| Basic Information | |
|---|---|
| Family ID | F066875 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 42 residues |
| Representative Sequence | VSTNKKRDGTVRKLKIDLADGVEKSQGKLVVKARKSYVAPKS |
| Number of Associated Samples | 104 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.21 % |
| % of genes from short scaffolds (< 2000 bps) | 91.27 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.16 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (72.222 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (9.524 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.619 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (61.905 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.16 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF01713 | Smr | 4.76 |
| PF00654 | Voltage_CLC | 3.97 |
| PF00753 | Lactamase_B | 3.17 |
| PF03372 | Exo_endo_phos | 2.38 |
| PF12708 | Pectate_lyase_3 | 1.59 |
| PF02518 | HATPase_c | 1.59 |
| PF01850 | PIN | 1.59 |
| PF13316 | DUF4087 | 1.59 |
| PF10531 | SLBB | 1.59 |
| PF13620 | CarboxypepD_reg | 1.59 |
| PF04055 | Radical_SAM | 1.59 |
| PF00106 | adh_short | 1.59 |
| PF16242 | Pyrid_ox_like | 0.79 |
| PF01432 | Peptidase_M3 | 0.79 |
| PF12704 | MacB_PCD | 0.79 |
| PF04906 | Tweety | 0.79 |
| PF00210 | Ferritin | 0.79 |
| PF14534 | DUF4440 | 0.79 |
| PF13181 | TPR_8 | 0.79 |
| PF09720 | Unstab_antitox | 0.79 |
| PF00675 | Peptidase_M16 | 0.79 |
| PF06348 | DUF1059 | 0.79 |
| PF02412 | TSP_3 | 0.79 |
| PF00005 | ABC_tran | 0.79 |
| PF02630 | SCO1-SenC | 0.79 |
| PF03448 | MgtE_N | 0.79 |
| PF01909 | NTP_transf_2 | 0.79 |
| PF08818 | DUF1801 | 0.79 |
| PF02633 | Creatininase | 0.79 |
| PF01738 | DLH | 0.79 |
| PF04405 | ScdA_N | 0.79 |
| PF00282 | Pyridoxal_deC | 0.79 |
| PF04343 | DUF488 | 0.79 |
| PF13432 | TPR_16 | 0.79 |
| PF00501 | AMP-binding | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0038 | H+/Cl- antiporter ClcA | Inorganic ion transport and metabolism [P] | 3.97 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.79 |
| COG0339 | Zn-dependent oligopeptidase, M3 family | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| COG1164 | Oligoendopeptidase F | Amino acid transport and metabolism [E] | 0.79 |
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| COG1402 | Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis) | Coenzyme transport and metabolism [H] | 0.79 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| COG2239 | Mg/Co/Ni transporter MgtE (contains CBS domain) | Inorganic ion transport and metabolism [P] | 0.79 |
| COG2846 | Iron-sulfur cluster repair protein YtfE, RIC family, contains ScdAN and hemerythrin domains | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 0.79 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.79 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 72.22 % |
| Unclassified | root | N/A | 27.78 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2162886012|MBSR1b_contig_1547882 | All Organisms → cellular organisms → Bacteria | 2965 | Open in IMG/M |
| 3300000787|JGI11643J11755_11761957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1769 | Open in IMG/M |
| 3300000956|JGI10216J12902_102348427 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1581 | Open in IMG/M |
| 3300004156|Ga0062589_101439665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300004480|Ga0062592_100585010 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → unclassified Paraburkholderia → Paraburkholderia sp. 4D117 | 945 | Open in IMG/M |
| 3300004643|Ga0062591_101333015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300005093|Ga0062594_100367168 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1141 | Open in IMG/M |
| 3300005293|Ga0065715_11131334 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 513 | Open in IMG/M |
| 3300005332|Ga0066388_101445597 | All Organisms → cellular organisms → Bacteria | 1198 | Open in IMG/M |
| 3300005334|Ga0068869_100214986 | All Organisms → cellular organisms → Bacteria | 1521 | Open in IMG/M |
| 3300005334|Ga0068869_101220212 | Not Available | 661 | Open in IMG/M |
| 3300005343|Ga0070687_100942175 | Not Available | 622 | Open in IMG/M |
| 3300005366|Ga0070659_101834993 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300005543|Ga0070672_100991358 | Not Available | 744 | Open in IMG/M |
| 3300005543|Ga0070672_101015494 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 735 | Open in IMG/M |
| 3300005545|Ga0070695_100331418 | All Organisms → cellular organisms → Bacteria | 1135 | Open in IMG/M |
| 3300005546|Ga0070696_100499243 | Not Available | 968 | Open in IMG/M |
| 3300005547|Ga0070693_100840414 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005549|Ga0070704_100390386 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1185 | Open in IMG/M |
| 3300005556|Ga0066707_10562059 | Not Available | 734 | Open in IMG/M |
| 3300005561|Ga0066699_10295378 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1153 | Open in IMG/M |
| 3300005576|Ga0066708_10922750 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005577|Ga0068857_100550858 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300005577|Ga0068857_101250501 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005578|Ga0068854_101475923 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300005616|Ga0068852_100044736 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3763 | Open in IMG/M |
| 3300005618|Ga0068864_101942636 | Not Available | 594 | Open in IMG/M |
| 3300005840|Ga0068870_10673701 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300005841|Ga0068863_100379792 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300005841|Ga0068863_100663270 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300005842|Ga0068858_101648153 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300005844|Ga0068862_101115312 | Not Available | 784 | Open in IMG/M |
| 3300006032|Ga0066696_10396771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 900 | Open in IMG/M |
| 3300006034|Ga0066656_10530759 | Not Available | 766 | Open in IMG/M |
| 3300006237|Ga0097621_100766992 | Not Available | 892 | Open in IMG/M |
| 3300006755|Ga0079222_10034483 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2202 | Open in IMG/M |
| 3300006846|Ga0075430_101760328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300006852|Ga0075433_11814179 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 524 | Open in IMG/M |
| 3300006871|Ga0075434_101104637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Smithella → unclassified Smithella → Smithella sp. | 806 | Open in IMG/M |
| 3300009012|Ga0066710_101412132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1078 | Open in IMG/M |
| 3300009038|Ga0099829_10339636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1235 | Open in IMG/M |
| 3300009101|Ga0105247_10571405 | Not Available | 834 | Open in IMG/M |
| 3300009101|Ga0105247_11521262 | Not Available | 546 | Open in IMG/M |
| 3300009101|Ga0105247_11648148 | Not Available | 528 | Open in IMG/M |
| 3300009137|Ga0066709_101888224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 832 | Open in IMG/M |
| 3300009162|Ga0075423_10068467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3681 | Open in IMG/M |
| 3300009162|Ga0075423_10281145 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
| 3300009162|Ga0075423_12439653 | Not Available | 570 | Open in IMG/M |
| 3300009174|Ga0105241_10108743 | Not Available | 2217 | Open in IMG/M |
| 3300009174|Ga0105241_10768457 | Not Available | 885 | Open in IMG/M |
| 3300009174|Ga0105241_10830704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 853 | Open in IMG/M |
| 3300009177|Ga0105248_11063616 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300009177|Ga0105248_11064993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 914 | Open in IMG/M |
| 3300009553|Ga0105249_12203587 | Not Available | 624 | Open in IMG/M |
| 3300010037|Ga0126304_10060501 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
| 3300010042|Ga0126314_10862364 | Not Available | 668 | Open in IMG/M |
| 3300010045|Ga0126311_10326016 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1164 | Open in IMG/M |
| 3300010359|Ga0126376_10173983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1754 | Open in IMG/M |
| 3300010359|Ga0126376_10372568 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300010359|Ga0126376_10933647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 861 | Open in IMG/M |
| 3300010362|Ga0126377_12834899 | Not Available | 559 | Open in IMG/M |
| 3300010373|Ga0134128_12641688 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300010375|Ga0105239_11775221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300010375|Ga0105239_12930793 | Not Available | 556 | Open in IMG/M |
| 3300010376|Ga0126381_102640848 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 718 | Open in IMG/M |
| 3300010397|Ga0134124_10400496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1306 | Open in IMG/M |
| 3300010397|Ga0134124_12534759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300010399|Ga0134127_11209930 | Not Available | 822 | Open in IMG/M |
| 3300010400|Ga0134122_10635167 | Not Available | 992 | Open in IMG/M |
| 3300010401|Ga0134121_10700624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 960 | Open in IMG/M |
| 3300010403|Ga0134123_10929629 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 878 | Open in IMG/M |
| 3300010403|Ga0134123_11953780 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010403|Ga0134123_12516140 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300011269|Ga0137392_11258600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300011270|Ga0137391_10859462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 744 | Open in IMG/M |
| 3300012189|Ga0137388_10453810 | All Organisms → cellular organisms → Bacteria | 1189 | Open in IMG/M |
| 3300012205|Ga0137362_10068869 | All Organisms → cellular organisms → Bacteria | 2926 | Open in IMG/M |
| 3300012210|Ga0137378_11473548 | Not Available | 592 | Open in IMG/M |
| 3300012353|Ga0137367_10334275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1080 | Open in IMG/M |
| 3300012353|Ga0137367_10433647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 930 | Open in IMG/M |
| 3300012469|Ga0150984_100643398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 700 | Open in IMG/M |
| 3300012517|Ga0157354_1010046 | Not Available | 933 | Open in IMG/M |
| 3300012918|Ga0137396_10914546 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300012922|Ga0137394_10017629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5679 | Open in IMG/M |
| 3300012955|Ga0164298_10874810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 651 | Open in IMG/M |
| 3300012977|Ga0134087_10379601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300013102|Ga0157371_10637127 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300013296|Ga0157374_10757073 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300013296|Ga0157374_11805950 | Not Available | 637 | Open in IMG/M |
| 3300013307|Ga0157372_12217274 | Not Available | 631 | Open in IMG/M |
| 3300014325|Ga0163163_11685521 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300014326|Ga0157380_10482538 | All Organisms → cellular organisms → Bacteria | 1199 | Open in IMG/M |
| 3300014326|Ga0157380_13102518 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300015054|Ga0137420_1433993 | Not Available | 1440 | Open in IMG/M |
| 3300015357|Ga0134072_10112826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 851 | Open in IMG/M |
| 3300015371|Ga0132258_12134042 | Not Available | 1408 | Open in IMG/M |
| 3300015371|Ga0132258_12181729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1391 | Open in IMG/M |
| 3300018468|Ga0066662_10009032 | All Organisms → cellular organisms → Bacteria | 5099 | Open in IMG/M |
| 3300024331|Ga0247668_1066886 | Not Available | 726 | Open in IMG/M |
| 3300025885|Ga0207653_10181544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 787 | Open in IMG/M |
| 3300025904|Ga0207647_10073390 | All Organisms → cellular organisms → Bacteria | 2062 | Open in IMG/M |
| 3300025907|Ga0207645_11044009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. HDW15A | 552 | Open in IMG/M |
| 3300025910|Ga0207684_10000130 | All Organisms → cellular organisms → Bacteria | 137931 | Open in IMG/M |
| 3300025911|Ga0207654_10969227 | Not Available | 618 | Open in IMG/M |
| 3300025918|Ga0207662_10419497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 910 | Open in IMG/M |
| 3300025936|Ga0207670_10417560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1076 | Open in IMG/M |
| 3300025940|Ga0207691_11051154 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 678 | Open in IMG/M |
| 3300025941|Ga0207711_11383792 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300025941|Ga0207711_11646455 | Not Available | 585 | Open in IMG/M |
| 3300025942|Ga0207689_10762559 | Not Available | 816 | Open in IMG/M |
| 3300025945|Ga0207679_12056666 | Not Available | 519 | Open in IMG/M |
| 3300025961|Ga0207712_11793558 | Not Available | 550 | Open in IMG/M |
| 3300026035|Ga0207703_10184605 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1843 | Open in IMG/M |
| 3300026323|Ga0209472_1196901 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300026332|Ga0209803_1131099 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 991 | Open in IMG/M |
| 3300027674|Ga0209118_1046699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1289 | Open in IMG/M |
| 3300027846|Ga0209180_10457424 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 719 | Open in IMG/M |
| 3300027873|Ga0209814_10052350 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300028803|Ga0307281_10240251 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300030991|Ga0073994_12431039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300031548|Ga0307408_101567754 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300031716|Ga0310813_12236123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Chroococcidiopsidales → Chroococcidiopsidaceae → Aliterella | 518 | Open in IMG/M |
| 3300031833|Ga0310917_11179229 | Not Available | 510 | Open in IMG/M |
| 3300031908|Ga0310900_10906752 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 719 | Open in IMG/M |
| 3300031939|Ga0308174_11380678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300032205|Ga0307472_101442681 | Not Available | 669 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.52% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 7.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.14% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 7.14% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.56% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.76% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 4.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.97% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.17% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.38% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.38% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.59% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.59% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.59% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.59% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.79% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300000787 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012517 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.6.yng.070610 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300024331 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| MBSR1b_0695.00001740 | 2162886012 | Miscanthus Rhizosphere | TRYSFSFVSTNKKRDGTVRKLKIDLADGVEKSQGKLVVKARKSYVAPKS |
| JGI11643J11755_117619574 | 3300000787 | Soil | RDGTTRKLKLDIDPAQQKSQGKMVVKARRSYISPREAR* |
| JGI10216J12902_1023484273 | 3300000956 | Soil | GTTRKLKIDVGAPAQKTKGKLVVKARRSYVAPKS* |
| Ga0062589_1014396652 | 3300004156 | Soil | AFVSTNKKRDGTTRKLKLDIDPVRQKSQEKLVIKARRSYISPRN* |
| Ga0062592_1005850102 | 3300004480 | Soil | STNKNRDGTTRKLKLDVDPVQQKSQGKMVVKARRSYISPREAR* |
| Ga0062591_1013330152 | 3300004643 | Soil | TRYSFSFVSTNRKRDGTLRKLKIDVADSAAKSQGKLVVKSRKSYVAPRDLNKGVN* |
| Ga0062594_1003671681 | 3300005093 | Soil | FVSTNKKRDGTMRKLKIDVADGVEKSQGKLVVKARKSYIAPKS* |
| Ga0065715_111313341 | 3300005293 | Miscanthus Rhizosphere | RYSFSFVSTNKKRDGTVRKLKVDLAEGVEKSQGKVVVKARKSYVAPKG* |
| Ga0066388_1014455972 | 3300005332 | Tropical Forest Soil | RSRFSLAYVSSNKARDGSLRKLKIDLTPDALKTRGKLVVKSRRSYVAPRS* |
| Ga0068869_1002149864 | 3300005334 | Miscanthus Rhizosphere | SLAFVSSNRKRDGTLRKLKIDVSPEVQKSQGKLVVKSRRSYVAPKQ* |
| Ga0068869_1012202121 | 3300005334 | Miscanthus Rhizosphere | TNKKRDGTVRKLKVDLAEGVEKTQGKVVVKARKSYVAPKG* |
| Ga0070687_1009421752 | 3300005343 | Switchgrass Rhizosphere | FSFVSTNKKRDGSVRQLKIDLADATEKSQGKLVVKARRSYVAPKE* |
| Ga0070659_1018349931 | 3300005366 | Corn Rhizosphere | YSFSFVSTNKKRDGTVRKLKIDLADGVEKSQGRLVVKARRSYVAPKE* |
| Ga0070672_1009913581 | 3300005543 | Miscanthus Rhizosphere | VSTNKKRDGSVRQLKIDLADATEKSQGKLVVKARRSYVAPKE* |
| Ga0070672_1010154942 | 3300005543 | Miscanthus Rhizosphere | KKRDGTMRKLKIDVADGVEKSQGKLVVKARKSYIAPKS* |
| Ga0070695_1003314181 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | YSFSFVSTNKKRDGTVRKLKVDLAEGVEKSQGKVVVKARKSYVAPKG* |
| Ga0070696_1004992431 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | NKKRDGTLRKLKIELAPATKKAQTKLIVKARKSYIAPKD* |
| Ga0070693_1008404141 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | FSFVSTNKKRDGTVRKLKIDLADGIEKSQGRLVVKARRSYVAPKE* |
| Ga0070704_1003903861 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | STNKKRDGTMRKLKIDVADGVEKSQGKLVVKARKSYIAPKS* |
| Ga0066707_105620591 | 3300005556 | Soil | FVSSNKKRDGALRRLKIDISPAAQKSPGKLVVKARKSYVAPRS* |
| Ga0066699_102953781 | 3300005561 | Soil | SSNKKRDGSTRKLKIDVSPSLQKSPGKLVVKARRSYVAPQR* |
| Ga0066708_109227501 | 3300005576 | Soil | VSTNKKRDGTTRKLKLDVDPALEKSQGKLVVKARRNYIAPRS* |
| Ga0068857_1005508581 | 3300005577 | Corn Rhizosphere | AFVSTNKQRDGTTRKLKLDLDPARQKPQGKLVIKARRSYIAPRR* |
| Ga0068857_1012505012 | 3300005577 | Corn Rhizosphere | KRDGTVRKLKIDLADGVEKSQGRLVVKARKSYVAPKN* |
| Ga0068854_1014759231 | 3300005578 | Corn Rhizosphere | KRDGSVRKLKVELADATKKTQEKLVVKARKSYVAPKG* |
| Ga0068852_1000447361 | 3300005616 | Corn Rhizosphere | YSFSFVSTNKKRDGTVRKLKVDLAEGVEKTQGKVVVKARKSYVAPKG* |
| Ga0068864_1019426361 | 3300005618 | Switchgrass Rhizosphere | VSTNKKRDGTVRKLKIDLADGVEKSQGKLVVKARKSYVAPKS* |
| Ga0068870_106737013 | 3300005840 | Miscanthus Rhizosphere | YSLAFVSSNRKRDGTLRKLKIDVSPEVQKSQGKLVVKSRRSYVAPKQ* |
| Ga0068863_1003797922 | 3300005841 | Switchgrass Rhizosphere | RYSFSFVSTNKKRDGTVRKLKIDLADGVEKSQGRLVVKARKSYVAPKN* |
| Ga0068863_1006632701 | 3300005841 | Switchgrass Rhizosphere | SFVSTNKKRDGTLRKLKIELVNGVEKSQGKLVVKARRSYIAPKS* |
| Ga0068858_1016481532 | 3300005842 | Switchgrass Rhizosphere | GTTRKLKLDVDSAQQKSQGKLVVKARRSYISPREAR* |
| Ga0068862_1011153122 | 3300005844 | Switchgrass Rhizosphere | RDGTTRKLKLDVDPAQQKSQGKLVVKARRSYISPRGAR* |
| Ga0066696_103967711 | 3300006032 | Soil | GTMRKLKIEVQPPLPQPNGKLVVKARRSYVAPRS* |
| Ga0066656_105307592 | 3300006034 | Soil | RDGTVRKLRLKVAPAVEKSQGKLAVKTRRSYVAPKG* |
| Ga0097621_1007669921 | 3300006237 | Miscanthus Rhizosphere | RYSFSFVSTNKKRDGTVRKLKIDLADGVEKSEGKLVVKARRSYVAPKE* |
| Ga0079222_100344831 | 3300006755 | Agricultural Soil | TNKKRDGTTRKLQIDMGQPAQKSRGKLVVKARRSYVAPRT* |
| Ga0075430_1017603281 | 3300006846 | Populus Rhizosphere | FSFVSTNKKRDGTVRKLKIDLADGVEKSQGKVVVKARKSYVAPKG* |
| Ga0075433_118141791 | 3300006852 | Populus Rhizosphere | KQRDGTTRKLKLDLDPARQKSQGKLVIKARRSYIAPRS* |
| Ga0075434_1011046373 | 3300006871 | Populus Rhizosphere | RYNIAFVSSNKKRDGTLRKLKIELAAATKKTQKNLVVKARKSYVAPKG* |
| Ga0066710_1014121322 | 3300009012 | Grasslands Soil | SNKKRDGTTRKLKIDVSPPLQKSQGKLVVKARRSYVAPRR |
| Ga0099829_103396361 | 3300009038 | Vadose Zone Soil | GTTRKLKIEMAIPVQKSQGKLVVKARRSYVAPRS* |
| Ga0105247_105714051 | 3300009101 | Switchgrass Rhizosphere | KKRDGTTRKLKLDVDSAQQKSQGKLVVKARRSYISPREAR* |
| Ga0105247_115212621 | 3300009101 | Switchgrass Rhizosphere | SFVSTNKKRDGSLRNLKIDVANNAEKSQGKLVVKSRKSYVAPKGVN* |
| Ga0105247_116481481 | 3300009101 | Switchgrass Rhizosphere | NKKRDGTLRKLKIELVNGVEKSQGKLVVKARRSYIAPKS* |
| Ga0066709_1018882241 | 3300009137 | Grasslands Soil | SNKKRDGSTRKLKIDVASAAQKSQGKLVVRARRSYVAPKS* |
| Ga0075423_100684671 | 3300009162 | Populus Rhizosphere | AFVSTNKVRDGSLRKLKIELKPEAKKARGELVVKSRKSYVAPRG* |
| Ga0075423_102811451 | 3300009162 | Populus Rhizosphere | RDGTTRKLKLDIDPAQQKSQGKLVVKARRSYISPREAR* |
| Ga0075423_124396532 | 3300009162 | Populus Rhizosphere | AFVSTNKLRDGSLRKLKIELKPEVKKTRGELMVKSRKSYVAPRG* |
| Ga0105241_101087431 | 3300009174 | Corn Rhizosphere | KRDGTLRKLKIDLAPATKKSQTKLVVKARKSYVAPKG* |
| Ga0105241_107684572 | 3300009174 | Corn Rhizosphere | FVSSNKKRDGSLRKLKIDLVDGAKKKQQVKLVVKARRSYVAPKS* |
| Ga0105241_108307041 | 3300009174 | Corn Rhizosphere | KRDGTTRKLKLDVDPAQQKSKGKLVVKARRSYISPRAAR* |
| Ga0105248_110636162 | 3300009177 | Switchgrass Rhizosphere | AFVSTNKKRDGTTRKLKLDVDPAQQESQGKLVVKARRSYISPREAR* |
| Ga0105248_110649931 | 3300009177 | Switchgrass Rhizosphere | NKQRDGTTRKLKLDLDPARQKSQGKLVIKARRSYIAPRR* |
| Ga0105249_122035872 | 3300009553 | Switchgrass Rhizosphere | KKRDGTVRKLKIDMADGVEKSQGKLVVKARRSYVAPKS* |
| Ga0126304_100605011 | 3300010037 | Serpentine Soil | TNKKRDGTVRKLKIGLANSVEKSQGRLVVKARKSYVAPKE* |
| Ga0126314_108623641 | 3300010042 | Serpentine Soil | SFSFVSTNKKRDGTVRKLKVDLVDGVEKSQGKLVVKARKSYVAPKN* |
| Ga0126311_103260163 | 3300010045 | Serpentine Soil | GTVRKLKIDLADGVEKSEGRLVVKARKNYVAPKE* |
| Ga0126376_101739831 | 3300010359 | Tropical Forest Soil | FSLAYVSSNKARDGSLRKLKIDLTPDALKTRGKLVVKSRRSYVAPRS* |
| Ga0126376_103725681 | 3300010359 | Tropical Forest Soil | AFVSTNKKRDGTTRKLKLDIDPARQKSQGKLVIKARRSYISPRG* |
| Ga0126376_109336472 | 3300010359 | Tropical Forest Soil | YSFSFVSTNKSRDGSVRKLKVDLADGVEKTEGHVVVKARKTYVAPKS* |
| Ga0126377_128348992 | 3300010362 | Tropical Forest Soil | STNKNRDGTVRKLKVDLAEGVEKSQGKLVVRARKSYVAPK* |
| Ga0134128_126416881 | 3300010373 | Terrestrial Soil | YSFSFVSTNKNRDGTVRKLKVDLANGVEKSQGKLVVKARKSYVAPKG* |
| Ga0105239_117752213 | 3300010375 | Corn Rhizosphere | FVSTNKQRDGTTRKLKLDVDPAQQKSQGKLVVKARRSYISPRAAR* |
| Ga0105239_129307932 | 3300010375 | Corn Rhizosphere | RDGTVRKLKIDLANGVEKSQGKLVVKARKTYVAPKE* |
| Ga0126381_1026408481 | 3300010376 | Tropical Forest Soil | NKKRDGTTRRLKVDVQPSLSDSEGKLVVKAKRSYVAPRT* |
| Ga0134124_104004961 | 3300010397 | Terrestrial Soil | NRNRDGTTRKLKLELQPAVEKTEGKLVIKSRRSYVAPKS* |
| Ga0134124_125347592 | 3300010397 | Terrestrial Soil | RTRYSFSFVSTNKKRDGTVRKLKIDLADGVEKSNGKLVVKARKSYVAPKGESSQ* |
| Ga0134127_112099302 | 3300010399 | Terrestrial Soil | GTLRKLKIDLAPATKKSQTKLVVKARKSYVAPKG* |
| Ga0134122_106351672 | 3300010400 | Terrestrial Soil | DGTTRKLKLDVDPAQQKSQGKLVVKARRSYISPREAR* |
| Ga0134121_107006241 | 3300010401 | Terrestrial Soil | NRDGTTRKLKLDLQPNVQKSEGKLIVKSRRSYVAPRS* |
| Ga0134123_109296291 | 3300010403 | Terrestrial Soil | RDGTTRKLKIDLAQSAQKSKDRLVVKARRSYIAPGS* |
| Ga0134123_119537803 | 3300010403 | Terrestrial Soil | RKRDGTLRKLKIEVTPEVQKAQGKLVVKARRSYVAPKQKDEGR* |
| Ga0134123_125161402 | 3300010403 | Terrestrial Soil | AFVSTNKKRDGTTRKLKIDLAQSSPKPKDKLVVKARRSYIAPGD* |
| Ga0137392_112586001 | 3300011269 | Vadose Zone Soil | NKKRDGTVRKLRIDVAAAPQKSQGKLVVKARRSYVAPKS* |
| Ga0137391_108594622 | 3300011270 | Vadose Zone Soil | TRYNLAYVSSNKKRDGTARKLKIDVAPAAQKSQGKLVVKARRSYVAPHS* |
| Ga0137388_104538103 | 3300012189 | Vadose Zone Soil | RDGTTRKLKIDVSPSLQKSQTRLVVKARRSYVAPRS* |
| Ga0137362_100688691 | 3300012205 | Vadose Zone Soil | KKRDGTTRKLRVDLAPPIQKSQVKLVVKARRSYVAPSR* |
| Ga0137378_114735481 | 3300012210 | Vadose Zone Soil | FVSTNKKRDGTTRKLKIDVQPAVPKSQGKLVVKARRSYVAPK* |
| Ga0137367_103342752 | 3300012353 | Vadose Zone Soil | LAFVSSNKKRDGTTRKLKLDVAPAIEKSEGKLVVKARRSYVAPKQ* |
| Ga0137367_104336471 | 3300012353 | Vadose Zone Soil | KKRDGTTRKLKIDVSPSLQKSQDKLAVKARRSYVAPRS* |
| Ga0150984_1006433982 | 3300012469 | Avena Fatua Rhizosphere | GTTRKLKIELAQAAQKSKDKLVVKARRSYIAPGS* |
| Ga0157354_10100461 | 3300012517 | Unplanted Soil | RDGTTRKLKLDIDPARQKSQGKVVIKARRRYIAPRS* |
| Ga0137396_109145461 | 3300012918 | Vadose Zone Soil | NLAFVSSNRKRDGSLRKLKIDVTPAIDKSQGKLVVKARRSYIAPR* |
| Ga0137394_100176291 | 3300012922 | Vadose Zone Soil | GSLRKLKIDVTPAIDKSQGKLVVKARRGYIAPKQ* |
| Ga0164298_108748101 | 3300012955 | Soil | NKKRDGTLRKLKIDLTPDAQKSNGKLVVKARRGYIAPKEK* |
| Ga0134087_103796011 | 3300012977 | Grasslands Soil | KKRDGTTRKLKLDLSQPVQKSQGKLVVKARRSYVAPR* |
| Ga0157371_106371272 | 3300013102 | Corn Rhizosphere | FSFVSTNKKRDGTVRKLKIDLADGVEKSQGRLVVKARRSYVAPKE* |
| Ga0157374_107570731 | 3300013296 | Miscanthus Rhizosphere | DGTVRKLKIDLADAIEKSQGRLVVKARRSYVAPKE* |
| Ga0157374_118059502 | 3300013296 | Miscanthus Rhizosphere | FGSTNKKRDGTTLKLKLDFDPAQQKSQGKLVVKARRSYISPREAR* |
| Ga0157372_122172741 | 3300013307 | Corn Rhizosphere | NKKRDGTLRKLKIELAPATKKAQTKLVVKARKSYIAPKD* |
| Ga0163163_116855212 | 3300014325 | Switchgrass Rhizosphere | SFSFVSTNKKRDGTVRNLKISLADGIEKSQGRLVVKARRSYVAPKE* |
| Ga0157380_104825381 | 3300014326 | Switchgrass Rhizosphere | TNKQHDGTVRKLKVDVAEGAAKSEGKLVVKARKSYVAPKS* |
| Ga0157380_131025182 | 3300014326 | Switchgrass Rhizosphere | FVSSNRRRDGTLRKLKIDVHQELHKSQGKLVVKSRRSYVAPKEK* |
| Ga0137420_14339931 | 3300015054 | Vadose Zone Soil | VSSNRKRDGSLRTLKIDVTPDAQKSQGKLVVKARRSYLAPKEK* |
| Ga0134072_101128261 | 3300015357 | Grasslands Soil | KKRDGTTRKLKLDLSQPVQKSQGKLVVKARRSYVAPRT* |
| Ga0132258_121340422 | 3300015371 | Arabidopsis Rhizosphere | FVSSNKARDGSVRKLKIELKPEVQKTRGNLVVKARRSYVAPRG* |
| Ga0132258_121817291 | 3300015371 | Arabidopsis Rhizosphere | KKRDGSLRKLKIELADNAKKRHDKLVVKARKSYVAPKS* |
| Ga0066662_100090324 | 3300018468 | Grasslands Soil | DGTTRKLKLKVSPVVEKSQGKLAVKTRGSYVAPRS |
| Ga0247668_10668861 | 3300024331 | Soil | VSSNKKRDGTTRKLKVDLAPSTQKSQTKLVVKARRSYVAPTR |
| Ga0207653_101815442 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | TNKKHDGTVRKLKVDVAEGAAKSEGKVVVKARKSYVAPKS |
| Ga0207647_100733903 | 3300025904 | Corn Rhizosphere | SFSFVSTNKKRDGTVRKLKVDLAEGVEKAQGKVVVKARKSYVAPKG |
| Ga0207645_110440092 | 3300025907 | Miscanthus Rhizosphere | KRDGTTRKLKLDVDSAQQKSQGKLVVKARRTYISPREAR |
| Ga0207684_1000013060 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFVSSNKKRDGTLRKLKIELASARKKTQKDLVVKARRSYVAPKS |
| Ga0207654_109692271 | 3300025911 | Corn Rhizosphere | AFVSSNKKRDGSLRKLKIELADNAKKTHDKLVVKARKSYVAPKG |
| Ga0207662_104194971 | 3300025918 | Switchgrass Rhizosphere | LAFVSTNKKRDGTTRKLKLDVDSPQQKSQGKLVVKARRSYISPREAR |
| Ga0207670_104175603 | 3300025936 | Switchgrass Rhizosphere | LAFVSTNKKRDGTTRKLKIDMGQSAQKSRGKLVVKARRSYVAPRT |
| Ga0207691_110511541 | 3300025940 | Miscanthus Rhizosphere | NKKRDGTMRKLKIDVADGVEKSQGKLVVKARKSYIAPKS |
| Ga0207711_113837921 | 3300025941 | Switchgrass Rhizosphere | AFVSTNKKRDGTTRKLKLDVDPAQQESQGKLVVKARRSYISPREAR |
| Ga0207711_116464551 | 3300025941 | Switchgrass Rhizosphere | FVSTNKKRDGSVRQLKIDLADATEKSQGKLVVKARRSYVAPKE |
| Ga0207689_107625592 | 3300025942 | Miscanthus Rhizosphere | RDGTVRKLKVDLAEGVEKTQGKVVVKARKSYVAPKG |
| Ga0207679_120566662 | 3300025945 | Corn Rhizosphere | YSFSFVSTNKNRDGTVRKLKIDLSDGVQKSQGKLVVKARKSYVAPKS |
| Ga0207712_117935582 | 3300025961 | Switchgrass Rhizosphere | HDGTVRKLKVDVAEGAAKSEGKLVVKARKSYVAPKS |
| Ga0207703_101846054 | 3300026035 | Switchgrass Rhizosphere | KRDGTTRKLKIDLAQSAQKSKDRLVVKARRSYIAPGS |
| Ga0209472_11969012 | 3300026323 | Soil | RDGATRKLKLDVSAPNQPPKTKLVVKARRSYVAPRN |
| Ga0209803_11310991 | 3300026332 | Soil | SNKKRDGTTRKLKIDIGTAGQKSQGKLVVRARRSYIAPRS |
| Ga0209118_10466991 | 3300027674 | Forest Soil | SSNKKRDGTTRKLKIDVSPPLQKSQGKLVVKARRSYIAPRS |
| Ga0209180_104574242 | 3300027846 | Vadose Zone Soil | NKKRDGTTRKLKIDVSPSLQKSQTRLVVKARRSYVAPRS |
| Ga0209814_100523501 | 3300027873 | Populus Rhizosphere | KKRDGTTRKLKLDIHPAGQKSQGKLVIKARRSYIAPRS |
| Ga0307281_102402511 | 3300028803 | Soil | KRDGTLRKLKIDVTPAVEKSQGKVVVKARRGYIAPKQ |
| Ga0073994_124310391 | 3300030991 | Soil | FVSSNKKRDGTTRKLKIDLATPAQKSQDKLVVKARRSYVAPRR |
| Ga0307408_1015677541 | 3300031548 | Rhizosphere | RDGTVRKLKIDLADGIEKSQGHLVVKARRTYVAPKE |
| Ga0310813_122361231 | 3300031716 | Soil | RTRYSFSFVSTNKKRDGTLRKLKVEVADGVQKSEGKLVVKARKSYVAPKS |
| Ga0310917_111792291 | 3300031833 | Soil | TNKKRDGTTRRLKVDVQPSLSDTEGKLVVKAKRSYVAPRT |
| Ga0310900_109067521 | 3300031908 | Soil | STNKKRDGTMRKLKIDVADGVEKSQGKLVVKARKSYIAPKS |
| Ga0308174_113806781 | 3300031939 | Soil | VSTNKKRDGTVRKLKIDLADGIEKSQGRLVVKARRSYVAPKE |
| Ga0307472_1014426811 | 3300032205 | Hardwood Forest Soil | SFVSTNKKRDGTVRKLKIDLTDGVEKSQGRLVVKARKSYVAPKE |
| ⦗Top⦘ |