73%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.56%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.17%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.59%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	27.78%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	23.02%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	11.90%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	9.52%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	7.14%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.56%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	3.97%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.17%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.17%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	1.59%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.59%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.59%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	9.52%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	7.14%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	7.14%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	7.14%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.56%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	4.76%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	4.76%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.97%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	3.97%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	3.17%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	3.17%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	3.17%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	2.38%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	2.38%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	2.38%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.38%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	2.38%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	1.59%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	1.59%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.59%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	1.59%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	1.59%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.59%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.59%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	1.59%
Unplanted Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil	0.79%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	0.79%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.79%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	0.79%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.79%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.79%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.79%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.79%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.79%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300000787	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005093	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks	Environmental	Open in IMG/M
3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1	Host-Associated	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Environmental	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005556	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156	Environmental	Open in IMG/M
3300005561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Host-Associated	Open in IMG/M
3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006032	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145	Environmental	Open in IMG/M
3300006034	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006755	Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter	Environmental	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006852	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300010037	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25	Environmental	Open in IMG/M
3300010042	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B	Environmental	Open in IMG/M
3300010045	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61	Environmental	Open in IMG/M
3300010359	Tropical forest soil microbial communities from Panama - MetaG Plot_15	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010373	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4	Environmental	Open in IMG/M
3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Host-Associated	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011269	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012210	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG	Environmental	Open in IMG/M
3300012353	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012517	Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012977	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG	Environmental	Open in IMG/M
3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015054	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015357	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300024331	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09	Environmental	Open in IMG/M
3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)	Environmental	Open in IMG/M
3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026323	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)	Environmental	Open in IMG/M
3300026332	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)	Environmental	Open in IMG/M
3300027674	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)	Environmental	Open in IMG/M
3300027846	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027873	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental	Open in IMG/M
3300030991	Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Host-Associated	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031833	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178	Environmental	Open in IMG/M
3300031908	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1	Environmental	Open in IMG/M
3300031939	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
MBSR1b_0695.00001740	2162886012	Miscanthus Rhizosphere	TRYSFSFVSTNKKRDGTVRKLKIDLADGVEKSQGKLVVKARKSYVAPKS
JGI11643J11755_117619574	3300000787	Soil	RDGTTRKLKLDIDPAQQKSQGKMVVKARRSYISPREAR*
JGI10216J12902_1023484273	3300000956	Soil	GTTRKLKIDVGAPAQKTKGKLVVKARRSYVAPKS*
Ga0062589_1014396652	3300004156	Soil	AFVSTNKKRDGTTRKLKLDIDPVRQKSQEKLVIKARRSYISPRN*
Ga0062592_1005850102	3300004480	Soil	STNKNRDGTTRKLKLDVDPVQQKSQGKMVVKARRSYISPREAR*
Ga0062591_1013330152	3300004643	Soil	TRYSFSFVSTNRKRDGTLRKLKIDVADSAAKSQGKLVVKSRKSYVAPRDLNKGVN*
Ga0062594_1003671681	3300005093	Soil	FVSTNKKRDGTMRKLKIDVADGVEKSQGKLVVKARKSYIAPKS*
Ga0065715_111313341	3300005293	Miscanthus Rhizosphere	RYSFSFVSTNKKRDGTVRKLKVDLAEGVEKSQGKVVVKARKSYVAPKG*
Ga0066388_1014455972	3300005332	Tropical Forest Soil	RSRFSLAYVSSNKARDGSLRKLKIDLTPDALKTRGKLVVKSRRSYVAPRS*
Ga0068869_1002149864	3300005334	Miscanthus Rhizosphere	SLAFVSSNRKRDGTLRKLKIDVSPEVQKSQGKLVVKSRRSYVAPKQ*
Ga0068869_1012202121	3300005334	Miscanthus Rhizosphere	TNKKRDGTVRKLKVDLAEGVEKTQGKVVVKARKSYVAPKG*
Ga0070687_1009421752	3300005343	Switchgrass Rhizosphere	FSFVSTNKKRDGSVRQLKIDLADATEKSQGKLVVKARRSYVAPKE*
Ga0070659_1018349931	3300005366	Corn Rhizosphere	YSFSFVSTNKKRDGTVRKLKIDLADGVEKSQGRLVVKARRSYVAPKE*
Ga0070672_1009913581	3300005543	Miscanthus Rhizosphere	VSTNKKRDGSVRQLKIDLADATEKSQGKLVVKARRSYVAPKE*
Ga0070672_1010154942	3300005543	Miscanthus Rhizosphere	KKRDGTMRKLKIDVADGVEKSQGKLVVKARKSYIAPKS*
Ga0070695_1003314181	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	YSFSFVSTNKKRDGTVRKLKVDLAEGVEKSQGKVVVKARKSYVAPKG*
Ga0070696_1004992431	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	NKKRDGTLRKLKIELAPATKKAQTKLIVKARKSYIAPKD*
Ga0070693_1008404141	3300005547	Corn, Switchgrass And Miscanthus Rhizosphere	FSFVSTNKKRDGTVRKLKIDLADGIEKSQGRLVVKARRSYVAPKE*
Ga0070704_1003903861	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	STNKKRDGTMRKLKIDVADGVEKSQGKLVVKARKSYIAPKS*
Ga0066707_105620591	3300005556	Soil	FVSSNKKRDGALRRLKIDISPAAQKSPGKLVVKARKSYVAPRS*
Ga0066699_102953781	3300005561	Soil	SSNKKRDGSTRKLKIDVSPSLQKSPGKLVVKARRSYVAPQR*
Ga0066708_109227501	3300005576	Soil	VSTNKKRDGTTRKLKLDVDPALEKSQGKLVVKARRNYIAPRS*
Ga0068857_1005508581	3300005577	Corn Rhizosphere	AFVSTNKQRDGTTRKLKLDLDPARQKPQGKLVIKARRSYIAPRR*
Ga0068857_1012505012	3300005577	Corn Rhizosphere	KRDGTVRKLKIDLADGVEKSQGRLVVKARKSYVAPKN*
Ga0068854_1014759231	3300005578	Corn Rhizosphere	KRDGSVRKLKVELADATKKTQEKLVVKARKSYVAPKG*
Ga0068852_1000447361	3300005616	Corn Rhizosphere	YSFSFVSTNKKRDGTVRKLKVDLAEGVEKTQGKVVVKARKSYVAPKG*
Ga0068864_1019426361	3300005618	Switchgrass Rhizosphere	VSTNKKRDGTVRKLKIDLADGVEKSQGKLVVKARKSYVAPKS*
Ga0068870_106737013	3300005840	Miscanthus Rhizosphere	YSLAFVSSNRKRDGTLRKLKIDVSPEVQKSQGKLVVKSRRSYVAPKQ*
Ga0068863_1003797922	3300005841	Switchgrass Rhizosphere	RYSFSFVSTNKKRDGTVRKLKIDLADGVEKSQGRLVVKARKSYVAPKN*
Ga0068863_1006632701	3300005841	Switchgrass Rhizosphere	SFVSTNKKRDGTLRKLKIELVNGVEKSQGKLVVKARRSYIAPKS*
Ga0068858_1016481532	3300005842	Switchgrass Rhizosphere	GTTRKLKLDVDSAQQKSQGKLVVKARRSYISPREAR*
Ga0068862_1011153122	3300005844	Switchgrass Rhizosphere	RDGTTRKLKLDVDPAQQKSQGKLVVKARRSYISPRGAR*
Ga0066696_103967711	3300006032	Soil	GTMRKLKIEVQPPLPQPNGKLVVKARRSYVAPRS*
Ga0066656_105307592	3300006034	Soil	RDGTVRKLRLKVAPAVEKSQGKLAVKTRRSYVAPKG*
Ga0097621_1007669921	3300006237	Miscanthus Rhizosphere	RYSFSFVSTNKKRDGTVRKLKIDLADGVEKSEGKLVVKARRSYVAPKE*
Ga0079222_100344831	3300006755	Agricultural Soil	TNKKRDGTTRKLQIDMGQPAQKSRGKLVVKARRSYVAPRT*
Ga0075430_1017603281	3300006846	Populus Rhizosphere	FSFVSTNKKRDGTVRKLKIDLADGVEKSQGKVVVKARKSYVAPKG*
Ga0075433_118141791	3300006852	Populus Rhizosphere	KQRDGTTRKLKLDLDPARQKSQGKLVIKARRSYIAPRS*
Ga0075434_1011046373	3300006871	Populus Rhizosphere	RYNIAFVSSNKKRDGTLRKLKIELAAATKKTQKNLVVKARKSYVAPKG*
Ga0066710_1014121322	3300009012	Grasslands Soil	SNKKRDGTTRKLKIDVSPPLQKSQGKLVVKARRSYVAPRR
Ga0099829_103396361	3300009038	Vadose Zone Soil	GTTRKLKIEMAIPVQKSQGKLVVKARRSYVAPRS*
Ga0105247_105714051	3300009101	Switchgrass Rhizosphere	KKRDGTTRKLKLDVDSAQQKSQGKLVVKARRSYISPREAR*
Ga0105247_115212621	3300009101	Switchgrass Rhizosphere	SFVSTNKKRDGSLRNLKIDVANNAEKSQGKLVVKSRKSYVAPKGVN*
Ga0105247_116481481	3300009101	Switchgrass Rhizosphere	NKKRDGTLRKLKIELVNGVEKSQGKLVVKARRSYIAPKS*
Ga0066709_1018882241	3300009137	Grasslands Soil	SNKKRDGSTRKLKIDVASAAQKSQGKLVVRARRSYVAPKS*
Ga0075423_100684671	3300009162	Populus Rhizosphere	AFVSTNKVRDGSLRKLKIELKPEAKKARGELVVKSRKSYVAPRG*
Ga0075423_102811451	3300009162	Populus Rhizosphere	RDGTTRKLKLDIDPAQQKSQGKLVVKARRSYISPREAR*
Ga0075423_124396532	3300009162	Populus Rhizosphere	AFVSTNKLRDGSLRKLKIELKPEVKKTRGELMVKSRKSYVAPRG*
Ga0105241_101087431	3300009174	Corn Rhizosphere	KRDGTLRKLKIDLAPATKKSQTKLVVKARKSYVAPKG*
Ga0105241_107684572	3300009174	Corn Rhizosphere	FVSSNKKRDGSLRKLKIDLVDGAKKKQQVKLVVKARRSYVAPKS*
Ga0105241_108307041	3300009174	Corn Rhizosphere	KRDGTTRKLKLDVDPAQQKSKGKLVVKARRSYISPRAAR*
Ga0105248_110636162	3300009177	Switchgrass Rhizosphere	AFVSTNKKRDGTTRKLKLDVDPAQQESQGKLVVKARRSYISPREAR*
Ga0105248_110649931	3300009177	Switchgrass Rhizosphere	NKQRDGTTRKLKLDLDPARQKSQGKLVIKARRSYIAPRR*
Ga0105249_122035872	3300009553	Switchgrass Rhizosphere	KKRDGTVRKLKIDMADGVEKSQGKLVVKARRSYVAPKS*
Ga0126304_100605011	3300010037	Serpentine Soil	TNKKRDGTVRKLKIGLANSVEKSQGRLVVKARKSYVAPKE*
Ga0126314_108623641	3300010042	Serpentine Soil	SFSFVSTNKKRDGTVRKLKVDLVDGVEKSQGKLVVKARKSYVAPKN*
Ga0126311_103260163	3300010045	Serpentine Soil	GTVRKLKIDLADGVEKSEGRLVVKARKNYVAPKE*
Ga0126376_101739831	3300010359	Tropical Forest Soil	FSLAYVSSNKARDGSLRKLKIDLTPDALKTRGKLVVKSRRSYVAPRS*
Ga0126376_103725681	3300010359	Tropical Forest Soil	AFVSTNKKRDGTTRKLKLDIDPARQKSQGKLVIKARRSYISPRG*
Ga0126376_109336472	3300010359	Tropical Forest Soil	YSFSFVSTNKSRDGSVRKLKVDLADGVEKTEGHVVVKARKTYVAPKS*
Ga0126377_128348992	3300010362	Tropical Forest Soil	STNKNRDGTVRKLKVDLAEGVEKSQGKLVVRARKSYVAPK*
Ga0134128_126416881	3300010373	Terrestrial Soil	YSFSFVSTNKNRDGTVRKLKVDLANGVEKSQGKLVVKARKSYVAPKG*
Ga0105239_117752213	3300010375	Corn Rhizosphere	FVSTNKQRDGTTRKLKLDVDPAQQKSQGKLVVKARRSYISPRAAR*
Ga0105239_129307932	3300010375	Corn Rhizosphere	RDGTVRKLKIDLANGVEKSQGKLVVKARKTYVAPKE*
Ga0126381_1026408481	3300010376	Tropical Forest Soil	NKKRDGTTRRLKVDVQPSLSDSEGKLVVKAKRSYVAPRT*
Ga0134124_104004961	3300010397	Terrestrial Soil	NRNRDGTTRKLKLELQPAVEKTEGKLVIKSRRSYVAPKS*
Ga0134124_125347592	3300010397	Terrestrial Soil	RTRYSFSFVSTNKKRDGTVRKLKIDLADGVEKSNGKLVVKARKSYVAPKGESSQ*
Ga0134127_112099302	3300010399	Terrestrial Soil	GTLRKLKIDLAPATKKSQTKLVVKARKSYVAPKG*
Ga0134122_106351672	3300010400	Terrestrial Soil	DGTTRKLKLDVDPAQQKSQGKLVVKARRSYISPREAR*
Ga0134121_107006241	3300010401	Terrestrial Soil	NRDGTTRKLKLDLQPNVQKSEGKLIVKSRRSYVAPRS*
Ga0134123_109296291	3300010403	Terrestrial Soil	RDGTTRKLKIDLAQSAQKSKDRLVVKARRSYIAPGS*
Ga0134123_119537803	3300010403	Terrestrial Soil	RKRDGTLRKLKIEVTPEVQKAQGKLVVKARRSYVAPKQKDEGR*
Ga0134123_125161402	3300010403	Terrestrial Soil	AFVSTNKKRDGTTRKLKIDLAQSSPKPKDKLVVKARRSYIAPGD*
Ga0137392_112586001	3300011269	Vadose Zone Soil	NKKRDGTVRKLRIDVAAAPQKSQGKLVVKARRSYVAPKS*
Ga0137391_108594622	3300011270	Vadose Zone Soil	TRYNLAYVSSNKKRDGTARKLKIDVAPAAQKSQGKLVVKARRSYVAPHS*
Ga0137388_104538103	3300012189	Vadose Zone Soil	RDGTTRKLKIDVSPSLQKSQTRLVVKARRSYVAPRS*
Ga0137362_100688691	3300012205	Vadose Zone Soil	KKRDGTTRKLRVDLAPPIQKSQVKLVVKARRSYVAPSR*
Ga0137378_114735481	3300012210	Vadose Zone Soil	FVSTNKKRDGTTRKLKIDVQPAVPKSQGKLVVKARRSYVAPK*
Ga0137367_103342752	3300012353	Vadose Zone Soil	LAFVSSNKKRDGTTRKLKLDVAPAIEKSEGKLVVKARRSYVAPKQ*
Ga0137367_104336471	3300012353	Vadose Zone Soil	KKRDGTTRKLKIDVSPSLQKSQDKLAVKARRSYVAPRS*
Ga0150984_1006433982	3300012469	Avena Fatua Rhizosphere	GTTRKLKIELAQAAQKSKDKLVVKARRSYIAPGS*
Ga0157354_10100461	3300012517	Unplanted Soil	RDGTTRKLKLDIDPARQKSQGKVVIKARRRYIAPRS*
Ga0137396_109145461	3300012918	Vadose Zone Soil	NLAFVSSNRKRDGSLRKLKIDVTPAIDKSQGKLVVKARRSYIAPR*
Ga0137394_100176291	3300012922	Vadose Zone Soil	GSLRKLKIDVTPAIDKSQGKLVVKARRGYIAPKQ*
Ga0164298_108748101	3300012955	Soil	NKKRDGTLRKLKIDLTPDAQKSNGKLVVKARRGYIAPKEK*
Ga0134087_103796011	3300012977	Grasslands Soil	KKRDGTTRKLKLDLSQPVQKSQGKLVVKARRSYVAPR*
Ga0157371_106371272	3300013102	Corn Rhizosphere	FSFVSTNKKRDGTVRKLKIDLADGVEKSQGRLVVKARRSYVAPKE*
Ga0157374_107570731	3300013296	Miscanthus Rhizosphere	DGTVRKLKIDLADAIEKSQGRLVVKARRSYVAPKE*
Ga0157374_118059502	3300013296	Miscanthus Rhizosphere	FGSTNKKRDGTTLKLKLDFDPAQQKSQGKLVVKARRSYISPREAR*
Ga0157372_122172741	3300013307	Corn Rhizosphere	NKKRDGTLRKLKIELAPATKKAQTKLVVKARKSYIAPKD*
Ga0163163_116855212	3300014325	Switchgrass Rhizosphere	SFSFVSTNKKRDGTVRNLKISLADGIEKSQGRLVVKARRSYVAPKE*
Ga0157380_104825381	3300014326	Switchgrass Rhizosphere	TNKQHDGTVRKLKVDVAEGAAKSEGKLVVKARKSYVAPKS*
Ga0157380_131025182	3300014326	Switchgrass Rhizosphere	FVSSNRRRDGTLRKLKIDVHQELHKSQGKLVVKSRRSYVAPKEK*
Ga0137420_14339931	3300015054	Vadose Zone Soil	VSSNRKRDGSLRTLKIDVTPDAQKSQGKLVVKARRSYLAPKEK*
Ga0134072_101128261	3300015357	Grasslands Soil	KKRDGTTRKLKLDLSQPVQKSQGKLVVKARRSYVAPRT*
Ga0132258_121340422	3300015371	Arabidopsis Rhizosphere	FVSSNKARDGSVRKLKIELKPEVQKTRGNLVVKARRSYVAPRG*
Ga0132258_121817291	3300015371	Arabidopsis Rhizosphere	KKRDGSLRKLKIELADNAKKRHDKLVVKARKSYVAPKS*
Ga0066662_100090324	3300018468	Grasslands Soil	DGTTRKLKLKVSPVVEKSQGKLAVKTRGSYVAPRS
Ga0247668_10668861	3300024331	Soil	VSSNKKRDGTTRKLKVDLAPSTQKSQTKLVVKARRSYVAPTR
Ga0207653_101815442	3300025885	Corn, Switchgrass And Miscanthus Rhizosphere	TNKKHDGTVRKLKVDVAEGAAKSEGKVVVKARKSYVAPKS
Ga0207647_100733903	3300025904	Corn Rhizosphere	SFSFVSTNKKRDGTVRKLKVDLAEGVEKAQGKVVVKARKSYVAPKG
Ga0207645_110440092	3300025907	Miscanthus Rhizosphere	KRDGTTRKLKLDVDSAQQKSQGKLVVKARRTYISPREAR
Ga0207684_1000013060	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	MAFVSSNKKRDGTLRKLKIELASARKKTQKDLVVKARRSYVAPKS
Ga0207654_109692271	3300025911	Corn Rhizosphere	AFVSSNKKRDGSLRKLKIELADNAKKTHDKLVVKARKSYVAPKG
Ga0207662_104194971	3300025918	Switchgrass Rhizosphere	LAFVSTNKKRDGTTRKLKLDVDSPQQKSQGKLVVKARRSYISPREAR
Ga0207670_104175603	3300025936	Switchgrass Rhizosphere	LAFVSTNKKRDGTTRKLKIDMGQSAQKSRGKLVVKARRSYVAPRT
Ga0207691_110511541	3300025940	Miscanthus Rhizosphere	NKKRDGTMRKLKIDVADGVEKSQGKLVVKARKSYIAPKS
Ga0207711_113837921	3300025941	Switchgrass Rhizosphere	AFVSTNKKRDGTTRKLKLDVDPAQQESQGKLVVKARRSYISPREAR
Ga0207711_116464551	3300025941	Switchgrass Rhizosphere	FVSTNKKRDGSVRQLKIDLADATEKSQGKLVVKARRSYVAPKE
Ga0207689_107625592	3300025942	Miscanthus Rhizosphere	RDGTVRKLKVDLAEGVEKTQGKVVVKARKSYVAPKG
Ga0207679_120566662	3300025945	Corn Rhizosphere	YSFSFVSTNKNRDGTVRKLKIDLSDGVQKSQGKLVVKARKSYVAPKS
Ga0207712_117935582	3300025961	Switchgrass Rhizosphere	HDGTVRKLKVDVAEGAAKSEGKLVVKARKSYVAPKS
Ga0207703_101846054	3300026035	Switchgrass Rhizosphere	KRDGTTRKLKIDLAQSAQKSKDRLVVKARRSYIAPGS
Ga0209472_11969012	3300026323	Soil	RDGATRKLKLDVSAPNQPPKTKLVVKARRSYVAPRN
Ga0209803_11310991	3300026332	Soil	SNKKRDGTTRKLKIDIGTAGQKSQGKLVVRARRSYIAPRS
Ga0209118_10466991	3300027674	Forest Soil	SSNKKRDGTTRKLKIDVSPPLQKSQGKLVVKARRSYIAPRS
Ga0209180_104574242	3300027846	Vadose Zone Soil	NKKRDGTTRKLKIDVSPSLQKSQTRLVVKARRSYVAPRS
Ga0209814_100523501	3300027873	Populus Rhizosphere	KKRDGTTRKLKLDIHPAGQKSQGKLVIKARRSYIAPRS
Ga0307281_102402511	3300028803	Soil	KRDGTLRKLKIDVTPAVEKSQGKVVVKARRGYIAPKQ
Ga0073994_124310391	3300030991	Soil	FVSSNKKRDGTTRKLKIDLATPAQKSQDKLVVKARRSYVAPRR
Ga0307408_1015677541	3300031548	Rhizosphere	RDGTVRKLKIDLADGIEKSQGHLVVKARRTYVAPKE
Ga0310813_122361231	3300031716	Soil	RTRYSFSFVSTNKKRDGTLRKLKVEVADGVQKSEGKLVVKARKSYVAPKS
Ga0310917_111792291	3300031833	Soil	TNKKRDGTTRRLKVDVQPSLSDTEGKLVVKAKRSYVAPRT
Ga0310900_109067521	3300031908	Soil	STNKKRDGTMRKLKIDVADGVEKSQGKLVVKARKSYIAPKS
Ga0308174_113806781	3300031939	Soil	VSTNKKRDGTVRKLKIDLADGIEKSQGRLVVKARRSYVAPKE
Ga0307472_1014426811	3300032205	Hardwood Forest Soil	SFVSTNKKRDGTVRKLKIDLTDGVEKSQGRLVVKARKSYVAPKE

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F066875

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences