NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F066754

Metagenome / Metatranscriptome Family F066754

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066754
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 42 residues
Representative Sequence LWYYAFDWAGPDVPQVMEVLCTKEKDGEPGRVVEITLAAPSL
Number of Associated Samples 114
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.97 %
% of genes near scaffold ends (potentially truncated) 85.71 %
% of genes from short scaffolds (< 2000 bps) 88.10 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.873 % of family members)
Environment Ontology (ENVO) Unclassified
(27.778 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(58.730 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 40.00%    Coil/Unstructured: 60.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF00664ABC_membrane 19.84
PF06127Mpo1-like 0.79
PF01661Macro 0.79
PF13662Toprim_4 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 126 Family Scaffolds
COG2110O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domainTranslation, ribosomal structure and biogenesis [J] 0.79
COG45392-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids)Lipid transport and metabolism [I] 0.79

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000955|JGI1027J12803_100086595All Organisms → cellular organisms → Bacteria2902Open in IMG/M
3300002917|JGI25616J43925_10103600All Organisms → cellular organisms → Bacteria1172Open in IMG/M
3300004268|Ga0066398_10027086All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1018Open in IMG/M
3300004268|Ga0066398_10165358All Organisms → cellular organisms → Bacteria → Acidobacteria564Open in IMG/M
3300005332|Ga0066388_104906699All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300005356|Ga0070674_101818275All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium553Open in IMG/M
3300005440|Ga0070705_101532651All Organisms → cellular organisms → Bacteria → Acidobacteria559Open in IMG/M
3300005445|Ga0070708_100122532All Organisms → cellular organisms → Bacteria2400Open in IMG/M
3300005467|Ga0070706_100951876All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300005536|Ga0070697_100745033All Organisms → cellular organisms → Bacteria866Open in IMG/M
3300005536|Ga0070697_101015331All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300005541|Ga0070733_10037610All Organisms → cellular organisms → Bacteria3018Open in IMG/M
3300005764|Ga0066903_100676666All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1812Open in IMG/M
3300005764|Ga0066903_109116606All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium502Open in IMG/M
3300005944|Ga0066788_10042590All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1057Open in IMG/M
3300006579|Ga0074054_10070924All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300006903|Ga0075426_11382255All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300006904|Ga0075424_100836822All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300009012|Ga0066710_101146740All Organisms → cellular organisms → Bacteria1203Open in IMG/M
3300009088|Ga0099830_11583734All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300009137|Ga0066709_101911488All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300009176|Ga0105242_10842774All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300009644|Ga0116121_1224136All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium600Open in IMG/M
3300009839|Ga0116223_10799123All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium540Open in IMG/M
3300010046|Ga0126384_11954595All Organisms → cellular organisms → Bacteria → Acidobacteria560Open in IMG/M
3300010339|Ga0074046_10482828All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium741Open in IMG/M
3300010343|Ga0074044_10073880All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2307Open in IMG/M
3300010343|Ga0074044_10633821All Organisms → cellular organisms → Bacteria → Acidobacteria698Open in IMG/M
3300010360|Ga0126372_10473019All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1168Open in IMG/M
3300010360|Ga0126372_10562024All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300010361|Ga0126378_10221010All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1978Open in IMG/M
3300010366|Ga0126379_10282670All Organisms → cellular organisms → Bacteria1654Open in IMG/M
3300010375|Ga0105239_12266598All Organisms → cellular organisms → Bacteria → Acidobacteria632Open in IMG/M
3300010376|Ga0126381_104156970All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium562Open in IMG/M
3300010398|Ga0126383_11651363All Organisms → cellular organisms → Bacteria → Acidobacteria730Open in IMG/M
3300010399|Ga0134127_13594144All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium508Open in IMG/M
3300011270|Ga0137391_10404601All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300012203|Ga0137399_10095396All Organisms → cellular organisms → Bacteria2289Open in IMG/M
3300012356|Ga0137371_10347020All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300012361|Ga0137360_11664686All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300012582|Ga0137358_10432152All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300012923|Ga0137359_10009693All Organisms → cellular organisms → Bacteria7996Open in IMG/M
3300012924|Ga0137413_10289480All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300012929|Ga0137404_11389427All Organisms → cellular organisms → Bacteria → Acidobacteria648Open in IMG/M
3300012929|Ga0137404_11598246All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium604Open in IMG/M
3300012971|Ga0126369_12353808All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300012984|Ga0164309_10858900All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium736Open in IMG/M
3300014157|Ga0134078_10669026All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium505Open in IMG/M
3300014165|Ga0181523_10001599All Organisms → cellular organisms → Bacteria23846Open in IMG/M
3300014200|Ga0181526_10055987All Organisms → cellular organisms → Bacteria2514Open in IMG/M
3300014658|Ga0181519_10452195All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium792Open in IMG/M
3300015264|Ga0137403_10461365All Organisms → cellular organisms → Bacteria1145Open in IMG/M
3300016270|Ga0182036_11306735All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300016319|Ga0182033_10789777All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300016319|Ga0182033_11201927All Organisms → cellular organisms → Bacteria → Acidobacteria679Open in IMG/M
3300016422|Ga0182039_10151492All Organisms → cellular organisms → Bacteria1796Open in IMG/M
3300016445|Ga0182038_11841755All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium546Open in IMG/M
3300017933|Ga0187801_10328140All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium626Open in IMG/M
3300018024|Ga0187881_10038705All Organisms → cellular organisms → Bacteria2401Open in IMG/M
3300018038|Ga0187855_10336783All Organisms → cellular organisms → Bacteria881Open in IMG/M
3300018060|Ga0187765_10071088All Organisms → cellular organisms → Bacteria1838Open in IMG/M
3300018062|Ga0187784_11384408All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300018090|Ga0187770_11627835All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300019278|Ga0187800_1296621All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300019360|Ga0187894_10233762All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300019788|Ga0182028_1367431All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1849Open in IMG/M
3300020021|Ga0193726_1282746All Organisms → cellular organisms → Bacteria → Acidobacteria654Open in IMG/M
3300020199|Ga0179592_10151699All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300020580|Ga0210403_11094547All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300020583|Ga0210401_11508612All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300021086|Ga0179596_10044136All Organisms → cellular organisms → Bacteria1812Open in IMG/M
3300021088|Ga0210404_10885480All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
3300021168|Ga0210406_10523637All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium935Open in IMG/M
3300021178|Ga0210408_10238120All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1449Open in IMG/M
3300021180|Ga0210396_10024678All Organisms → cellular organisms → Bacteria5565Open in IMG/M
3300021180|Ga0210396_10197293All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1799Open in IMG/M
3300021405|Ga0210387_10492050All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1090Open in IMG/M
3300021405|Ga0210387_10525606All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300021432|Ga0210384_10156097All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2048Open in IMG/M
3300021432|Ga0210384_11569189All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium564Open in IMG/M
3300021474|Ga0210390_10332771All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1286Open in IMG/M
3300021479|Ga0210410_11266838All Organisms → cellular organisms → Bacteria → Acidobacteria629Open in IMG/M
3300022533|Ga0242662_10086631All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium873Open in IMG/M
3300025474|Ga0208479_1095751All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300025934|Ga0207686_10920141All Organisms → cellular organisms → Bacteria → Acidobacteria706Open in IMG/M
3300026309|Ga0209055_1237801All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300026322|Ga0209687_1181654All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300026489|Ga0257160_1070206All Organisms → cellular organisms → Bacteria → Acidobacteria618Open in IMG/M
3300026555|Ga0179593_1025142All Organisms → cellular organisms → Bacteria1802Open in IMG/M
3300027654|Ga0209799_1054203All Organisms → cellular organisms → Bacteria897Open in IMG/M
3300027701|Ga0209447_10165786All Organisms → cellular organisms → Bacteria → Acidobacteria607Open in IMG/M
3300027795|Ga0209139_10187570All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300027812|Ga0209656_10447683All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium572Open in IMG/M
3300028746|Ga0302233_10116791All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1044Open in IMG/M
3300028747|Ga0302219_10125362All Organisms → cellular organisms → Bacteria978Open in IMG/M
3300028801|Ga0302226_10268334All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300028863|Ga0302218_10293151All Organisms → cellular organisms → Bacteria → Acidobacteria527Open in IMG/M
3300030618|Ga0311354_11012360All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300030659|Ga0316363_10356858All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium575Open in IMG/M
3300031231|Ga0170824_108425869All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300031236|Ga0302324_103344660All Organisms → cellular organisms → Bacteria → Acidobacteria524Open in IMG/M
3300031561|Ga0318528_10292939All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300031718|Ga0307474_10131221All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1884Open in IMG/M
3300031720|Ga0307469_10233151All Organisms → cellular organisms → Bacteria1466Open in IMG/M
3300031740|Ga0307468_101427573All Organisms → cellular organisms → Bacteria → Acidobacteria637Open in IMG/M
3300031747|Ga0318502_10501372All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300031754|Ga0307475_11014455All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300031835|Ga0318517_10159984All Organisms → cellular organisms → Bacteria → Acidobacteria1009Open in IMG/M
3300031879|Ga0306919_11203675All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300031890|Ga0306925_12066866All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300031910|Ga0306923_10979072All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300031912|Ga0306921_12392872All Organisms → cellular organisms → Bacteria → Acidobacteria551Open in IMG/M
3300031941|Ga0310912_10683620All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300031962|Ga0307479_11492205All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300032001|Ga0306922_10022304All Organisms → cellular organisms → Bacteria6343Open in IMG/M
3300032001|Ga0306922_10175918All Organisms → cellular organisms → Bacteria2294Open in IMG/M
3300032066|Ga0318514_10253126All Organisms → cellular organisms → Bacteria927Open in IMG/M
3300032160|Ga0311301_10519923All Organisms → cellular organisms → Bacteria1755Open in IMG/M
3300032160|Ga0311301_13005310All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300032174|Ga0307470_10325070All Organisms → cellular organisms → Bacteria1055Open in IMG/M
3300032180|Ga0307471_104168805All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300032205|Ga0307472_102703236All Organisms → cellular organisms → Bacteria → Acidobacteria507Open in IMG/M
3300032261|Ga0306920_100245226All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2673Open in IMG/M
3300032954|Ga0335083_11528567All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium506Open in IMG/M
3300033134|Ga0335073_10312266All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1881Open in IMG/M
3300033755|Ga0371489_0038321All Organisms → cellular organisms → Bacteria3392Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.87%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.11%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.52%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.35%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil6.35%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.76%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.76%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.97%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.17%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.38%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.38%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.38%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.38%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.38%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.59%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.59%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.59%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.79%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.79%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.79%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.79%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.79%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.79%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.79%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.79%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.79%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.79%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil0.79%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004268Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBioEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005944Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300019278Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300022533Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025474Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes)EnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300026555Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300027654Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027701Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027795Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300028746Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028801Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI1027J12803_10008659533300000955SoilYYAFDWAGPDVPQVMEVVCTVGKDGEPGRVVEITLAASSL*
JGI25616J43925_1010360023300002917Grasslands SoilLWYYGFDWAGPDVPQVTELLRTTEKDGKPGRVVEITLAAASL*
Ga0066398_1002708623300004268Tropical Forest SoilGQQLELLYYAFDWAGPDVPQVMEVVCTVGESGKPGRVVEITLAASSL*
Ga0066398_1016535813300004268Tropical Forest SoilELWYYAFDWAGADVPQVMEVLCTREADGKAGRVMEITLAAPSL*
Ga0066388_10490669913300005332Tropical Forest SoilDGQRLELLYYAFDWAGPDVPQVMQVLCTVKQDGTPGKVVEITLAASSL*
Ga0070674_10181827513300005356Miscanthus RhizosphereGQQLELLYYAFDWAGPDVPQVMEVVCTAEIDGAPGRVVEIMLAASSL*
Ga0070705_10153265123300005440Corn, Switchgrass And Miscanthus RhizosphereYAFDWAGPDVPQVMEVVCTVGKDGEPGRVVEITLAASSL*
Ga0070708_10012253233300005445Corn, Switchgrass And Miscanthus RhizosphereGQRLELLYYAFDWAGPDVPQVMEVLCTAEKDGEPGRVVEITLAAASL*
Ga0070706_10095187623300005467Corn, Switchgrass And Miscanthus RhizosphereYAFDWAGPDVPQVMEVLCTAEKDGEPGRVVEITLAAASL*
Ga0070697_10074503313300005536Corn, Switchgrass And Miscanthus RhizosphereYYAFDWAGPDVPQVMEVLCTAEKDGKPGRVVEITLAASSL*
Ga0070697_10101533123300005536Corn, Switchgrass And Miscanthus RhizosphereGQRLELLYYAFDWAGPDVPQVMEVLCTAEKDGAPGRVVEITLAAASL*
Ga0070733_1003761033300005541Surface SoilLYYAFDWAGPDVPQVMAVLCTPGSGAKPGRVIDITLMAPSL*
Ga0066903_10067666633300005764Tropical Forest SoilLLYYAFDWTGPDTPQVMEVVCTVGENGEPGRVVEITLAASSL*
Ga0066903_10911660623300005764Tropical Forest SoilYYAFDWAGPDVPQVMEVLCSKAAEGKPGQVMEITLAAPSL*
Ga0066788_1004259013300005944SoilLELLYYAFDWAGPDVPQVMAVLCTPEKNAKPGRVVEITLAAPSL*
Ga0074054_1007092423300006579SoilRLELLYYAFDWAGSEVPQVMEVLCTVEHDGKPGRVIEITLAASSL*
Ga0075426_1138225513300006903Populus RhizosphereYYAFDWAGPDVPQVMEVVCTVGQDGQPERVVEITLAASSL*
Ga0075424_10083682233300006904Populus RhizosphereKGGQRLELLYYAFDWAGPDVPQVMEVACTVGKDGEPGRVVEITLAASSL*
Ga0066710_10114674013300009012Grasslands SoilDWAGPDVPQVMEVLCTAEKDGEPGRVVEITLAAASL
Ga0099830_1158373423300009088Vadose Zone SoilGQRLELWYYAFGWAGPDVPQVMEVLCTLEKDGEPGRVVEVRLAAASL*
Ga0066709_10191148813300009137Grasslands SoilTKDGQRLELLYYAFDWAGPDVPQVMEVLCTAEKDGEPGRVVEITLAAASL*
Ga0105242_1084277413300009176Miscanthus RhizosphereAFDWAGPDVPQVMEVVCTVETDGAPGRVVEITLAASSL*
Ga0116121_122413613300009644PeatlandLWYYAFDWAGADVPQVMEVLCTKEQDGQPGRVVEITLAAPS
Ga0116223_1079912313300009839Peatlands SoilKDGQPLELWYYAFDWAGPDVPQVMEVLCTKEKDGEPGRVVEITLAAPSL*
Ga0126384_1195459513300010046Tropical Forest SoilLLYYAFDWAGPDVPQVMEVLCTVAEDGKPGRVVEITLAASSL*
Ga0074046_1048282823300010339Bog Forest SoilLWYYAFDWAGPDVPQVMEVLCTREKDGQPGRVVEITLAAPSL*
Ga0074044_1007388033300010343Bog Forest SoilYYAFDWAGPDVPQVMEVLCSKEKDGPPGRVLEITLAAPSL*
Ga0074044_1063382123300010343Bog Forest SoilLWYYAFDWAGPDVPQVMEVLCTKEKDGEPGRVVEITLAAPSL*
Ga0126372_1047301933300010360Tropical Forest SoilYAFDWAGPDVPQVMEVLCTREKAGQPGRVIEITLAAPSL*
Ga0126372_1056202433300010360Tropical Forest SoilFDWAGPDVPQLMEVLCTVEKDGKPGRVVEITLAVSSL*
Ga0126378_1022101013300010361Tropical Forest SoilLWYYAFDWAGPDVPQVMEVVCTREKDGQVGQVVEITLAAPSL*
Ga0126379_1028267033300010366Tropical Forest SoilLLYYAFDWAGPDVPQVMEVVCTVGKDGEPGRVVEITLAASSL*
Ga0105239_1226659823300010375Corn RhizosphereKGGQRLELLYYAFDWAGPDVPQVMEVVCTVGKDGEPGRVVEITLAASSL*
Ga0126381_10415697023300010376Tropical Forest SoilDWAGPDVPQVLEVVVTVGKDGEPGRVVEITLAASSL*
Ga0126383_1165136313300010398Tropical Forest SoilQPLELWYYAFDWAGPDVPQVMEVLCTREQDGKPGRVVEITLAAPSL*
Ga0134127_1359414423300010399Terrestrial SoilYYAFDWAGPDVPQVMTVLCTPGQEGNAGRVVEITLAAPSL*
Ga0137391_1040460133300011270Vadose Zone SoilYAFDWAGPDVPQMMEVLCTVEKDGKPGRVIEITLSASSL*
Ga0137399_1009539633300012203Vadose Zone SoilLWYYAFGWAGPDVPQVMEALCTLEKDGEPGRVVEIGLAAASL*
Ga0137371_1034702033300012356Vadose Zone SoilWAGPDVPQVMEVLCTAEKDGEPGRVVEITLAAASL*
Ga0137360_1166468623300012361Vadose Zone SoilLYYAFDWAGPDVPQGMAVLCTVEKDGIPGRVVEITLAASSL*
Ga0137358_1043215223300012582Vadose Zone SoilLELLYYAFDWAGPDVPQLMEVLCTVEKGGKPGRVVEITLAVSSL*
Ga0137359_1000969333300012923Vadose Zone SoilLWYYAFGWAGPNVAQVMEVLCTLEKDGEPGRAVEIRLAAASL*
Ga0137413_1028948013300012924Vadose Zone SoilQQRLELLYYAFDWAGPDGPQMMEGRCTVEKDGKPGRVIEITLSASSL*
Ga0137404_1138942723300012929Vadose Zone SoilLYYAFDWAGPDVPQVMEVLCTAEKDGEPGRVVEITLAAASL*
Ga0137404_1159824623300012929Vadose Zone SoilRLELLYYAFDWAGPDVPQVMEVLCTAEKDGEPGRVVEITLAAASL*
Ga0126369_1235380823300012971Tropical Forest SoilMYYAFDWAGADVPQVMEVLCTKAADGKPGRVMEITLAAPSL*
Ga0164309_1085890013300012984SoilLLYYAFDWAGSDVPQVMEVVCTVEKDGEPGRVVEITLAASSL*
Ga0134078_1066902623300014157Grasslands SoilGQRLELLYYAFDWAGPDVPQVMEVLCTVGTDGKPGRVLEITLAASSL*
Ga0181523_10001599223300014165BogWAGADVPQVMEVLCTKEQDGRPGRVVEITLAAPSL*
Ga0181526_1005598733300014200BogMYYAFDWAGPEVPQVMEVLCSKEKDGQPGRVVEITLAAPSL*
Ga0181519_1045219513300014658BogMYYAFDWAGPDVPQVMEVLCTKEKNGQAGRVVEITLAAPSL*
Ga0137403_1046136523300015264Vadose Zone SoilLWYHAFGWAGPDVPQVMEVFCALEKDGEPGRVVEIRLAAASL*
Ga0182036_1130673523300016270SoilLELLYYAFDWAGPDVPQVMQVACTAEKDGRAARVVEITLAASSL
Ga0182033_1078977713300016319SoilPLELMYYAFDWAGADVPQVMEVLCTKAVDGKPGRVMEITLAAPSL
Ga0182033_1120192713300016319SoilELMYYAFDWAGADVPQVMEVLCTKAAEGKPGRVMEITLAAPSL
Ga0182039_1015149233300016422SoilMYYAFDWAGPDVPQVMEVLCTKAADGKPGRVMEITLAAPSL
Ga0182038_1184175513300016445SoilQPLELWYYAFDWAGPDVPQVMEVLCTREQDGKPGRVIEITLAAPSL
Ga0187801_1032814013300017933Freshwater SedimentDWAGPDVPQVMEVLCTREKDGQPGRVVEITLAAPSL
Ga0187881_1003870533300018024PeatlandWAGPDVPQVMEVLCTKEKEGQPGRVVEITLAAPSL
Ga0187855_1033678323300018038PeatlandGQPLELWYYAFDWAGADVPQVMEVLCTKEHDGQPGRVVEITLAAPSL
Ga0187765_1007108833300018060Tropical PeatlandELWYYAFDWAGPDVPQVMEVLCTREQDGKPGRVVEITLAAPSL
Ga0187784_1138440813300018062Tropical PeatlandQPLELWYYAFDWAGPDVPQVMEVLCTREKEGQPGTVVEITLAAPSL
Ga0187770_1162783523300018090Tropical PeatlandQPLELWYYAFDWAGPNVPQVMEVPCTMEKDGQPGYGVQITLATRSL
Ga0187800_129662133300019278PeatlandWAGPDVPQVMEVLCTTEKEGQPGRVIEITLAAARL
Ga0187894_1023376213300019360Microbial Mat On RocksQELELLYYQFDWAGPDVPQVMEVLCTPEKDGKPGRVVKIMLAAPSL
Ga0182028_136743133300019788FenLWYYAFDWAGPDVPQVMEVLCTKEKDGQPGRVVEITLAAPSL
Ga0193726_128274613300020021SoilLYYAFDWAGPDVPQVMAVLCTPGKNAKPGRVVEITLMAPSL
Ga0179592_1015169923300020199Vadose Zone SoilLLYYAFDWAGPDVPQLMEVLCTVEKDGKPGRVVEITLAVSSL
Ga0210403_1109454723300020580SoilSEDGQQLELWYYAFDWAGPDVPQVMEVLCAVGQDGKPGRVVEITLAAPSL
Ga0210401_1150861223300020583SoilYAFDWAGADVPQVMEVLCTREADGKPGRVVEITLAGPSL
Ga0179596_1004413633300021086Vadose Zone SoilELLYYAFDWAGPDVPQMMEVLCTVEKDGKPGRVIEITLSASSL
Ga0210404_1088548013300021088SoilGQPLELLYYAFDWAGSDVPQVMQAVCTPEKDGQPGQVVEITLAASSL
Ga0210406_1052363713300021168SoilYAFDWAGPDVPQVMQVVCTPEQGGQAGRVVEITLAASSL
Ga0210408_1023812033300021178SoilYAFDWAGPDVPQVMQVVCTPEQDDRAGRVVEITLAASSL
Ga0210396_1002467863300021180SoilVVLRVRLAGADVPQVIELLCTREARGKPGRVVEITLAGPSL
Ga0210396_1019729333300021180SoilKDGQPLELWYYAFDWAGPDVPQVMEVVCTREKEGQPGRVVEITLAAPSL
Ga0210387_1049205033300021405SoilQLELLYYAFDWAGPDVPQVMEVLCTLQKDGKPGSVVEITLAAPSL
Ga0210387_1052560633300021405SoilELLYYAFDWAGTAVPQVMEVLCTVVRDGKPGRVVEITLAAPSL
Ga0210384_1015609733300021432SoilAFDWAGPDVPQVMEVVCTREKDGQVGRVVEITLAAPSL
Ga0210384_1156918913300021432SoilYAFDWAGPDVPQVMEVLCTAEEVGKPGRVVEITLAAPSL
Ga0210390_1033277123300021474SoilVVLRVRLAGADVPQVMELLCTREARGKPGRVVEITLAGPSL
Ga0210410_1126683823300021479SoilLLYYAFDWAGADVPQVMEVLCTVPQDGKPGRVVEITLAAPSL
Ga0242662_1008663133300022533SoilWAGADVPQVMEVLCTQETEGKPGRVVEITLAGPSL
Ga0208479_109575113300025474Arctic Peat SoilQQLELWYYAFDWAGADVPQVMEVLCTKEKDRVPGRVIEITLAAPSL
Ga0207686_1092014113300025934Miscanthus RhizosphereLSYYAFDWAGPDVPQVMTVLCTPGQEGNAGRVVEITLAAPSL
Ga0209055_123780113300026309SoilDWAGPDVPQVMEVLCTAEKEGEPGRVVEITLAAASL
Ga0209687_118165423300026322SoilGRVWSGPQVMEVLCTVGTDGKPSRLHEITLAASSL
Ga0257160_107020623300026489SoilAFDWAGPDVPQLMEVLCTVEKGGKPGRVVEITLAVSSL
Ga0179593_102514253300026555Vadose Zone SoilLWYCAFGWAGPDVPQVMEVVCTLEKDGKPGRVVEIRLAAASL
Ga0209799_105420313300027654Tropical Forest SoilQRLELLYYAFDWAGPDVPQVMEVVCTVANDGGPGLVVEITLAASSL
Ga0209447_1016578623300027701Bog Forest SoilRKLELLYYAFDWAGADVPQVMEVLCTVEDDGKPGRVVEITLAAPSL
Ga0209139_1018757013300027795Bog Forest SoilYYAFDWAGPDVPQVMEVMCTVAQDGKSGRVVEITLAAPSL
Ga0209656_1044768323300027812Bog Forest SoilFDWAGPDVPQVMEVLCTREKDGQPGRVVEITLAAPSL
Ga0302233_1011679133300028746PalsaWAGTDVPQLMAVLCTPGKNGKAGRVVEITLEAPSL
Ga0302219_1012536213300028747PalsaLELLYYAFDWAGADVPQVMEVVCGVQQNGKPGRVVEITLAAPSL
Ga0302226_1026833423300028801PalsaMYYAFDWAGSSVPQVMEVFCARDSGRVMEITLAYPSL
Ga0302218_1029315123300028863PalsaLLYYAFDWAGTDVPQLMAVLCTPGKNGKAGRVVEITLEAPSL
Ga0311354_1101236013300030618PalsaAFDWAGADVPQVMEVVCGVQQNGKPGRVVEITLAAPSL
Ga0316363_1035685823300030659Peatlands SoilAFDWAGADVPQVMEVLCTREQDGQPGHVVEITLAAPSL
Ga0170824_10842586923300031231Forest SoilFDWARPDFLKIMAVLCTPEKDGKPGQVVENTLVAASL
Ga0302324_10334466013300031236PalsaDWAGADVPQVMEVLCTVEDDGKPGRVVEITLAAPSL
Ga0318528_1029293923300031561SoilLMYYAFDWAGPEVPQVMEVLCTKAAEGKPGRVMEITLAAPSL
Ga0307474_1013122113300031718Hardwood Forest SoilRQLELLYYAFDWAGADVPQVMEVACSVKEGQKPGRVVEITLAAPSL
Ga0307469_1023315133300031720Hardwood Forest SoilLELWYYAFDWAGADVPQVMEVLCTREADGKPGRVVKITLAGPSL
Ga0307468_10142757313300031740Hardwood Forest SoilYAFDWAGADVPQVMEVLCTAEKDGEPGRVVEITLAAASL
Ga0318502_1050137223300031747SoilPLELMYYAFDWAGPEVPQVMEVLCTKAAEGKPGRVMEITLAAPSL
Ga0307475_1101445513300031754Hardwood Forest SoilLYYAFDWAGPDVPQVMAVLCTPEKNAKPGRVVEITLAAPSL
Ga0318517_1015998423300031835SoilMYYAFDWAGPEVPQVMEVLCTKAAEGKPGRVMEITLAAPSL
Ga0306919_1120367523300031879SoilLMYYAFDWAGPDVPQVMEVLCTKAAEGKPGRVMEITLAAPSL
Ga0306925_1206686613300031890SoilAFDWAGPDVPQVMEVVCTRERDGQAGRVVEITLAAPSL
Ga0306923_1097907223300031910SoilYYAFDWAGADVPQVMEVLCTKAADGKPGRVMEITLAAPSL
Ga0306921_1239287223300031912SoilFDWAGPDVPQVMEVLCTVEQDGKPGRVVEITLAASSL
Ga0310912_1068362023300031941SoilMYYASDWAGPNLLQVGDVVCTKALEGKPGRVMEIT
Ga0307479_1149220513300031962Hardwood Forest SoilAFDWAGPDVPQVMEVLCTVGKNGEPGRVVEITLAASSL
Ga0306922_1002230463300032001SoilGQPLELWYYAFDWAGPDVPQVMEVLCTREKAGQPGRVIEITLAAPSL
Ga0306922_1017591813300032001SoilLELLYYAFDWAGPDVPQVMEVLCTVEQDGKPGRVVEITLAASSL
Ga0318514_1025312623300032066SoilPLELMYYAFDWAGPDVPQVMEVLCTKAAEGKPGRVMEITLAAPSL
Ga0311301_1051992313300032160Peatlands SoilWYYTFDWAGPHVPQVMEVLCTKEQDGQPGYVVEITLAAPSL
Ga0311301_1300531013300032160Peatlands SoilLWYYAFDWAGPDVPQVMEVLCTKEKDGQPGYVVEITLAAP
Ga0307470_1032507013300032174Hardwood Forest SoilSTKDGQQLELLYYAFDWAGPDVPQLMEVLCTVEKDGKPGRVVEITLAVSSL
Ga0307471_10416880523300032180Hardwood Forest SoilYAFDWAGPEVPQVMQIVCTAEKDAKAGRVVQITLAASNL
Ga0307472_10270323613300032205Hardwood Forest SoilLYYAFDWAGSDVPQVMEVVCTVEKDGEPGRVVEITLAASSL
Ga0306920_10024522613300032261SoilDGQPLELWYYAFDWAGPDVPQVMEVLCTREKAGQPGRVIEITLAAPSL
Ga0335083_1152856723300032954SoilELWYYAFDWAGPDVPQVMEVLCTREQDGKPGRVIEITLAAPSL
Ga0335073_1031226633300033134SoilLELWYYAFDWAGENVPQVMEVLCTQEADGKPGRVIEITLAAPSL
Ga0371489_0038321_1956_20843300033755Peat SoilLWYYAFDWAGPDVPQVMEVLCTKEKDGEPGRVVEITLAAPSL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.