| Basic Information | |
|---|---|
| Family ID | F066754 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 42 residues |
| Representative Sequence | LWYYAFDWAGPDVPQVMEVLCTKEKDGEPGRVVEITLAAPSL |
| Number of Associated Samples | 114 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 3.97 % |
| % of genes near scaffold ends (potentially truncated) | 85.71 % |
| % of genes from short scaffolds (< 2000 bps) | 88.10 % |
| Associated GOLD sequencing projects | 107 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.61 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.873 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.778 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (58.730 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 40.00% Coil/Unstructured: 60.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.61 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF00664 | ABC_membrane | 19.84 |
| PF06127 | Mpo1-like | 0.79 |
| PF01661 | Macro | 0.79 |
| PF13662 | Toprim_4 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG4539 | 2-hydroxy fatty acid dioxygenase MPO1 (alpha-oxidation of fatty acids) | Lipid transport and metabolism [I] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_100086595 | All Organisms → cellular organisms → Bacteria | 2902 | Open in IMG/M |
| 3300002917|JGI25616J43925_10103600 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300004268|Ga0066398_10027086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1018 | Open in IMG/M |
| 3300004268|Ga0066398_10165358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300005332|Ga0066388_104906699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300005356|Ga0070674_101818275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300005440|Ga0070705_101532651 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300005445|Ga0070708_100122532 | All Organisms → cellular organisms → Bacteria | 2400 | Open in IMG/M |
| 3300005467|Ga0070706_100951876 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300005536|Ga0070697_100745033 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300005536|Ga0070697_101015331 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300005541|Ga0070733_10037610 | All Organisms → cellular organisms → Bacteria | 3018 | Open in IMG/M |
| 3300005764|Ga0066903_100676666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1812 | Open in IMG/M |
| 3300005764|Ga0066903_109116606 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300005944|Ga0066788_10042590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
| 3300006579|Ga0074054_10070924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300006903|Ga0075426_11382255 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300006904|Ga0075424_100836822 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300009012|Ga0066710_101146740 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300009088|Ga0099830_11583734 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300009137|Ga0066709_101911488 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300009176|Ga0105242_10842774 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300009644|Ga0116121_1224136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300009839|Ga0116223_10799123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300010046|Ga0126384_11954595 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300010339|Ga0074046_10482828 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 741 | Open in IMG/M |
| 3300010343|Ga0074044_10073880 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2307 | Open in IMG/M |
| 3300010343|Ga0074044_10633821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300010360|Ga0126372_10473019 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1168 | Open in IMG/M |
| 3300010360|Ga0126372_10562024 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300010361|Ga0126378_10221010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1978 | Open in IMG/M |
| 3300010366|Ga0126379_10282670 | All Organisms → cellular organisms → Bacteria | 1654 | Open in IMG/M |
| 3300010375|Ga0105239_12266598 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300010376|Ga0126381_104156970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 562 | Open in IMG/M |
| 3300010398|Ga0126383_11651363 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300010399|Ga0134127_13594144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300011270|Ga0137391_10404601 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300012203|Ga0137399_10095396 | All Organisms → cellular organisms → Bacteria | 2289 | Open in IMG/M |
| 3300012356|Ga0137371_10347020 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
| 3300012361|Ga0137360_11664686 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300012582|Ga0137358_10432152 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300012923|Ga0137359_10009693 | All Organisms → cellular organisms → Bacteria | 7996 | Open in IMG/M |
| 3300012924|Ga0137413_10289480 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300012929|Ga0137404_11389427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300012929|Ga0137404_11598246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300012971|Ga0126369_12353808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300012984|Ga0164309_10858900 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 736 | Open in IMG/M |
| 3300014157|Ga0134078_10669026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300014165|Ga0181523_10001599 | All Organisms → cellular organisms → Bacteria | 23846 | Open in IMG/M |
| 3300014200|Ga0181526_10055987 | All Organisms → cellular organisms → Bacteria | 2514 | Open in IMG/M |
| 3300014658|Ga0181519_10452195 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 792 | Open in IMG/M |
| 3300015264|Ga0137403_10461365 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300016270|Ga0182036_11306735 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 605 | Open in IMG/M |
| 3300016319|Ga0182033_10789777 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300016319|Ga0182033_11201927 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300016422|Ga0182039_10151492 | All Organisms → cellular organisms → Bacteria | 1796 | Open in IMG/M |
| 3300016445|Ga0182038_11841755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300017933|Ga0187801_10328140 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300018024|Ga0187881_10038705 | All Organisms → cellular organisms → Bacteria | 2401 | Open in IMG/M |
| 3300018038|Ga0187855_10336783 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300018060|Ga0187765_10071088 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300018062|Ga0187784_11384408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300018090|Ga0187770_11627835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300019278|Ga0187800_1296621 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300019360|Ga0187894_10233762 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300019788|Ga0182028_1367431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1849 | Open in IMG/M |
| 3300020021|Ga0193726_1282746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300020199|Ga0179592_10151699 | All Organisms → cellular organisms → Bacteria | 1060 | Open in IMG/M |
| 3300020580|Ga0210403_11094547 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300020583|Ga0210401_11508612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 529 | Open in IMG/M |
| 3300021086|Ga0179596_10044136 | All Organisms → cellular organisms → Bacteria | 1812 | Open in IMG/M |
| 3300021088|Ga0210404_10885480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 3300021168|Ga0210406_10523637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 935 | Open in IMG/M |
| 3300021178|Ga0210408_10238120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1449 | Open in IMG/M |
| 3300021180|Ga0210396_10024678 | All Organisms → cellular organisms → Bacteria | 5565 | Open in IMG/M |
| 3300021180|Ga0210396_10197293 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1799 | Open in IMG/M |
| 3300021405|Ga0210387_10492050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1090 | Open in IMG/M |
| 3300021405|Ga0210387_10525606 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300021432|Ga0210384_10156097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2048 | Open in IMG/M |
| 3300021432|Ga0210384_11569189 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
| 3300021474|Ga0210390_10332771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1286 | Open in IMG/M |
| 3300021479|Ga0210410_11266838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300022533|Ga0242662_10086631 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
| 3300025474|Ga0208479_1095751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300025934|Ga0207686_10920141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 706 | Open in IMG/M |
| 3300026309|Ga0209055_1237801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 561 | Open in IMG/M |
| 3300026322|Ga0209687_1181654 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300026489|Ga0257160_1070206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300026555|Ga0179593_1025142 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
| 3300027654|Ga0209799_1054203 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300027701|Ga0209447_10165786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300027795|Ga0209139_10187570 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300027812|Ga0209656_10447683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 572 | Open in IMG/M |
| 3300028746|Ga0302233_10116791 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1044 | Open in IMG/M |
| 3300028747|Ga0302219_10125362 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300028801|Ga0302226_10268334 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300028863|Ga0302218_10293151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300030618|Ga0311354_11012360 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300030659|Ga0316363_10356858 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300031231|Ga0170824_108425869 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300031236|Ga0302324_103344660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300031561|Ga0318528_10292939 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300031718|Ga0307474_10131221 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1884 | Open in IMG/M |
| 3300031720|Ga0307469_10233151 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
| 3300031740|Ga0307468_101427573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300031747|Ga0318502_10501372 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 727 | Open in IMG/M |
| 3300031754|Ga0307475_11014455 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 652 | Open in IMG/M |
| 3300031835|Ga0318517_10159984 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1009 | Open in IMG/M |
| 3300031879|Ga0306919_11203675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300031890|Ga0306925_12066866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300031910|Ga0306923_10979072 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300031912|Ga0306921_12392872 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 551 | Open in IMG/M |
| 3300031941|Ga0310912_10683620 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300031962|Ga0307479_11492205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300032001|Ga0306922_10022304 | All Organisms → cellular organisms → Bacteria | 6343 | Open in IMG/M |
| 3300032001|Ga0306922_10175918 | All Organisms → cellular organisms → Bacteria | 2294 | Open in IMG/M |
| 3300032066|Ga0318514_10253126 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300032160|Ga0311301_10519923 | All Organisms → cellular organisms → Bacteria | 1755 | Open in IMG/M |
| 3300032160|Ga0311301_13005310 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300032174|Ga0307470_10325070 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300032180|Ga0307471_104168805 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300032205|Ga0307472_102703236 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300032261|Ga0306920_100245226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2673 | Open in IMG/M |
| 3300032954|Ga0335083_11528567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300033134|Ga0335073_10312266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1881 | Open in IMG/M |
| 3300033755|Ga0371489_0038321 | All Organisms → cellular organisms → Bacteria | 3392 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.35% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.76% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.97% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.17% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.38% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.38% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.38% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.38% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.38% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.59% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.59% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.59% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.79% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.79% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.79% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.79% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.79% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005944 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025474 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028747 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028863 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1000865953 | 3300000955 | Soil | YYAFDWAGPDVPQVMEVVCTVGKDGEPGRVVEITLAASSL* |
| JGI25616J43925_101036002 | 3300002917 | Grasslands Soil | LWYYGFDWAGPDVPQVTELLRTTEKDGKPGRVVEITLAAASL* |
| Ga0066398_100270862 | 3300004268 | Tropical Forest Soil | GQQLELLYYAFDWAGPDVPQVMEVVCTVGESGKPGRVVEITLAASSL* |
| Ga0066398_101653581 | 3300004268 | Tropical Forest Soil | ELWYYAFDWAGADVPQVMEVLCTREADGKAGRVMEITLAAPSL* |
| Ga0066388_1049066991 | 3300005332 | Tropical Forest Soil | DGQRLELLYYAFDWAGPDVPQVMQVLCTVKQDGTPGKVVEITLAASSL* |
| Ga0070674_1018182751 | 3300005356 | Miscanthus Rhizosphere | GQQLELLYYAFDWAGPDVPQVMEVVCTAEIDGAPGRVVEIMLAASSL* |
| Ga0070705_1015326512 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | YAFDWAGPDVPQVMEVVCTVGKDGEPGRVVEITLAASSL* |
| Ga0070708_1001225323 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GQRLELLYYAFDWAGPDVPQVMEVLCTAEKDGEPGRVVEITLAAASL* |
| Ga0070706_1009518762 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | YAFDWAGPDVPQVMEVLCTAEKDGEPGRVVEITLAAASL* |
| Ga0070697_1007450331 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | YYAFDWAGPDVPQVMEVLCTAEKDGKPGRVVEITLAASSL* |
| Ga0070697_1010153312 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | GQRLELLYYAFDWAGPDVPQVMEVLCTAEKDGAPGRVVEITLAAASL* |
| Ga0070733_100376103 | 3300005541 | Surface Soil | LYYAFDWAGPDVPQVMAVLCTPGSGAKPGRVIDITLMAPSL* |
| Ga0066903_1006766663 | 3300005764 | Tropical Forest Soil | LLYYAFDWTGPDTPQVMEVVCTVGENGEPGRVVEITLAASSL* |
| Ga0066903_1091166062 | 3300005764 | Tropical Forest Soil | YYAFDWAGPDVPQVMEVLCSKAAEGKPGQVMEITLAAPSL* |
| Ga0066788_100425901 | 3300005944 | Soil | LELLYYAFDWAGPDVPQVMAVLCTPEKNAKPGRVVEITLAAPSL* |
| Ga0074054_100709242 | 3300006579 | Soil | RLELLYYAFDWAGSEVPQVMEVLCTVEHDGKPGRVIEITLAASSL* |
| Ga0075426_113822551 | 3300006903 | Populus Rhizosphere | YYAFDWAGPDVPQVMEVVCTVGQDGQPERVVEITLAASSL* |
| Ga0075424_1008368223 | 3300006904 | Populus Rhizosphere | KGGQRLELLYYAFDWAGPDVPQVMEVACTVGKDGEPGRVVEITLAASSL* |
| Ga0066710_1011467401 | 3300009012 | Grasslands Soil | DWAGPDVPQVMEVLCTAEKDGEPGRVVEITLAAASL |
| Ga0099830_115837342 | 3300009088 | Vadose Zone Soil | GQRLELWYYAFGWAGPDVPQVMEVLCTLEKDGEPGRVVEVRLAAASL* |
| Ga0066709_1019114881 | 3300009137 | Grasslands Soil | TKDGQRLELLYYAFDWAGPDVPQVMEVLCTAEKDGEPGRVVEITLAAASL* |
| Ga0105242_108427741 | 3300009176 | Miscanthus Rhizosphere | AFDWAGPDVPQVMEVVCTVETDGAPGRVVEITLAASSL* |
| Ga0116121_12241361 | 3300009644 | Peatland | LWYYAFDWAGADVPQVMEVLCTKEQDGQPGRVVEITLAAPS |
| Ga0116223_107991231 | 3300009839 | Peatlands Soil | KDGQPLELWYYAFDWAGPDVPQVMEVLCTKEKDGEPGRVVEITLAAPSL* |
| Ga0126384_119545951 | 3300010046 | Tropical Forest Soil | LLYYAFDWAGPDVPQVMEVLCTVAEDGKPGRVVEITLAASSL* |
| Ga0074046_104828282 | 3300010339 | Bog Forest Soil | LWYYAFDWAGPDVPQVMEVLCTREKDGQPGRVVEITLAAPSL* |
| Ga0074044_100738803 | 3300010343 | Bog Forest Soil | YYAFDWAGPDVPQVMEVLCSKEKDGPPGRVLEITLAAPSL* |
| Ga0074044_106338212 | 3300010343 | Bog Forest Soil | LWYYAFDWAGPDVPQVMEVLCTKEKDGEPGRVVEITLAAPSL* |
| Ga0126372_104730193 | 3300010360 | Tropical Forest Soil | YAFDWAGPDVPQVMEVLCTREKAGQPGRVIEITLAAPSL* |
| Ga0126372_105620243 | 3300010360 | Tropical Forest Soil | FDWAGPDVPQLMEVLCTVEKDGKPGRVVEITLAVSSL* |
| Ga0126378_102210101 | 3300010361 | Tropical Forest Soil | LWYYAFDWAGPDVPQVMEVVCTREKDGQVGQVVEITLAAPSL* |
| Ga0126379_102826703 | 3300010366 | Tropical Forest Soil | LLYYAFDWAGPDVPQVMEVVCTVGKDGEPGRVVEITLAASSL* |
| Ga0105239_122665982 | 3300010375 | Corn Rhizosphere | KGGQRLELLYYAFDWAGPDVPQVMEVVCTVGKDGEPGRVVEITLAASSL* |
| Ga0126381_1041569702 | 3300010376 | Tropical Forest Soil | DWAGPDVPQVLEVVVTVGKDGEPGRVVEITLAASSL* |
| Ga0126383_116513631 | 3300010398 | Tropical Forest Soil | QPLELWYYAFDWAGPDVPQVMEVLCTREQDGKPGRVVEITLAAPSL* |
| Ga0134127_135941442 | 3300010399 | Terrestrial Soil | YYAFDWAGPDVPQVMTVLCTPGQEGNAGRVVEITLAAPSL* |
| Ga0137391_104046013 | 3300011270 | Vadose Zone Soil | YAFDWAGPDVPQMMEVLCTVEKDGKPGRVIEITLSASSL* |
| Ga0137399_100953963 | 3300012203 | Vadose Zone Soil | LWYYAFGWAGPDVPQVMEALCTLEKDGEPGRVVEIGLAAASL* |
| Ga0137371_103470203 | 3300012356 | Vadose Zone Soil | WAGPDVPQVMEVLCTAEKDGEPGRVVEITLAAASL* |
| Ga0137360_116646862 | 3300012361 | Vadose Zone Soil | LYYAFDWAGPDVPQGMAVLCTVEKDGIPGRVVEITLAASSL* |
| Ga0137358_104321522 | 3300012582 | Vadose Zone Soil | LELLYYAFDWAGPDVPQLMEVLCTVEKGGKPGRVVEITLAVSSL* |
| Ga0137359_100096933 | 3300012923 | Vadose Zone Soil | LWYYAFGWAGPNVAQVMEVLCTLEKDGEPGRAVEIRLAAASL* |
| Ga0137413_102894801 | 3300012924 | Vadose Zone Soil | QQRLELLYYAFDWAGPDGPQMMEGRCTVEKDGKPGRVIEITLSASSL* |
| Ga0137404_113894272 | 3300012929 | Vadose Zone Soil | LYYAFDWAGPDVPQVMEVLCTAEKDGEPGRVVEITLAAASL* |
| Ga0137404_115982462 | 3300012929 | Vadose Zone Soil | RLELLYYAFDWAGPDVPQVMEVLCTAEKDGEPGRVVEITLAAASL* |
| Ga0126369_123538082 | 3300012971 | Tropical Forest Soil | MYYAFDWAGADVPQVMEVLCTKAADGKPGRVMEITLAAPSL* |
| Ga0164309_108589001 | 3300012984 | Soil | LLYYAFDWAGSDVPQVMEVVCTVEKDGEPGRVVEITLAASSL* |
| Ga0134078_106690262 | 3300014157 | Grasslands Soil | GQRLELLYYAFDWAGPDVPQVMEVLCTVGTDGKPGRVLEITLAASSL* |
| Ga0181523_1000159922 | 3300014165 | Bog | WAGADVPQVMEVLCTKEQDGRPGRVVEITLAAPSL* |
| Ga0181526_100559873 | 3300014200 | Bog | MYYAFDWAGPEVPQVMEVLCSKEKDGQPGRVVEITLAAPSL* |
| Ga0181519_104521951 | 3300014658 | Bog | MYYAFDWAGPDVPQVMEVLCTKEKNGQAGRVVEITLAAPSL* |
| Ga0137403_104613652 | 3300015264 | Vadose Zone Soil | LWYHAFGWAGPDVPQVMEVFCALEKDGEPGRVVEIRLAAASL* |
| Ga0182036_113067352 | 3300016270 | Soil | LELLYYAFDWAGPDVPQVMQVACTAEKDGRAARVVEITLAASSL |
| Ga0182033_107897771 | 3300016319 | Soil | PLELMYYAFDWAGADVPQVMEVLCTKAVDGKPGRVMEITLAAPSL |
| Ga0182033_112019271 | 3300016319 | Soil | ELMYYAFDWAGADVPQVMEVLCTKAAEGKPGRVMEITLAAPSL |
| Ga0182039_101514923 | 3300016422 | Soil | MYYAFDWAGPDVPQVMEVLCTKAADGKPGRVMEITLAAPSL |
| Ga0182038_118417551 | 3300016445 | Soil | QPLELWYYAFDWAGPDVPQVMEVLCTREQDGKPGRVIEITLAAPSL |
| Ga0187801_103281401 | 3300017933 | Freshwater Sediment | DWAGPDVPQVMEVLCTREKDGQPGRVVEITLAAPSL |
| Ga0187881_100387053 | 3300018024 | Peatland | WAGPDVPQVMEVLCTKEKEGQPGRVVEITLAAPSL |
| Ga0187855_103367832 | 3300018038 | Peatland | GQPLELWYYAFDWAGADVPQVMEVLCTKEHDGQPGRVVEITLAAPSL |
| Ga0187765_100710883 | 3300018060 | Tropical Peatland | ELWYYAFDWAGPDVPQVMEVLCTREQDGKPGRVVEITLAAPSL |
| Ga0187784_113844081 | 3300018062 | Tropical Peatland | QPLELWYYAFDWAGPDVPQVMEVLCTREKEGQPGTVVEITLAAPSL |
| Ga0187770_116278352 | 3300018090 | Tropical Peatland | QPLELWYYAFDWAGPNVPQVMEVPCTMEKDGQPGYGVQITLATRSL |
| Ga0187800_12966213 | 3300019278 | Peatland | WAGPDVPQVMEVLCTTEKEGQPGRVIEITLAAARL |
| Ga0187894_102337621 | 3300019360 | Microbial Mat On Rocks | QELELLYYQFDWAGPDVPQVMEVLCTPEKDGKPGRVVKIMLAAPSL |
| Ga0182028_13674313 | 3300019788 | Fen | LWYYAFDWAGPDVPQVMEVLCTKEKDGQPGRVVEITLAAPSL |
| Ga0193726_12827461 | 3300020021 | Soil | LYYAFDWAGPDVPQVMAVLCTPGKNAKPGRVVEITLMAPSL |
| Ga0179592_101516992 | 3300020199 | Vadose Zone Soil | LLYYAFDWAGPDVPQLMEVLCTVEKDGKPGRVVEITLAVSSL |
| Ga0210403_110945472 | 3300020580 | Soil | SEDGQQLELWYYAFDWAGPDVPQVMEVLCAVGQDGKPGRVVEITLAAPSL |
| Ga0210401_115086122 | 3300020583 | Soil | YAFDWAGADVPQVMEVLCTREADGKPGRVVEITLAGPSL |
| Ga0179596_100441363 | 3300021086 | Vadose Zone Soil | ELLYYAFDWAGPDVPQMMEVLCTVEKDGKPGRVIEITLSASSL |
| Ga0210404_108854801 | 3300021088 | Soil | GQPLELLYYAFDWAGSDVPQVMQAVCTPEKDGQPGQVVEITLAASSL |
| Ga0210406_105236371 | 3300021168 | Soil | YAFDWAGPDVPQVMQVVCTPEQGGQAGRVVEITLAASSL |
| Ga0210408_102381203 | 3300021178 | Soil | YAFDWAGPDVPQVMQVVCTPEQDDRAGRVVEITLAASSL |
| Ga0210396_100246786 | 3300021180 | Soil | VVLRVRLAGADVPQVIELLCTREARGKPGRVVEITLAGPSL |
| Ga0210396_101972933 | 3300021180 | Soil | KDGQPLELWYYAFDWAGPDVPQVMEVVCTREKEGQPGRVVEITLAAPSL |
| Ga0210387_104920503 | 3300021405 | Soil | QLELLYYAFDWAGPDVPQVMEVLCTLQKDGKPGSVVEITLAAPSL |
| Ga0210387_105256063 | 3300021405 | Soil | ELLYYAFDWAGTAVPQVMEVLCTVVRDGKPGRVVEITLAAPSL |
| Ga0210384_101560973 | 3300021432 | Soil | AFDWAGPDVPQVMEVVCTREKDGQVGRVVEITLAAPSL |
| Ga0210384_115691891 | 3300021432 | Soil | YAFDWAGPDVPQVMEVLCTAEEVGKPGRVVEITLAAPSL |
| Ga0210390_103327712 | 3300021474 | Soil | VVLRVRLAGADVPQVMELLCTREARGKPGRVVEITLAGPSL |
| Ga0210410_112668382 | 3300021479 | Soil | LLYYAFDWAGADVPQVMEVLCTVPQDGKPGRVVEITLAAPSL |
| Ga0242662_100866313 | 3300022533 | Soil | WAGADVPQVMEVLCTQETEGKPGRVVEITLAGPSL |
| Ga0208479_10957511 | 3300025474 | Arctic Peat Soil | QQLELWYYAFDWAGADVPQVMEVLCTKEKDRVPGRVIEITLAAPSL |
| Ga0207686_109201411 | 3300025934 | Miscanthus Rhizosphere | LSYYAFDWAGPDVPQVMTVLCTPGQEGNAGRVVEITLAAPSL |
| Ga0209055_12378011 | 3300026309 | Soil | DWAGPDVPQVMEVLCTAEKEGEPGRVVEITLAAASL |
| Ga0209687_11816542 | 3300026322 | Soil | GRVWSGPQVMEVLCTVGTDGKPSRLHEITLAASSL |
| Ga0257160_10702062 | 3300026489 | Soil | AFDWAGPDVPQLMEVLCTVEKGGKPGRVVEITLAVSSL |
| Ga0179593_10251425 | 3300026555 | Vadose Zone Soil | LWYCAFGWAGPDVPQVMEVVCTLEKDGKPGRVVEIRLAAASL |
| Ga0209799_10542031 | 3300027654 | Tropical Forest Soil | QRLELLYYAFDWAGPDVPQVMEVVCTVANDGGPGLVVEITLAASSL |
| Ga0209447_101657862 | 3300027701 | Bog Forest Soil | RKLELLYYAFDWAGADVPQVMEVLCTVEDDGKPGRVVEITLAAPSL |
| Ga0209139_101875701 | 3300027795 | Bog Forest Soil | YYAFDWAGPDVPQVMEVMCTVAQDGKSGRVVEITLAAPSL |
| Ga0209656_104476832 | 3300027812 | Bog Forest Soil | FDWAGPDVPQVMEVLCTREKDGQPGRVVEITLAAPSL |
| Ga0302233_101167913 | 3300028746 | Palsa | WAGTDVPQLMAVLCTPGKNGKAGRVVEITLEAPSL |
| Ga0302219_101253621 | 3300028747 | Palsa | LELLYYAFDWAGADVPQVMEVVCGVQQNGKPGRVVEITLAAPSL |
| Ga0302226_102683342 | 3300028801 | Palsa | MYYAFDWAGSSVPQVMEVFCARDSGRVMEITLAYPSL |
| Ga0302218_102931512 | 3300028863 | Palsa | LLYYAFDWAGTDVPQLMAVLCTPGKNGKAGRVVEITLEAPSL |
| Ga0311354_110123601 | 3300030618 | Palsa | AFDWAGADVPQVMEVVCGVQQNGKPGRVVEITLAAPSL |
| Ga0316363_103568582 | 3300030659 | Peatlands Soil | AFDWAGADVPQVMEVLCTREQDGQPGHVVEITLAAPSL |
| Ga0170824_1084258692 | 3300031231 | Forest Soil | FDWARPDFLKIMAVLCTPEKDGKPGQVVENTLVAASL |
| Ga0302324_1033446601 | 3300031236 | Palsa | DWAGADVPQVMEVLCTVEDDGKPGRVVEITLAAPSL |
| Ga0318528_102929392 | 3300031561 | Soil | LMYYAFDWAGPEVPQVMEVLCTKAAEGKPGRVMEITLAAPSL |
| Ga0307474_101312211 | 3300031718 | Hardwood Forest Soil | RQLELLYYAFDWAGADVPQVMEVACSVKEGQKPGRVVEITLAAPSL |
| Ga0307469_102331513 | 3300031720 | Hardwood Forest Soil | LELWYYAFDWAGADVPQVMEVLCTREADGKPGRVVKITLAGPSL |
| Ga0307468_1014275731 | 3300031740 | Hardwood Forest Soil | YAFDWAGADVPQVMEVLCTAEKDGEPGRVVEITLAAASL |
| Ga0318502_105013722 | 3300031747 | Soil | PLELMYYAFDWAGPEVPQVMEVLCTKAAEGKPGRVMEITLAAPSL |
| Ga0307475_110144551 | 3300031754 | Hardwood Forest Soil | LYYAFDWAGPDVPQVMAVLCTPEKNAKPGRVVEITLAAPSL |
| Ga0318517_101599842 | 3300031835 | Soil | MYYAFDWAGPEVPQVMEVLCTKAAEGKPGRVMEITLAAPSL |
| Ga0306919_112036752 | 3300031879 | Soil | LMYYAFDWAGPDVPQVMEVLCTKAAEGKPGRVMEITLAAPSL |
| Ga0306925_120668661 | 3300031890 | Soil | AFDWAGPDVPQVMEVVCTRERDGQAGRVVEITLAAPSL |
| Ga0306923_109790722 | 3300031910 | Soil | YYAFDWAGADVPQVMEVLCTKAADGKPGRVMEITLAAPSL |
| Ga0306921_123928722 | 3300031912 | Soil | FDWAGPDVPQVMEVLCTVEQDGKPGRVVEITLAASSL |
| Ga0310912_106836202 | 3300031941 | Soil | MYYASDWAGPNLLQVGDVVCTKALEGKPGRVMEIT |
| Ga0307479_114922051 | 3300031962 | Hardwood Forest Soil | AFDWAGPDVPQVMEVLCTVGKNGEPGRVVEITLAASSL |
| Ga0306922_100223046 | 3300032001 | Soil | GQPLELWYYAFDWAGPDVPQVMEVLCTREKAGQPGRVIEITLAAPSL |
| Ga0306922_101759181 | 3300032001 | Soil | LELLYYAFDWAGPDVPQVMEVLCTVEQDGKPGRVVEITLAASSL |
| Ga0318514_102531262 | 3300032066 | Soil | PLELMYYAFDWAGPDVPQVMEVLCTKAAEGKPGRVMEITLAAPSL |
| Ga0311301_105199231 | 3300032160 | Peatlands Soil | WYYTFDWAGPHVPQVMEVLCTKEQDGQPGYVVEITLAAPSL |
| Ga0311301_130053101 | 3300032160 | Peatlands Soil | LWYYAFDWAGPDVPQVMEVLCTKEKDGQPGYVVEITLAAP |
| Ga0307470_103250701 | 3300032174 | Hardwood Forest Soil | STKDGQQLELLYYAFDWAGPDVPQLMEVLCTVEKDGKPGRVVEITLAVSSL |
| Ga0307471_1041688052 | 3300032180 | Hardwood Forest Soil | YAFDWAGPEVPQVMQIVCTAEKDAKAGRVVQITLAASNL |
| Ga0307472_1027032361 | 3300032205 | Hardwood Forest Soil | LYYAFDWAGSDVPQVMEVVCTVEKDGEPGRVVEITLAASSL |
| Ga0306920_1002452261 | 3300032261 | Soil | DGQPLELWYYAFDWAGPDVPQVMEVLCTREKAGQPGRVIEITLAAPSL |
| Ga0335083_115285672 | 3300032954 | Soil | ELWYYAFDWAGPDVPQVMEVLCTREQDGKPGRVIEITLAAPSL |
| Ga0335073_103122663 | 3300033134 | Soil | LELWYYAFDWAGENVPQVMEVLCTQEADGKPGRVIEITLAAPSL |
| Ga0371489_0038321_1956_2084 | 3300033755 | Peat Soil | LWYYAFDWAGPDVPQVMEVLCTKEKDGEPGRVVEITLAAPSL |
| ⦗Top⦘ |