| Basic Information | |
|---|---|
| Family ID | F066794 |
| Family Type | Metagenome |
| Number of Sequences | 126 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MNLRCSKCQLVFLVNTFEDVRIIQAMSCPEGAGHKLSEVV |
| Number of Associated Samples | 78 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 71.43 % |
| % of genes near scaffold ends (potentially truncated) | 33.33 % |
| % of genes from short scaffolds (< 2000 bps) | 65.08 % |
| Associated GOLD sequencing projects | 67 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | unclassified viruses (59.524 % of family members) |
| NCBI Taxonomy ID | 12429 |
| Taxonomy | All Organisms → Viruses → unclassified viruses |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater (28.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (84.921 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (86.508 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.24% β-sheet: 17.65% Coil/Unstructured: 69.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF00145 | DNA_methylase | 12.00 |
| PF05869 | Dam | 5.60 |
| PF16778 | Phage_tail_APC | 2.40 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 12.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 70.63 % |
| Unclassified | root | N/A | 29.37 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000101|DelMOSum2010_c10047539 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2174 | Open in IMG/M |
| 3300000101|DelMOSum2010_c10152473 | All Organisms → Viruses → unclassified bacterial viruses → Bacteriophage sp. | 845 | Open in IMG/M |
| 3300000115|DelMOSum2011_c10153103 | Not Available | 682 | Open in IMG/M |
| 3300000116|DelMOSpr2010_c10223711 | All Organisms → Viruses → unclassified bacterial viruses → Bacteriophage sp. | 588 | Open in IMG/M |
| 3300000117|DelMOWin2010_c10013435 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4530 | Open in IMG/M |
| 3300000257|LP_F_10_SI03_100DRAFT_1029483 | Not Available | 898 | Open in IMG/M |
| 3300001450|JGI24006J15134_10001710 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 12415 | Open in IMG/M |
| 3300001450|JGI24006J15134_10009284 | All Organisms → Viruses | 4904 | Open in IMG/M |
| 3300001450|JGI24006J15134_10010316 | All Organisms → Viruses | 4616 | Open in IMG/M |
| 3300001450|JGI24006J15134_10010647 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4528 | Open in IMG/M |
| 3300001450|JGI24006J15134_10077922 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1249 | Open in IMG/M |
| 3300001450|JGI24006J15134_10088176 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1142 | Open in IMG/M |
| 3300001450|JGI24006J15134_10205731 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 596 | Open in IMG/M |
| 3300001450|JGI24006J15134_10206710 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 594 | Open in IMG/M |
| 3300001450|JGI24006J15134_10217408 | Not Available | 570 | Open in IMG/M |
| 3300003586|JGI26261J51718_1012840 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2443 | Open in IMG/M |
| 3300004097|Ga0055584_102385971 | Not Available | 536 | Open in IMG/M |
| 3300004829|Ga0068515_100740 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4218 | Open in IMG/M |
| 3300004829|Ga0068515_100986 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 3699 | Open in IMG/M |
| 3300004829|Ga0068515_104936 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1714 | Open in IMG/M |
| 3300004829|Ga0068515_105788 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1574 | Open in IMG/M |
| 3300004829|Ga0068515_106394 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1497 | Open in IMG/M |
| 3300004951|Ga0068513_1009711 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1013 | Open in IMG/M |
| 3300004951|Ga0068513_1010578 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 972 | Open in IMG/M |
| 3300004951|Ga0068513_1016350 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 790 | Open in IMG/M |
| 3300004951|Ga0068513_1019980 | Not Available | 717 | Open in IMG/M |
| 3300004951|Ga0068513_1033277 | Not Available | 563 | Open in IMG/M |
| 3300004951|Ga0068513_1035780 | Not Available | 544 | Open in IMG/M |
| 3300005600|Ga0070726_10451624 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 648 | Open in IMG/M |
| 3300005601|Ga0070722_10280510 | Not Available | 708 | Open in IMG/M |
| 3300005920|Ga0070725_10301175 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 705 | Open in IMG/M |
| 3300006467|Ga0099972_12831021 | Not Available | 715 | Open in IMG/M |
| 3300006467|Ga0099972_13095085 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1170 | Open in IMG/M |
| 3300006789|Ga0098054_1361892 | Not Available | 513 | Open in IMG/M |
| 3300006789|Ga0098054_1364798 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 510 | Open in IMG/M |
| 3300006803|Ga0075467_10661101 | Not Available | 533 | Open in IMG/M |
| 3300006916|Ga0070750_10070071 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1663 | Open in IMG/M |
| 3300006919|Ga0070746_10047077 | All Organisms → Viruses → Predicted Viral | 2260 | Open in IMG/M |
| 3300006919|Ga0070746_10458175 | Not Available | 565 | Open in IMG/M |
| 3300006920|Ga0070748_1031269 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2184 | Open in IMG/M |
| 3300006921|Ga0098060_1004641 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4835 | Open in IMG/M |
| 3300006921|Ga0098060_1004641 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4835 | Open in IMG/M |
| 3300006929|Ga0098036_1243336 | Not Available | 544 | Open in IMG/M |
| 3300007276|Ga0070747_1280726 | Not Available | 575 | Open in IMG/M |
| 3300007540|Ga0099847_1088530 | Not Available | 949 | Open in IMG/M |
| 3300009418|Ga0114908_1020759 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2572 | Open in IMG/M |
| 3300009420|Ga0114994_10628394 | Not Available | 703 | Open in IMG/M |
| 3300009550|Ga0115013_10016068 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 3958 | Open in IMG/M |
| 3300010392|Ga0118731_106427715 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 523 | Open in IMG/M |
| 3300010392|Ga0118731_111794172 | Not Available | 653 | Open in IMG/M |
| 3300010392|Ga0118731_115489323 | Not Available | 718 | Open in IMG/M |
| 3300010430|Ga0118733_107172435 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 579 | Open in IMG/M |
| 3300010883|Ga0133547_10440106 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2652 | Open in IMG/M |
| 3300010883|Ga0133547_11212644 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1440 | Open in IMG/M |
| 3300013010|Ga0129327_10011339 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4880 | Open in IMG/M |
| 3300017709|Ga0181387_1084230 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 645 | Open in IMG/M |
| 3300017710|Ga0181403_1003827 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 3330 | Open in IMG/M |
| 3300017710|Ga0181403_1009130 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2140 | Open in IMG/M |
| 3300017710|Ga0181403_1114031 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 565 | Open in IMG/M |
| 3300017713|Ga0181391_1116581 | Not Available | 599 | Open in IMG/M |
| 3300017717|Ga0181404_1007105 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 3013 | Open in IMG/M |
| 3300017717|Ga0181404_1016189 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1941 | Open in IMG/M |
| 3300017717|Ga0181404_1034018 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1302 | Open in IMG/M |
| 3300017720|Ga0181383_1002843 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4822 | Open in IMG/M |
| 3300017728|Ga0181419_1080024 | Not Available | 818 | Open in IMG/M |
| 3300017728|Ga0181419_1140829 | Not Available | 581 | Open in IMG/M |
| 3300017731|Ga0181416_1002088 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4971 | Open in IMG/M |
| 3300017731|Ga0181416_1007300 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2633 | Open in IMG/M |
| 3300017732|Ga0181415_1002531 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4699 | Open in IMG/M |
| 3300017732|Ga0181415_1131593 | Not Available | 561 | Open in IMG/M |
| 3300017733|Ga0181426_1052183 | Not Available | 809 | Open in IMG/M |
| 3300017733|Ga0181426_1068741 | Not Available | 705 | Open in IMG/M |
| 3300017738|Ga0181428_1001882 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4848 | Open in IMG/M |
| 3300017738|Ga0181428_1002007 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4713 | Open in IMG/M |
| 3300017738|Ga0181428_1005119 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2988 | Open in IMG/M |
| 3300017743|Ga0181402_1044778 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1204 | Open in IMG/M |
| 3300017745|Ga0181427_1121508 | Not Available | 637 | Open in IMG/M |
| 3300017748|Ga0181393_1173721 | Not Available | 530 | Open in IMG/M |
| 3300017755|Ga0181411_1097512 | Not Available | 870 | Open in IMG/M |
| 3300017760|Ga0181408_1142592 | Not Available | 618 | Open in IMG/M |
| 3300017760|Ga0181408_1157411 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 584 | Open in IMG/M |
| 3300017764|Ga0181385_1010895 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2923 | Open in IMG/M |
| 3300017764|Ga0181385_1060663 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1171 | Open in IMG/M |
| 3300017764|Ga0181385_1160531 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 681 | Open in IMG/M |
| 3300017768|Ga0187220_1005162 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 3986 | Open in IMG/M |
| 3300017769|Ga0187221_1206653 | Not Available | 565 | Open in IMG/M |
| 3300017772|Ga0181430_1010043 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 3273 | Open in IMG/M |
| 3300017776|Ga0181394_1138649 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 760 | Open in IMG/M |
| 3300017782|Ga0181380_1020569 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2461 | Open in IMG/M |
| 3300017782|Ga0181380_1258198 | Not Available | 577 | Open in IMG/M |
| 3300017786|Ga0181424_10007644 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4676 | Open in IMG/M |
| 3300020431|Ga0211554_10031473 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 3057 | Open in IMG/M |
| 3300020431|Ga0211554_10286662 | All Organisms → Viruses → unclassified bacterial viruses → Bacteriophage sp. | 776 | Open in IMG/M |
| 3300020455|Ga0211664_10096890 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1385 | Open in IMG/M |
| 3300020464|Ga0211694_10004952 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4968 | Open in IMG/M |
| 3300020465|Ga0211640_10124897 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1472 | Open in IMG/M |
| 3300021375|Ga0213869_10026096 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 3235 | Open in IMG/M |
| 3300022065|Ga0212024_1002175 | All Organisms → Viruses → Predicted Viral | 2203 | Open in IMG/M |
| 3300022065|Ga0212024_1011332 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1341 | Open in IMG/M |
| 3300022072|Ga0196889_1017200 | All Organisms → Viruses → Predicted Viral | 1528 | Open in IMG/M |
| 3300022164|Ga0212022_1044835 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 685 | Open in IMG/M |
| 3300022178|Ga0196887_1009226 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 3253 | Open in IMG/M |
| (restricted) 3300022888|Ga0233428_1149251 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 808 | Open in IMG/M |
| (restricted) 3300022931|Ga0233433_10439608 | Not Available | 505 | Open in IMG/M |
| 3300024433|Ga0209986_10133987 | Not Available | 1302 | Open in IMG/M |
| (restricted) 3300024518|Ga0255048_10373850 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 690 | Open in IMG/M |
| 3300025137|Ga0209336_10007040 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4781 | Open in IMG/M |
| 3300025137|Ga0209336_10027614 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1940 | Open in IMG/M |
| 3300025137|Ga0209336_10168819 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 563 | Open in IMG/M |
| 3300025138|Ga0209634_1132568 | All Organisms → Viruses → Predicted Viral | 1044 | Open in IMG/M |
| 3300025168|Ga0209337_1015151 | All Organisms → Viruses | 4671 | Open in IMG/M |
| 3300025168|Ga0209337_1015277 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4647 | Open in IMG/M |
| 3300025168|Ga0209337_1025947 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 3323 | Open in IMG/M |
| 3300025168|Ga0209337_1026884 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 3249 | Open in IMG/M |
| 3300025168|Ga0209337_1078507 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1607 | Open in IMG/M |
| 3300025168|Ga0209337_1230070 | Not Available | 727 | Open in IMG/M |
| 3300025543|Ga0208303_1005070 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 4546 | Open in IMG/M |
| 3300025623|Ga0209041_1070334 | Not Available | 1010 | Open in IMG/M |
| 3300025647|Ga0208160_1169960 | Not Available | 514 | Open in IMG/M |
| 3300025887|Ga0208544_10249465 | All Organisms → Viruses → unclassified bacterial viruses → Bacteriophage sp. | 710 | Open in IMG/M |
| 3300027801|Ga0209091_10245268 | Not Available | 872 | Open in IMG/M |
| 3300027859|Ga0209503_10020062 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 2974 | Open in IMG/M |
| (restricted) 3300027996|Ga0233413_10310151 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 679 | Open in IMG/M |
| 3300028920|Ga0272441_11179707 | All Organisms → Viruses → unclassified bacterial viruses → Bacteriophage sp. | 574 | Open in IMG/M |
| 3300031623|Ga0302123_10083495 | All Organisms → Viruses → unclassified viruses → Circular genetic element sp. | 1713 | Open in IMG/M |
| 3300031627|Ga0302118_10438495 | Not Available | 581 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 28.57% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 25.40% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.90% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 4.76% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 3.97% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.97% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.97% |
| Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 3.97% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 3.17% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 3.17% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.59% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 0.79% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 0.79% |
| Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 0.79% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 0.79% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.79% |
| Marine Sediment | Environmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment | 0.79% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000257 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_F_10_SI03_100 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300003586 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI074_LV_135m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004829 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs | Environmental | Open in IMG/M |
| 3300004951 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVs | Environmental | Open in IMG/M |
| 3300005600 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1 | Environmental | Open in IMG/M |
| 3300005601 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1 | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300006467 | Coastal sediment microbial communities from Rhode Island, USA: Combined Assembly of Gp0121717, Gp0123912, Gp0123935 | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300009418 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s17 | Environmental | Open in IMG/M |
| 3300009420 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 | Environmental | Open in IMG/M |
| 3300009550 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
| 3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
| 3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017720 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017732 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11 | Environmental | Open in IMG/M |
| 3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
| 3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017760 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017769 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2) | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300017776 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23 | Environmental | Open in IMG/M |
| 3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
| 3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
| 3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
| 3300020455 | Marine microbial communities from Tara Oceans - TARA_B100000965 (ERX555917-ERR599081) | Environmental | Open in IMG/M |
| 3300020464 | Marine microbial communities from Tara Oceans - TARA_B100000530 (ERX556075-ERR599101) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300021375 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132 | Environmental | Open in IMG/M |
| 3300022065 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022888 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_120_MG | Environmental | Open in IMG/M |
| 3300022931 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MG | Environmental | Open in IMG/M |
| 3300024433 | Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300024518 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2 | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025138 | Marine viral communities from the Pacific Ocean - LP-40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025168 | Marine viral communities from the Pacific Ocean - LP-53 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025623 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_100m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025647 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025887 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027801 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300027859 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028920 | Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-Prop-6N | Environmental | Open in IMG/M |
| 3300031623 | Marine microbial communities from Western Arctic Ocean, Canada - CB21_32.1 | Environmental | Open in IMG/M |
| 3300031627 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_33.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_100475395 | 3300000101 | Marine | MNLRCAKCKTVFLVNTFEDVRIIQAMSCSEGAGHKLSEVA* |
| DelMOSum2010_101524732 | 3300000101 | Marine | MGDEILNLRCAKCQTVFLVNTFEDVKIIQAMSCPGGAGHKLSEVA* |
| DelMOSum2011_101531033 | 3300000115 | Marine | MNLRCSRCKIEFLVNTFEDVRIIQAMSCPEGAGHKLSEVV* |
| DelMOSpr2010_102237113 | 3300000116 | Marine | MGDEILNLRCAKCQTVFLVNTFEDVKIIQAMSCPG |
| DelMOWin2010_100134351 | 3300000117 | Marine | MNLRCCKCKLVFLVNHFDDVRIIQAMSCPEGAGHKLSEVV* |
| LP_F_10_SI03_100DRAFT_10294833 | 3300000257 | Marine | MNLRCCKCKLIFLVNHFDDVRIIQAMSCPEGAGHKLSEVV* |
| JGI24006J15134_1000171025 | 3300001450 | Marine | MNLRCAKCKMVFLVNTFEDVRIIQSMSCPESAGHKLSEVE* |
| JGI24006J15134_100092848 | 3300001450 | Marine | MNLRCAKCQIVFLVNTFEDVRIIQAMSCPEGAGHKLSEVA* |
| JGI24006J15134_1001031611 | 3300001450 | Marine | MNLRCSKCQTVFLVNSFEDVRIIQAMSCSAGAGHKLSEVA* |
| JGI24006J15134_100106478 | 3300001450 | Marine | MNLRCAKCQVDFLVNTFEDVRIIQSMSCPAGAGHKLTEVV* |
| JGI24006J15134_100779224 | 3300001450 | Marine | GGLAMNLRCSKCNTEFLVNTFEDVRIIQAMSCLAGAGHKLNEVV* |
| JGI24006J15134_100881763 | 3300001450 | Marine | MNLRCRKCGSRFLVNTFEDVRIIQALNCEDGGHVLSEML* |
| JGI24006J15134_102057313 | 3300001450 | Marine | GGLAMNLRCSKCNTEFLVNTFEDVRIIQAMSCPEGAGHKLSEVV* |
| JGI24006J15134_102067102 | 3300001450 | Marine | MNLRCSKCQLVFLVNTFEDVRIIQAMSCSAGAGHTLNEVV* |
| JGI24006J15134_102174082 | 3300001450 | Marine | MNIRCCKCKLEFLVNTFEDVKIIQAMSCPEGAGHKLSEVV* |
| JGI26261J51718_10128404 | 3300003586 | Marine | MNLRCCKCKLVFLVNHFDDVRIIQAMFCPEGAGHKLSEVV* |
| Ga0055584_1023859712 | 3300004097 | Pelagic Marine | MNLRCSKCQLVFLVNTFEDVRIIQAMSCPEGAGHKLSEVV* |
| Ga0068515_1007409 | 3300004829 | Marine Water | MNLRCSKCKEVFLVNTFEDVRIIQAMSCSAGAGHKLSEVA* |
| Ga0068515_1009867 | 3300004829 | Marine Water | MNLRCCKCQLEFLVNTFEDVRIIQAMSCPEGAGHKLSEVV* |
| Ga0068515_1049364 | 3300004829 | Marine Water | MNLRCSKCKEVFLVNTFEDVRIIQAMSCSAGAGHKLSEVV* |
| Ga0068515_1057882 | 3300004829 | Marine Water | MNLRCSKCKEVFLVNTFEDVRIIQAMSCSEGAGHKLSEVA* |
| Ga0068515_1063943 | 3300004829 | Marine Water | MNLRCSKCKIVFLVNTFEDVRIIQAMSCPEGAGHKLTEVA* |
| Ga0068513_10097112 | 3300004951 | Marine Water | LNLKCSKCKLVFLVNHFEDVRIIQAMSCPEGAGHKLSEVV* |
| Ga0068513_10105782 | 3300004951 | Marine Water | MNLRCSKCKEVFLVNTFEDVRIIQAMSCSAGAGHKLNEVA* |
| Ga0068513_10163501 | 3300004951 | Marine Water | MNLRCCKCKLEFLVNSYEDVRIIQAMSCPKGAGHKLSEVV* |
| Ga0068513_10199802 | 3300004951 | Marine Water | LNLRCCKCQLEFLVNTFEDVRIIQAMSCPKGAGHKLSEVA* |
| Ga0068513_10332771 | 3300004951 | Marine Water | MNLRCCKCQLEFLVNTFEDVRIIQAMSCPKGAGHKLSEVV* |
| Ga0068513_10357802 | 3300004951 | Marine Water | LNLRCCKCQLEFLVNTFEDVRIIQAMSCPKGAGHKLSEVV |
| Ga0070726_104516243 | 3300005600 | Marine Sediment | MNLRCRNCRAVFLVNSFEDVRIIQAMSCPEGAGHKLSEVA* |
| Ga0070722_102805101 | 3300005601 | Marine Sediment | MNLRCSKCKTEFLVNTFEDVRIIQAMSCSEGAGHKLSE |
| Ga0070725_103011753 | 3300005920 | Marine Sediment | CAKCKTVFLVNTFEDVRIIQAMSCSEGAGHKLSEVA* |
| Ga0099972_128310212 | 3300006467 | Marine | MNLRCCKCKLEFLVNHFDDVRIIQAMSCPEGAGHKLSEVV* |
| Ga0099972_130950853 | 3300006467 | Marine | MNLRCSKCKTEFLVNTFEDVRIIQAMSCSEGAGHKLSEVV* |
| Ga0098054_13618921 | 3300006789 | Marine | MNLRCCKCQLVFLVNTFEDVRIIQAMSCSEGAGHKLSE |
| Ga0098054_13647981 | 3300006789 | Marine | MNLRCSKCQLVFLVNTFEDVRIIQAMSCPEGAGHKLSE |
| Ga0075467_106611012 | 3300006803 | Aqueous | MNLRCCKCRLEFLVNTFEDVRIIQAMSCPEGAGHKLSEVV* |
| Ga0070750_100700713 | 3300006916 | Aqueous | MNLRCSKCQLVFLVNTFEDVRIIQAMSCSEGAGHKLSEVV* |
| Ga0070746_100470775 | 3300006919 | Aqueous | MNLRCCKCQLVFLVNTFEDVRIIQAMSCPKGAGHKLSEVV* |
| Ga0070746_104581751 | 3300006919 | Aqueous | IYMNLRCSKCQLVFLVNTFEDVRIIQAMSCPEGAGHKLSEVV* |
| Ga0070748_10312692 | 3300006920 | Aqueous | MNLRCCKCQLEFLDNTFEDVRIIQAMSCPEGAGHKLSEVV* |
| Ga0098060_10046411 | 3300006921 | Marine | MNLRCCKCKLVFLVNHFDEVRIIQAMSCPEGAGHKLSE |
| Ga0098060_100464112 | 3300006921 | Marine | FRMNLRCCKCKLVFLVNHFDEVRIIQAMSCPEGAGHKLSEVV* |
| Ga0098036_12433362 | 3300006929 | Marine | MNLRCCKCKLVFLVNHFDEVRIIQAMSCPEGAGHKLSEVV* |
| Ga0070747_12807261 | 3300007276 | Aqueous | MNLRCAKCKTVFLVNTFEDVRIIQAMSCSEGAGHKLSE |
| Ga0099847_10885301 | 3300007540 | Aqueous | NLRCCKCQLEFLVNTFEDVRIIQAMSCPEGAGHKLSEVV* |
| Ga0114908_10207595 | 3300009418 | Deep Ocean | MNLRCCKCQLVFLVNTFEDVRIIQAMSCPEGAGHKLSEVV* |
| Ga0114994_106283942 | 3300009420 | Marine | MNLRCAKCKLVFLVNHFDDVRIIQAMHCNEGAGHKLSEVA* |
| Ga0115013_100160684 | 3300009550 | Marine | MNLRCSKCKEVFLVNTFEDVKIIQAMSCSAGAGHKLSEVA* |
| Ga0118731_1064277152 | 3300010392 | Marine | MYVLQTIKEGDVSMNLRCSKCRLVFLVNTFEDVRIIQAMSCPEGAGHKLSEVA* |
| Ga0118731_1117941722 | 3300010392 | Marine | MNLRCCKCKLEFLVNHFDDVRIIQAMSCPEGAGHK |
| Ga0118731_1154893232 | 3300010392 | Marine | MNLRCSKCKIEFLVNTFEDVRIIQAMSCPEGAGHKLSEVV* |
| Ga0118733_1071724352 | 3300010430 | Marine Sediment | MNLRCSKCKLVFLVNTFEDVRIIQAMSCSEGAGHKL |
| Ga0133547_104401063 | 3300010883 | Marine | MNLRCAKCKLVFLVNHFDDVRIVQAMHCNEGAGHKLSEVA* |
| Ga0133547_112126444 | 3300010883 | Marine | MNLQCSKCELIFLVNTFEDVRIIQAMGCPKGAGHKLNGVV* |
| Ga0129327_1001133912 | 3300013010 | Freshwater To Marine Saline Gradient | KCQLVFLVNTFEDVRIIQAMSCPEGAGHKLSEVV* |
| Ga0181387_10842302 | 3300017709 | Seawater | MNLKCCKCQLEFLVNSFEDVRIIQAMSCPEGAGHKLSEVV |
| Ga0181403_10038273 | 3300017710 | Seawater | MNLRCSKCQLVFLVNTFEDVRIIQAMSCLEGAGHKLSEVV |
| Ga0181403_10091304 | 3300017710 | Seawater | MNLRCCKCQLEFLVNTFEDVRIIQAMSCPEGAGHKLNEVV |
| Ga0181403_11140311 | 3300017710 | Seawater | MNLRCSKCGLVFLVNTFEDVRIIQAMSCPEGAGHKLSEVA |
| Ga0181391_11165812 | 3300017713 | Seawater | MNLRCCKCKLEFLVNHFDDVRIIQAMSCSEGAGHKLSEVV |
| Ga0181404_10071053 | 3300017717 | Seawater | MNLRCCKCKLEFLVNHFDDVRIIQAMSCPEGAGHKLSEVA |
| Ga0181404_10161891 | 3300017717 | Seawater | MNLRCSKCQLVFLVNTFEDVRIIQAMSCPEGAGHKLS |
| Ga0181404_10340183 | 3300017717 | Seawater | MNLRCSKCKLVFLVNHFDDVRIIQAMSCPEGAGHKLSEVV |
| Ga0181383_10028434 | 3300017720 | Seawater | MNLKCSKCQLVFLVNTFEDVRIIQAMSCPEGAGHKLSEVA |
| Ga0181419_10800243 | 3300017728 | Seawater | VYLGGRRMNLRCSKCQLVFLVNTFEDVRIIQAMSCLEGAGHKLSEVV |
| Ga0181419_11408292 | 3300017728 | Seawater | MGDEVVNLRCSKCQLVFLVNTFEDVRIIQAMTCPAGAGHTLNEVA |
| Ga0181416_100208814 | 3300017731 | Seawater | MNLRCSKCQLVFLVNTFEDVRIIQAMSCSKGAGHKLSEVV |
| Ga0181416_10073003 | 3300017731 | Seawater | MNLRCAKCQTVFLVNTFEDVRIIQAMSCSEGAGHKLSEVA |
| Ga0181415_10025317 | 3300017732 | Seawater | MNLRCRKCGSRFLVNTFEDVRIIQALNCEDGGHVLSEMV |
| Ga0181415_11315931 | 3300017732 | Seawater | VVLMNLRCSKCQLVFLVNTFEDVRIIQAMSCPEGAGHKLSEVV |
| Ga0181426_10521833 | 3300017733 | Seawater | GGRRMNLRCSKCQLVFLVNTFEDVRIIQAMSCLEGAGHKLSEVV |
| Ga0181426_10687412 | 3300017733 | Seawater | MNLRCAKCKKVFLVNTFEDVRIIQAMSCENGAGHKLSEVA |
| Ga0181428_100188215 | 3300017738 | Seawater | LHRLYGRIKMGDEVVNLRCSKCQLVFLVNTFEDVRIIQAMSCSGGAGHNLNEVV |
| Ga0181428_10020071 | 3300017738 | Seawater | RFYLWELLGGYSMNLRCSKCGLVFLVNTFEDVRIIQAMSCPEGAGHKLSEVA |
| Ga0181428_10051194 | 3300017738 | Seawater | MNLRCSKCQLVFLVNTFEDVRIIQAMSCSEGAGHKLNEVV |
| Ga0181402_10447785 | 3300017743 | Seawater | EGLCMNLKWCRCQREFLVNSFEDVRIIQAMSCPEGAGHKLSEVV |
| Ga0181427_11215081 | 3300017745 | Seawater | NLRCSKCQLVFLVNTFEDVRIIQAMSCPEGAGHKLSEVV |
| Ga0181393_11737211 | 3300017748 | Seawater | QYQNSGVEFRMNLRCCKCKLVFLVNHFDDVRIIQAMSCPEGAGHKLSEVV |
| Ga0181411_10975122 | 3300017755 | Seawater | MNLRCFKCQLVFLVNTFEDVRIIQAMSCLEGAGHKLSEVV |
| Ga0181408_11425921 | 3300017760 | Seawater | NNEKRRGSNFSGGLCMNLRCSKCQLVFLVNTFEDVRIIQAMSCPEGAGHKLSEVV |
| Ga0181408_11574112 | 3300017760 | Seawater | MNLKCCKCQLEFLVNSFEDVRIIQAMSCPEGAGHKF |
| Ga0181385_10108952 | 3300017764 | Seawater | MNLKCCKCQLEFLVNSFEDVRIIQAMSCPEGAGHKLSEVA |
| Ga0181385_10606631 | 3300017764 | Seawater | EGLCMNLKCCKCQLEFLVNSFEDVRIIQAMSCPEGAGHKLSEVV |
| Ga0181385_11605312 | 3300017764 | Seawater | MNLRCSKCQLVFLVNTFEDVRIIQAMSCLEGAGHKLNEVV |
| Ga0187220_10051621 | 3300017768 | Seawater | MNLRCCKCKLEFLVNHFDDVRIIQAMSCSEGAGHKLSEV |
| Ga0187221_12066531 | 3300017769 | Seawater | RMNLRCCKCKLVFLVNHFDDVRIIQAMSCPEGAGHKLSEVV |
| Ga0181430_10100437 | 3300017772 | Seawater | MNLRCSKCKIVFLVNTFEDVRIIQAMTCSEGAGHTLNEVA |
| Ga0181394_11386491 | 3300017776 | Seawater | EKRRGTIFVEGLCMNLKCCKCQLEFLVNSFEDVRIIQAMSCPEGAGHKLSEVV |
| Ga0181380_10205696 | 3300017782 | Seawater | MNLKCCKCQLEFLVNSFEDVRIIQAMSCPEGAGHKL |
| Ga0181380_12581982 | 3300017782 | Seawater | MPKPKPERGGRRMNLKCSKCQLVFLVNTFEDVRIIQAMSCPEGAGHKLSEVA |
| Ga0181424_100076441 | 3300017786 | Seawater | AKCQTVFLVNTFEDVRIIQAMSCSEGAGHKLSEVA |
| Ga0211554_100314736 | 3300020431 | Marine | MNLRCSKCKLVFLVNTFEDVRIIQAMSCSEGAGHKLSDVA |
| Ga0211554_102866622 | 3300020431 | Marine | MGDEILNLRCAKCQTVFLVNTFEDVKIIQAMSCPGGAGHKLSEVA |
| Ga0211664_100968904 | 3300020455 | Marine | MNLRCSKCQLVFLVNTFEDVRIIQAMSCSEGAGHKLSEVA |
| Ga0211694_100049526 | 3300020464 | Marine | MNLRCSKCQLVFLVNTFEDVRIIQAMSCPEGAGHKLSEVV |
| Ga0211640_101248971 | 3300020465 | Marine | MNLRCTKCKEVFLVNTFEDVRIIQAMSCSEGAGHKLSEVA |
| Ga0213869_100260962 | 3300021375 | Seawater | MNLRCCKCKLVFLVNHFDDVRIIQAMSCPEGAGHKLSEVV |
| Ga0212024_10021755 | 3300022065 | Aqueous | CCKCQLEFLVNTFEDVRIIQAMSCPEGAGHKLSEVV |
| Ga0212024_10113323 | 3300022065 | Aqueous | MNLRCSKCQLVFLVNTFEDVRIIQAMSCSEGAGHKLSEVV |
| Ga0196889_10172001 | 3300022072 | Aqueous | MNLRCCKCQLEFLVNTFEDVRIIQAMSCPEGAGHKLSEVV |
| Ga0212022_10448351 | 3300022164 | Aqueous | KMNLRCRNCRAVFLVNSFEDVRIIQAMSCPEGAGHKLSEVA |
| Ga0196887_10092263 | 3300022178 | Aqueous | MNLRCRNCRAVFLVNSFEDVRIIQAMSCPEGAGHKLSEVA |
| (restricted) Ga0233428_11492511 | 3300022888 | Seawater | VLMNLRCCKCKLVFLVNHFDDVRIIQAMSCPEGAGHKLSEVV |
| (restricted) Ga0233433_104396083 | 3300022931 | Seawater | MNLRCCKCKLVFLVNHFDDVRIIQAMSCPEGAGHKLS |
| Ga0209986_101339872 | 3300024433 | Deep Subsurface | MNLRCAKCKTVFLVNTFEDVRIIQAMSCSEGAGHKLSEVA |
| (restricted) Ga0255048_103738502 | 3300024518 | Seawater | MNLRCCKCKLVFLVNHFDEVRIIQAMSCPEGAGHKLSEVV |
| Ga0209336_100070408 | 3300025137 | Marine | MNLRCAKCKMVFLVNTFEDVRIIQSMSCPESAGHKLSEVE |
| Ga0209336_100276142 | 3300025137 | Marine | MNLRCAKCQVDFLVNTFEDVRIIQSMSCPAGAGHKLTEVV |
| Ga0209336_101688191 | 3300025137 | Marine | IMNLRCAKCQIVFLVNTFEDVRIIQAMSCPEGAGHKLSEVA |
| Ga0209634_11325683 | 3300025138 | Marine | MNLRCAKCKMVFLVNTFEDVRIIQSMSCPESAGHKLSEVA |
| Ga0209337_10151518 | 3300025168 | Marine | MNLRCSKCQTVFLVNSFEDVRIIQAMSCSAGAGHKLSEVA |
| Ga0209337_10152778 | 3300025168 | Marine | MNLRCSKCNTEFLVNTFEDVRIIQAMSCLAGAGHKLNEVV |
| Ga0209337_10259474 | 3300025168 | Marine | MNLRCAKCQIVFLVNTFEDVRIIQAMSCPEGAGHKLSEVA |
| Ga0209337_10268845 | 3300025168 | Marine | MNLRCAKCKLAFLVNTFEDVRIIQAMSCPEGAGHKLSEVV |
| Ga0209337_10785072 | 3300025168 | Marine | MNIRCCKCKLEFLVNTFEDVKIIQAMSCPEGAGHKLSEVV |
| Ga0209337_12300702 | 3300025168 | Marine | MNLRCAKCKLVFLVNHFDDVRIIQAMHCNEGAGHKLSEVA |
| Ga0208303_10050705 | 3300025543 | Aqueous | MNLRCCKCQLVFLVNTFEDVRIIQAMSCPEGAGHKLSEVV |
| Ga0209041_10703342 | 3300025623 | Marine | MNLRCCKCKLIFLVNHFDDVRIIQAMSCPDGAGHKLSEVV |
| Ga0208160_11699603 | 3300025647 | Aqueous | NVYLGRGIRMNLRCCKCQLVFLVNTFEDVRIIQAMSCPEGAGHKLNEVV |
| Ga0208544_102494653 | 3300025887 | Aqueous | MGDEILNLRCAKCQTVFLVNTFEDVKIIQAMSCPGGAGH |
| Ga0209091_102452683 | 3300027801 | Marine | MNLRCAKCKLVFLVNHFDDVRIVQAMHCNEGAGHKLSEVA |
| Ga0209503_100200624 | 3300027859 | Marine | MNLRCSKCKEVFLVNTFEDVKIIQAMSCSAGAGHKLSEVA |
| (restricted) Ga0233413_103101512 | 3300027996 | Seawater | MNLRCCKCKLVFLVNHFDDVRIIQAMSCPEGAGHKL |
| Ga0272441_111797073 | 3300028920 | Marine Sediment | MGDEILNLRCAKCQTVFLVNTFEDVKIIQAMSCPGGAGHKLSEV |
| Ga0302123_100834955 | 3300031623 | Marine | MNLQCSKCELIFLVNTFEDVRIIQAMGCPKGAGHKLNGVV |
| Ga0302118_104384952 | 3300031627 | Marine | MNLQCSKCELIFLVNTFEDVRIIQAMGCPKGAGHK |
| ⦗Top⦘ |