 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F066844 |
| Family Type | Metagenome |
| Number of Sequences | 126 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MEDEYVYSLECNNCGDMTCAEVCFFYKDETYCEDCCPQGYGE |
| Number of Associated Samples | 99 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 81.75 % |
| % of genes near scaffold ends (potentially truncated) | 26.98 % |
| % of genes from short scaffolds (< 2000 bps) | 79.37 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (60.317 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (35.714 % of family members) |
| Environment Ontology (ENVO) | Unclassified (75.397 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (85.714 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 14.29% Coil/Unstructured: 85.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF00145 | DNA_methylase | 23.81 |
| PF12957 | DUF3846 | 3.17 |
| PF06067 | DUF932 | 2.38 |
| PF00589 | Phage_integrase | 1.59 |
| PF06945 | DUF1289 | 1.59 |
| PF07883 | Cupin_2 | 0.79 |
| PF01612 | DNA_pol_A_exo1 | 0.79 |
| PF01555 | N6_N4_Mtase | 0.79 |
| PF01381 | HTH_3 | 0.79 |
| PF06094 | GGACT | 0.79 |
| PF03889 | ArfA | 0.79 |
| PF00959 | Phage_lysozyme | 0.79 |
| PF07878 | RHH_5 | 0.79 |
| PF03592 | Terminase_2 | 0.79 |
| PF01883 | FeS_assembly_P | 0.79 |
| PF03906 | Phage_T7_tail | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 23.81 |
| COG3313 | Predicted Fe-S protein YdhL, DUF1289 family | General function prediction only [R] | 1.59 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.79 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.79 |
| COG3036 | Stalled ribosome alternative rescue factor ArfA | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG3728 | Phage terminase, small subunit | Mobilome: prophages, transposons [X] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 60.32 % |
| All Organisms | root | All Organisms | 39.68 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 35.71% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.90% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 6.35% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 4.76% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.97% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 3.17% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 3.17% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 3.17% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 2.38% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 2.38% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 2.38% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 2.38% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 1.59% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.59% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.59% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 1.59% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.59% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 1.59% |
| Marine Oceanic | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic | 0.79% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.79% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 0.79% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.79% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.79% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.79% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.79% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.79% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.79% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.79% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
| 3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300003427 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300004461 | Marine viral communities from Newfoundland, Canada BC-2 | Environmental | Open in IMG/M |
| 3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006332 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0200m | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006754 | Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006990 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG | Environmental | Open in IMG/M |
| 3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
| 3300008217 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_215 | Environmental | Open in IMG/M |
| 3300008221 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_66 | Environmental | Open in IMG/M |
| 3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009071 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 | Environmental | Open in IMG/M |
| 3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
| 3300009434 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 | Environmental | Open in IMG/M |
| 3300009445 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 | Environmental | Open in IMG/M |
| 3300009447 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110509 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009507 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300009794 | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300011128 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02 | Environmental | Open in IMG/M |
| 3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300017697 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2) | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017753 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
| 3300020401 | Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139) | Environmental | Open in IMG/M |
| 3300020439 | Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029) | Environmental | Open in IMG/M |
| 3300020595 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1 | Environmental | Open in IMG/M |
| 3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
| 3300021964 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34D | Environmental | Open in IMG/M |
| 3300022061 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2) | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022929 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025048 | Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes) | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025071 | Marine viral communities from the Pacific Ocean - LP-36 (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025508 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025849 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes) | Environmental | Open in IMG/M |
| 3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026187 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
| 3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300027779 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300027906 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031612 | Marine microbial communities from water near the shore, Antarctic Ocean - #127 | Environmental | Open in IMG/M |
| 3300031626 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_surface | Environmental | Open in IMG/M |
| 3300032255 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month chalcopyrite | Environmental | Open in IMG/M |
| 3300032274 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100012911 | 3300000101 | Marine | MEDEYVYDRDCNDCGAKTCAEVAFFHDDKVFCEDCCPEGYGE* |
| DelMOSum2010_100622662 | 3300000101 | Marine | MEDEYVYNKECADCGDMTCAEVCFFYKDETYCEDCCPQGYGE* |
| DelMOSum2011_101308611 | 3300000115 | Marine | MEIDMEDEYVYNKECADCGDMTCAEVCFFYKDETYCEDCCPQGYGE* |
| DelMOSum2011_101942623 | 3300000115 | Marine | MEIDMEDEYVYSLECNNCEDMTCAEVCFFYKDETYCEDCCPQGYGE* |
| DelMOSpr2010_100028278 | 3300000116 | Marine | MEKIEDYVYDRECEDCGAKTCAEVAFFFDDKIFCEDCCPEEYGA* |
| DelMOSpr2010_101074261 | 3300000116 | Marine | MEDEYVYSLDCKNCGDKTCAEKAFFHNDETFCDDCCPEGYGE* |
| BBAY92_100754821 | 3300000947 | Macroalgal Surface | MNDVVENEYVYNLKCADCGDMTCAEVCFFYEDEIYCEDCCPDGYGE* |
| JGI24006J15134_102318493 | 3300001450 | Marine | MEIDMEDEYVYSLECNNCGDMTCAEVCFFYKDETYCDDCCPQGYGE* |
| JGI24006J15134_102536253 | 3300001450 | Marine | MEDEYVYSLECNNCGDMTCAEVCFFYKDETYCEDCCPQGYGE* |
| JGI24003J15210_101232922 | 3300001460 | Marine | MEDEYVYSLDCENCGDKTCAEKAFFHKDETFCDDCCPEGYGE* |
| JGI24004J15324_100611531 | 3300001472 | Marine | YVYSLDCENCGDKTCAEKAFFHKDETFCDDCCPEGYGE* |
| JGI24004J15324_101312153 | 3300001472 | Marine | MEDEYVYDRDCKNCGAKTCAEKAFFHNDETFCDDCCPEGYGE* |
| JGI24005J15628_101332101 | 3300001589 | Marine | YVYSLECNNCGDMTCAEVCFFYKDETYCDDCCPQGYGE* |
| JGI24005J15628_101544691 | 3300001589 | Marine | MEDEYVYSLKCNNCGDMTCAEVAFFYEDETYCDDCCPQGYGE* |
| JGI24005J15628_101650353 | 3300001589 | Marine | YSLECNNCGDMTCAEVCFFYKDETYCEDCCPQGYGE* |
| JGI25128J35275_11151411 | 3300002488 | Marine | MREYVYDRECADCGDMTCAEVCFFYEDEIYCEDCCPIGYGE* |
| JGI26084J50262_10577984 | 3300003427 | Marine | MDQEYVYDRECDDCGAKTCAEVAYFYEDKTFCEDCCPDGYGE* |
| Ga0065861_10231852 | 3300004448 | Marine | MEEEYVYSLDCKNCGDKTCAEKAFFHNDETFCDDCCPEGYGE* |
| Ga0065861_10896844 | 3300004448 | Marine | MEDEYVYSLECNNCGNTTCAEVCFFYKDETYCEDCCPQGYGE* |
| Ga0065861_11558342 | 3300004448 | Marine | MEDEYVYSLDCENCGDKTCAEKAFFHNDETFCDDCCPEGYGE* |
| Ga0066223_10842151 | 3300004461 | Marine | MEEEYVYSLYCKNCGDKTCAEKAFFHNDETFCDDCCPEGYGE* |
| Ga0075478_100154942 | 3300006026 | Aqueous | MEDEYVYDRDCKDCGAKTCAEKAFFYNDETFCEDCCPEGYGE* |
| Ga0068500_10079997 | 3300006332 | Marine | MREHIYDRECADCGEMTCAEVCFFYEDEIYCEDCCPVGYGE* |
| Ga0068500_110970517 | 3300006332 | Marine | MREYVYDRECADCGDMTCAEVCFFYEDEIYCEDCCPVGYGE* |
| Ga0098038_10530471 | 3300006735 | Marine | MEDEYVYSLECNNCGDMTCAEVCFFYKDEVYCEWCCPEGYG |
| Ga0098038_10749413 | 3300006735 | Marine | MDREYVYDRECDDCGAKTCAEVAYFYEDKTFCEDCCPDGYGE* |
| Ga0098038_11336943 | 3300006735 | Marine | MEDEYVYDRDCNDCGAKTCAEVAFFHDDKVFCEDCCPEGYGE*FI |
| Ga0098037_11932183 | 3300006737 | Marine | MEDEYVYDRDCNDCGAKTCAEVAFFHDDKVFCEDCCPEGYGE*FILQK |
| Ga0098048_11382772 | 3300006752 | Marine | YNMEDEYIYNKECVDCGDMTCAEVCFFYKDETYCEDCCPQGYGD* |
| Ga0098048_12089052 | 3300006752 | Marine | MEDEYVYDRDCNDCGAKTCAEVAFFHDDKVFCEDCCPEAYGE* |
| Ga0098044_101760511 | 3300006754 | Marine | MREYVYDRECADCGEMTCAEVCFFYEDEIYCEDCCPVGYGE* |
| Ga0098055_10872394 | 3300006793 | Marine | VEEEFVYDRECFNCGAMTCAEVAFFYDDEVYCEDCCPEKYGE* |
| Ga0070754_1000514924 | 3300006810 | Aqueous | MEDEYVYSLKCNNCGDMTCAEVAFFYEDETYCDDCCPEGYGE* |
| Ga0070754_101736271 | 3300006810 | Aqueous | ECNSDEGEDYVYDRECDDCGAKTCAEVAYFYEDKTFCED* |
| Ga0070750_101125214 | 3300006916 | Aqueous | MEDEYVYNKECVDCGDMTCAEVCFFYKDETYCEDCCPQGYGE* |
| Ga0070746_101430841 | 3300006919 | Aqueous | MEDEYVYNKECVDCGDMTCAEVCFFYKDETYCEDCCPQGY |
| Ga0070748_12205883 | 3300006920 | Aqueous | MDQEYVYDRECNDCGQQTCAEVAYFYKDKTFCEDCCPDGYGE* |
| Ga0098051_10940852 | 3300006924 | Marine | NKECVDCGDMTCAEVCFFYKDETYCEDCCPQGYGD* |
| Ga0098046_11156882 | 3300006990 | Marine | MEDEYVYDRDCNDCGAKTCAEVAFFHDDKVFCEDCCP |
| Ga0075468_101108833 | 3300007229 | Aqueous | IMDQEYVYDRECNDCGQQTCAEVAYFYKDKTFCEDCCPDGYGE* |
| Ga0099849_10480804 | 3300007539 | Aqueous | MEDEYVYDRDCKNCGAKTCAEKAFFHKDETFCEDCCPEGYGE* |
| Ga0114899_12171671 | 3300008217 | Deep Ocean | MNDVVENEYVYDRECADCGDMTCAEVCFFYEDEIYCEDCCPVGYGE* |
| Ga0114916_11366992 | 3300008221 | Deep Ocean | MEDEYVYSLDCKNCGDKTCAEKAFFHKDETFCDDCCPEGYGE* |
| Ga0102960_12398173 | 3300009000 | Pond Water | MEDEYVYNKECADCGDMTCAEVCFFYKDETYCEDCCPDGYGEYI* |
| Ga0102963_10575875 | 3300009001 | Pond Water | MEDEYVYNKECADCGDMTCAEVCFFYKDETYCEDCCPDGYGE* |
| Ga0115566_103564464 | 3300009071 | Pelagic Marine | MEIDMEDEYVYNKECVDCGDMTCAEVCFFYKDETYCEDCCPQGYGE* |
| Ga0118687_101663582 | 3300009124 | Sediment | MSRSSCEEDYVYDRECENCGAKTCAEVAFFYNDQTFCEDCCPEEYGE* |
| Ga0115562_11253434 | 3300009434 | Pelagic Marine | MEDEYIYNKECVDCGDMTCAEVCFFYKDETYCEDCCPQGYGE |
| Ga0115553_13813282 | 3300009445 | Pelagic Marine | MEDEYVYNKECNNCGDMTCAEVCFFYKDETYCEDCCPQGYGEYI* |
| Ga0115560_14254272 | 3300009447 | Pelagic Marine | MEDEYVYSLECNNCGDMTCAEVCFFYKDETYCEDCCPQGYGD* |
| Ga0114932_106369381 | 3300009481 | Deep Subsurface | GARIMREYVYDRECADCGDMTCAEVCFFYEDEIYCEDCCPVGYGE* |
| Ga0115564_101192162 | 3300009505 | Pelagic Marine | MEDEYVYNKECNNCGDMTCAEVCFFYKDETYCEDCCPQGYGD* |
| Ga0115564_102063473 | 3300009505 | Pelagic Marine | MEDEYIYNKECVDCGDMTCAEVCFFYKDETYCEDCCPDGYGE* |
| Ga0115572_106686811 | 3300009507 | Pelagic Marine | MEDEYVYDRDCNDCGAKTCAEVAFFHDDKVFCEVCCPEGYGE* |
| Ga0115003_104508054 | 3300009512 | Marine | MRRIKQETMEDKYVCSLKCNNCGDMTCAEVAFFHEDETYCDDCCPEGYGE* |
| Ga0115003_108472523 | 3300009512 | Marine | MEEEYVYSLDCENCGDKTCAEKAFFHNDETFCDDCCPEGYGE* |
| Ga0115004_106908112 | 3300009526 | Marine | MEDKYVCSLKCNNCGDMTCAEVAFFHEDETYCDDCCPEGYGE* |
| Ga0115012_1005197910 | 3300009790 | Marine | MTEEYVYDRECDDCGLMTCAEVAFFYDDKIFCEWCCPDGYGDKQ* |
| Ga0115012_109956352 | 3300009790 | Marine | MTEEYVYDRECDDCGLMTCAEVAYLYDDKIFCEWCPPDGYGE* |
| Ga0105189_10244062 | 3300009794 | Marine Oceanic | MREYVYDLECADCGDMTCAEVCFFYEDEIYCEDCCPIGYGE* |
| Ga0098043_10620006 | 3300010148 | Marine | MEDEYVYSLECNNCGDMTCAEVCFFYKDEVYCEWCCPEGYGE* |
| Ga0098043_11624291 | 3300010148 | Marine | MDREYVYDRECDDCGAKTCAEVAYFYEDKTFCEDCCPDGYGG* |
| Ga0098049_10983574 | 3300010149 | Marine | MEDEYIYNKECVDCGDMTCAEVCFFYKDETYCEDCCPQGYG |
| Ga0098056_10141142 | 3300010150 | Marine | MEDEYIYNKECVDCGDMTCAEVCFFYKDETYCEDCCPQGYGD* |
| Ga0118731_1004412551 | 3300010392 | Marine | RECDDCGAKTCAEVAYFYEDKTFCEDCCPDGYGE* |
| Ga0151669_1393912 | 3300011128 | Marine | MNLTSKQNTTMEDEYVYDRDCKDCGAKTCAEKAFFYNDETFCEDCCPEGYGE* |
| Ga0151669_1547651 | 3300011128 | Marine | MGDNAMNENEYVYNKECADCGDMTCAEVCFFYKDETYCEDCCPQGYGE* |
| Ga0151677_10578503 | 3300011258 | Marine | MDKEYVYDRECDDCGAKTCAEVAYFYEDKTFCEDCCPEGYGGLLWVN* |
| Ga0160423_100522981 | 3300012920 | Surface Seawater | IPNECNQCYVYNKKCFDCGDMTCAERAFFYKDQVYCEDCPPDGYGE* |
| Ga0160423_103492983 | 3300012920 | Surface Seawater | VEEEFVYDRKCFNCGAMTCAEVAFFYDDEVYCEDCCPDGYGE* |
| Ga0180120_103871612 | 3300017697 | Freshwater To Marine Saline Gradient | MEDEYVQRYSYSLECNNCGDMTCAEVCFFYKDETYCEDCCPQGYGE |
| Ga0181377_10311024 | 3300017706 | Marine | MEDEYVYDRDCNDCGAKTCAEVAFFHDDKIFCEDCCPEGYGE |
| Ga0181369_10117646 | 3300017708 | Marine | IMDREYVYDRECDDCGAKTCAEVAYFYEDKTFCEDCCPDGYGE |
| Ga0181427_11167852 | 3300017745 | Seawater | VYSLECNNCGDMTCAEVCFFYKDEVYCEWCCPEGYGE |
| Ga0181407_11211662 | 3300017753 | Seawater | EYVYNKECADCGDMTCAEVCFFYKDETYCEDCCPQGYGE |
| Ga0181425_10372852 | 3300017771 | Seawater | MEDEYIYNKKCVDCGDMTCAEVCFFYKDETYCEDCCPQGYGE |
| Ga0181607_105492382 | 3300017950 | Salt Marsh | MDQEYVYDRECDDCGAKTCAEVAYFYEDKTFCEDCCPDGYGE |
| Ga0211678_103957632 | 3300020388 | Marine | MEDEYVYDRDCNDCGAKTCAEVAFFHDDKVFCEDCCPEGYGE |
| Ga0211617_100201421 | 3300020401 | Marine | VEEEFVYDRKCFNCGAMTCIELAFLYDDEVYCEDCCPDGYGE |
| Ga0211558_104501912 | 3300020439 | Marine | VEEEFVYDRECFNCGAMTCAEVAFFYDDEVYCEDCCPDGYGE |
| Ga0206126_104346841 | 3300020595 | Seawater | DEYVYDRDCNDCGAKTCAEVAFFHDDKVFCEDCCPEGYGE |
| Ga0213867_10264493 | 3300021335 | Seawater | MDQEYVYDRECNDCGQQTCAEVAYFYKDKTFCEDCCPDGYGE |
| Ga0206123_102941991 | 3300021365 | Seawater | YMEIDMEDEYVYNKECVDCGDMTCAEVCFFYKDETYCEDCCPQGYGE |
| Ga0222718_102798453 | 3300021958 | Estuarine Water | MSRSSCEEAYVYDRECENCGAKTCAEVAFFYNDQTFCEDCCPEEYGE |
| Ga0222715_103957793 | 3300021960 | Estuarine Water | MDQEYVYDRECDDCGAKTCAEVAYFYEDKTFCEDCCPEGYGE |
| Ga0222719_103426992 | 3300021964 | Estuarine Water | MEDEYVYNKECADCGDMTCAEVCFFYKDETYCEDCCPQGYGE |
| Ga0212023_10238783 | 3300022061 | Aqueous | YDRDCNDCGAKTCAEVAFFHDDKVFCEDCCPEGYGE |
| Ga0212024_10985783 | 3300022065 | Aqueous | KEGRLMEDEYVYDRDCKDCGAKTCAEKAFFYNDETFCEDCCPEGYGE |
| Ga0224906_11455053 | 3300022074 | Seawater | MEDEYIYNKECVDCGDMTCAEVCFFYKDETYCDDCCPQGYGE |
| Ga0212022_10175203 | 3300022164 | Aqueous | MEDEYVYDRDCKNCGAKTCAEKAFFHKDETFCEDCCPEGYGE |
| Ga0255752_104235261 | 3300022929 | Salt Marsh | MEKIEDYVYDRECEDCGAKTCAEVAFFFDDKIFCEDCCPEEYGA |
| (restricted) Ga0233444_100613476 | 3300024264 | Seawater | MEDEYVYNKECNNCGDMTCAEVCFFYKDETYCEDCCPQGYGE |
| Ga0209992_100544056 | 3300024344 | Deep Subsurface | MREYVYDRECADCGDMTCAEVCFFYEDEIYCEDCCPVGYGE |
| Ga0209992_102871961 | 3300024344 | Deep Subsurface | MREYVYDRECADCGDMTCAEVCFFYEDEIYCEDCCP |
| Ga0207905_10072872 | 3300025048 | Marine | MEDEYVYSLECNNCGDMTCAEVCFFYKDETYCEDCCPQGYGE |
| Ga0207905_10504831 | 3300025048 | Marine | MEDEYVYSLDCKNCGDKTCAEKAFFHKDETFCDDCCPEGYGEXLIPQKK |
| Ga0208667_100026633 | 3300025070 | Marine | MEDEYVYNKECVDCGDMTCAEVCFFYKDETYCEDCCPQGYGE |
| Ga0208667_100067119 | 3300025070 | Marine | MEDEYVYSLECNNCGDMTCAEVCFFYKDEVYCEWCCPEGYGE |
| Ga0207896_10209583 | 3300025071 | Marine | MEDEYVYSLDCKNCGDKTCAEKAFFHKDETFCDDCCPEGYGE |
| Ga0208157_10028106 | 3300025086 | Marine | MDREYVYDRECDDCGAKTCAEVAYFYEDKTFCEDCCPDGYGE |
| Ga0209535_10024124 | 3300025120 | Marine | MEDEYVYSLDCKNCGDKTCAEKAFFHKNETFCDDCCPEGYGE |
| Ga0209535_10535331 | 3300025120 | Marine | MEDEYVYSLDCENCGDKTCAEKAFFHKDETFCDDCCPEGYGE |
| Ga0209232_100369615 | 3300025132 | Marine | MREYVYDRECADCGDMTCAEVCFFYEDEIYCEDCCPIGYGE |
| Ga0209634_11501232 | 3300025138 | Marine | MEDEYVYSLECNNCGDMTCAEVCFFYKDETYCDDCCPQGYGE |
| Ga0208148_10218976 | 3300025508 | Aqueous | MEIDMEDEYVYNKECADCGDMTCAEVCFFYKDETYCEDCCPQGYGE |
| Ga0208149_10150676 | 3300025610 | Aqueous | MEDEYVYDRDCKDCGAKTCAEKAFFYNDETFCEDCCPEGYGE |
| Ga0208643_11712221 | 3300025645 | Aqueous | MEDEYVYSLKCNNCGDMTCAEVAFFYEDETYCDDCCPEGYGE |
| Ga0208428_10451935 | 3300025653 | Aqueous | GRLMEDEYVYDRDCKDCGAKTCAEKAFFYNDETFCEDCCPEGYGE |
| Ga0209603_12697112 | 3300025849 | Pelagic Marine | MEDEYVYDRDCNDCGAKTCAEVAFFHHDKVFCEDCCPEGYGE |
| Ga0209631_103681841 | 3300025890 | Pelagic Marine | YDKECDDCGAKTCAEVAYFYKDKTFCEDCCPDGYGQ |
| Ga0209630_102787702 | 3300025892 | Pelagic Marine | MEDEYVYNKECVDCGDMTCAEVCFFYKDETYCEDCCPQGYGD |
| Ga0209929_10433404 | 3300026187 | Pond Water | MDQEYVYDRECDDCGVKTCAEVAYFYEDKTFCEDCCPEGYGE |
| Ga0209929_11715282 | 3300026187 | Pond Water | MEDEYVYNKECADCGDMTCAEVCFFYKDETYCEDCCPDGYGE |
| Ga0209710_11441352 | 3300027687 | Marine | MEDEYINSLKCNNCGDMTCAEVAFFHEDETYCDDCCPEGYGE |
| Ga0209710_11509452 | 3300027687 | Marine | MEEEYVYSLDCKNCGDKTCAEKAFFHNDETFCDDCCPEGYGE |
| Ga0209709_100893355 | 3300027779 | Marine | MEDEYVYSLDCENCGDKTCAEKAFFHNDETFCDDCCPEGYGE |
| Ga0209404_1000673610 | 3300027906 | Marine | MTEEYVYDRECDDCGSMTCAEVAFFYDDKIFCEWCCPDGYGGEHE |
| Ga0256368_10020208 | 3300028125 | Sea-Ice Brine | MEDEYVYSLKCNNCEDMTCAEVAFFYKDETYCDDCCPEGYGE |
| Ga0183755_100013127 | 3300029448 | Marine | MEDEYVYSLECNNCEDMTCAEVCFFYKDETYCEWCCPEGYGE |
| Ga0183755_100754812 | 3300029448 | Marine | MNENEYVYNKECADCGDMTCAEVCFFYKDETYCEDCCPQGYGE |
| Ga0307488_101682624 | 3300031519 | Sackhole Brine | MEDEYVYSLECNNCGDMTCAEVCFFYKDETYCDNCCPQGYGE |
| Ga0308009_103670692 | 3300031612 | Marine | MEDEYVYSLDCKNCGDKTCAEKSFFHKDETFCDDCCPEGY |
| Ga0302121_101873162 | 3300031626 | Marine | MEEEYVYSLYCKNCGDKTCAEKAFFHNDETFCDDCCPEGYGE |
| Ga0316209_10902833 | 3300032255 | Microbial Mat | IMDQEYVYDRECDDCGAKTCAEVAYFYEDKTFCEDCCPDGYGE |
| Ga0316203_11965643 | 3300032274 | Microbial Mat | YVYDRECDDCGAKTCAEVAYFYEDKTFCEDCCPDGYGE |
| Ga0316202_100420636 | 3300032277 | Microbial Mat | MEDEYVYNKECVDCGDMTCAEVCFFYKDETYCEDCCPDGYGE |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |