NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F066749

Metagenome / Metatranscriptome Family F066749

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066749
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 49 residues
Representative Sequence MRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI
Number of Associated Samples 87
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 77.42 %
% of genes near scaffold ends (potentially truncated) 31.75 %
% of genes from short scaffolds (< 2000 bps) 80.95 %
Associated GOLD sequencing projects 75
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (42.857 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(35.714 % of family members)
Environment Ontology (ENVO) Unclassified
(73.016 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.476 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.14%    β-sheet: 0.00%    Coil/Unstructured: 56.86%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF13155Toprim_2 2.38
PF13662Toprim_4 1.59
PF03237Terminase_6N 1.59
PF08291Peptidase_M15_3 0.79
PF01612DNA_pol_A_exo1 0.79
PF13455MUG113 0.79
PF02867Ribonuc_red_lgC 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 126 Family Scaffolds
COG0209Ribonucleotide reductase alpha subunitNucleotide transport and metabolism [F] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms57.14 %
UnclassifiedrootN/A42.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10028726All Organisms → Viruses → Predicted Viral3093Open in IMG/M
3300000101|DelMOSum2010_c10060643All Organisms → Viruses → Predicted Viral1821Open in IMG/M
3300000101|DelMOSum2010_c10062148All Organisms → Viruses → Predicted Viral1787Open in IMG/M
3300000101|DelMOSum2010_c10087582All Organisms → Viruses → Predicted Viral1347Open in IMG/M
3300000101|DelMOSum2010_c10223255Not Available613Open in IMG/M
3300000115|DelMOSum2011_c10018845All Organisms → Viruses → Predicted Viral3334Open in IMG/M
3300000928|OpTDRAFT_10169221Not Available568Open in IMG/M
3300001348|JGI20154J14316_10130185Not Available722Open in IMG/M
3300002930|Water_101292Not Available4762Open in IMG/M
3300002930|Water_101859All Organisms → Viruses → Predicted Viral3805Open in IMG/M
3300003268|JGI26115J46592_1045576Not Available508Open in IMG/M
3300003271|JGI26114J46594_1002657All Organisms → Viruses → Predicted Viral3795Open in IMG/M
3300004097|Ga0055584_102526310Not Available518Open in IMG/M
3300004457|Ga0066224_1080109All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.912Open in IMG/M
3300004461|Ga0066223_1178455All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.721Open in IMG/M
3300005782|Ga0079367_1016823All Organisms → Viruses → Predicted Viral3462Open in IMG/M
3300005941|Ga0070743_10111805Not Available916Open in IMG/M
3300005942|Ga0070742_10140724Not Available670Open in IMG/M
3300006029|Ga0075466_1032051All Organisms → Viruses → Predicted Viral1635Open in IMG/M
3300006029|Ga0075466_1036833All Organisms → Viruses → Predicted Viral1498Open in IMG/M
3300006029|Ga0075466_1128038Not Available668Open in IMG/M
3300006617|Ga0101443_132758Not Available4251Open in IMG/M
3300006735|Ga0098038_1153175Not Available767Open in IMG/M
3300006793|Ga0098055_1328438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.570Open in IMG/M
3300006802|Ga0070749_10601942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.593Open in IMG/M
3300006803|Ga0075467_10047267All Organisms → Viruses → Predicted Viral2694Open in IMG/M
3300006868|Ga0075481_10340489Not Available519Open in IMG/M
3300006919|Ga0070746_10453953Not Available568Open in IMG/M
3300006920|Ga0070748_1070133All Organisms → Viruses → Predicted Viral1365Open in IMG/M
3300006920|Ga0070748_1170573Not Available804Open in IMG/M
3300006925|Ga0098050_1072896All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.888Open in IMG/M
3300007229|Ga0075468_10047377All Organisms → Viruses → Predicted Viral1472Open in IMG/M
3300007229|Ga0075468_10185627Not Available613Open in IMG/M
3300007231|Ga0075469_10115166Not Available747Open in IMG/M
3300007231|Ga0075469_10147389Not Available642Open in IMG/M
3300007345|Ga0070752_1312542All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.596Open in IMG/M
3300007346|Ga0070753_1291925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.584Open in IMG/M
3300007538|Ga0099851_1287809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.582Open in IMG/M
3300007538|Ga0099851_1306952Not Available559Open in IMG/M
3300007539|Ga0099849_1231048Not Available686Open in IMG/M
3300007540|Ga0099847_1130755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.753Open in IMG/M
3300007540|Ga0099847_1194393Not Available593Open in IMG/M
3300008416|Ga0115362_100114881Not Available547Open in IMG/M
3300009076|Ga0115550_1101043Not Available1066Open in IMG/M
3300009080|Ga0102815_10347402Not Available822Open in IMG/M
3300009434|Ga0115562_1298047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.552Open in IMG/M
3300009442|Ga0115563_1367242All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.515Open in IMG/M
3300009467|Ga0115565_10139130All Organisms → Viruses → Predicted Viral1135Open in IMG/M
3300009467|Ga0115565_10513089Not Available538Open in IMG/M
3300009495|Ga0115571_1230674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.749Open in IMG/M
3300009505|Ga0115564_10374189Not Available700Open in IMG/M
3300009505|Ga0115564_10625157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.506Open in IMG/M
3300010151|Ga0098061_1059423All Organisms → Viruses → Predicted Viral1475Open in IMG/M
3300010368|Ga0129324_10100400All Organisms → Viruses → Predicted Viral1249Open in IMG/M
3300011118|Ga0114922_10916318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.713Open in IMG/M
3300011118|Ga0114922_11327484Not Available580Open in IMG/M
3300011251|Ga0151676_1071049All Organisms → Viruses → Predicted Viral1593Open in IMG/M
3300012524|Ga0129331_1114116All Organisms → Viruses → Predicted Viral1992Open in IMG/M
3300012524|Ga0129331_1186354All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.748Open in IMG/M
3300012952|Ga0163180_10449072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.953Open in IMG/M
3300012969|Ga0129332_1149075Not Available891Open in IMG/M
3300013010|Ga0129327_10310764Not Available818Open in IMG/M
3300013010|Ga0129327_10432369Not Available703Open in IMG/M
3300017697|Ga0180120_10277727Not Available675Open in IMG/M
3300017735|Ga0181431_1008234All Organisms → Viruses → Predicted Viral2530Open in IMG/M
3300017735|Ga0181431_1056360Not Available887Open in IMG/M
3300017742|Ga0181399_1081139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.816Open in IMG/M
3300017743|Ga0181402_1126868Not Available651Open in IMG/M
3300017749|Ga0181392_1185146Not Available602Open in IMG/M
3300017752|Ga0181400_1156262Not Available645Open in IMG/M
3300017752|Ga0181400_1216669Not Available524Open in IMG/M
3300017767|Ga0181406_1187110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.617Open in IMG/M
3300020166|Ga0206128_1212818All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.733Open in IMG/M
3300020175|Ga0206124_10033775All Organisms → Viruses → Predicted Viral2363Open in IMG/M
3300020185|Ga0206131_10082172All Organisms → Viruses → Predicted Viral1937Open in IMG/M
3300020185|Ga0206131_10200299Not Available981Open in IMG/M
3300020187|Ga0206130_10097276All Organisms → Viruses → Predicted Viral1747Open in IMG/M
3300021185|Ga0206682_10135612All Organisms → Viruses → Predicted Viral1175Open in IMG/M
3300021375|Ga0213869_10263229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.749Open in IMG/M
3300021375|Ga0213869_10317648Not Available659Open in IMG/M
3300021378|Ga0213861_10010285Not Available7005Open in IMG/M
3300021378|Ga0213861_10235206Not Available976Open in IMG/M
3300021957|Ga0222717_10083377All Organisms → Viruses → Predicted Viral2018Open in IMG/M
3300021957|Ga0222717_10227640All Organisms → Viruses → Predicted Viral1093Open in IMG/M
3300021959|Ga0222716_10166587All Organisms → Viruses → Predicted Viral1424Open in IMG/M
3300021959|Ga0222716_10620573Not Available587Open in IMG/M
3300021960|Ga0222715_10322706Not Available869Open in IMG/M
3300022053|Ga0212030_1024842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.819Open in IMG/M
3300022072|Ga0196889_1004508All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium3296Open in IMG/M
3300022072|Ga0196889_1007967All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium2376Open in IMG/M
3300022072|Ga0196889_1016900All Organisms → Viruses → Predicted Viral1544Open in IMG/M
3300022072|Ga0196889_1077766Not Available620Open in IMG/M
3300022169|Ga0196903_1012696All Organisms → Viruses → Predicted Viral1038Open in IMG/M
3300022169|Ga0196903_1023234Not Available745Open in IMG/M
3300022169|Ga0196903_1029901Not Available645Open in IMG/M
3300022169|Ga0196903_1031332Not Available628Open in IMG/M
3300022178|Ga0196887_1038619All Organisms → Viruses → Predicted Viral1281Open in IMG/M
3300022178|Ga0196887_1048025All Organisms → Viruses → Predicted Viral1100Open in IMG/M
3300022178|Ga0196887_1050644All Organisms → Viruses → Predicted Viral1059Open in IMG/M
3300023568|Ga0228696_1000094All Organisms → cellular organisms → Bacteria6635Open in IMG/M
3300023702|Ga0232119_1000147All Organisms → cellular organisms → Bacteria7445Open in IMG/M
3300024180|Ga0228668_1000425All Organisms → cellular organisms → Bacteria18304Open in IMG/M
(restricted) 3300024264|Ga0233444_10030999All Organisms → Viruses → Predicted Viral3519Open in IMG/M
3300024346|Ga0244775_10036866All Organisms → cellular organisms → Bacteria4319Open in IMG/M
(restricted) 3300024517|Ga0255049_10254846Not Available804Open in IMG/M
(restricted) 3300024519|Ga0255046_10568569Not Available545Open in IMG/M
3300025508|Ga0208148_1095414Not Available648Open in IMG/M
3300025543|Ga0208303_1007359All Organisms → cellular organisms → Bacteria3600Open in IMG/M
3300025543|Ga0208303_1013252All Organisms → Viruses → Predicted Viral2483Open in IMG/M
3300025543|Ga0208303_1045423All Organisms → Viruses → Predicted Viral1091Open in IMG/M
3300025543|Ga0208303_1116763All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.543Open in IMG/M
3300025645|Ga0208643_1083160Not Available908Open in IMG/M
3300025806|Ga0208545_1106615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.724Open in IMG/M
3300025809|Ga0209199_1150282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.871Open in IMG/M
3300025809|Ga0209199_1155169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.850Open in IMG/M
3300025809|Ga0209199_1270984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.543Open in IMG/M
3300025832|Ga0209307_1211811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomonadales → Hyphomonadaceae → Henriciella → unclassified Henriciella → Henriciella sp.558Open in IMG/M
3300025889|Ga0208644_1401564Not Available504Open in IMG/M
(restricted) 3300027837|Ga0255041_10321653Not Available562Open in IMG/M
(restricted) 3300027861|Ga0233415_10132929All Organisms → Viruses → Predicted Viral1119Open in IMG/M
(restricted) 3300027881|Ga0255055_10218263All Organisms → Viruses → Predicted Viral1037Open in IMG/M
3300032274|Ga0316203_1217328Not Available525Open in IMG/M
3300032277|Ga0316202_10043199All Organisms → Viruses → Predicted Viral2130Open in IMG/M
3300032277|Ga0316202_10060030All Organisms → Viruses → Predicted Viral1776Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous35.71%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine9.52%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater7.94%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater5.56%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine4.76%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.97%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater3.97%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine3.17%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.17%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient3.17%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat2.38%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine2.38%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.59%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.59%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.59%
Estuary WaterEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water1.59%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.59%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.79%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.79%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.79%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.79%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.79%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.79%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.79%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.79%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000928Marine plume microbial communities from the Columbia River - 25 PSUEnvironmentalOpen in IMG/M
3300001348Pelagic Microbial community sample from North Sea - COGITO 998_met_04EnvironmentalOpen in IMG/M
3300002930Estuary water microbial communities from Pearl Estuary, Zhujiang, ChinaEnvironmentalOpen in IMG/M
3300003268Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_07_M0_10EnvironmentalOpen in IMG/M
3300003271Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_18_M0_10EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004457Marine viral communities from Newfoundland, Canada MC-1EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005782Marine sediment microbial communities from Aarhus Bay station M5, Denmark - 125 cmbsf, PM3EnvironmentalOpen in IMG/M
3300005941Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697EnvironmentalOpen in IMG/M
3300005942Estuarine microbial communities from the Columbia River estuary, USA - metaG S.757EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006617Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ09 time pointEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006868Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007345Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300008416Sea floor sediment microbial communities from Gulf of Mexico Methane Seep - MPC12BEnvironmentalOpen in IMG/M
3300009076Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300009434Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516EnvironmentalOpen in IMG/M
3300009442Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519EnvironmentalOpen in IMG/M
3300009467Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530EnvironmentalOpen in IMG/M
3300009495Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531EnvironmentalOpen in IMG/M
3300009505Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523EnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011118Deep subsurface microbial communities from Aarhus Bay to uncover new lineages of life (NeLLi) - Aarhus_00045 metaGEnvironmentalOpen in IMG/M
3300011251Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.2EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017749Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017767Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 29 SPOT_SRF_2011-12-20EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022169Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300023568Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 84R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023702Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 82R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024180Seawater microbial communities from Monterey Bay, California, United States - 82DEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300024517 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_3EnvironmentalOpen in IMG/M
3300024519 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_27EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025832Pelagic marine microbial communities from North Sea - COGITO_mtgs_110530 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027881 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27EnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_10028726123300000101MarineMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLAKQQAKTNDNI*
DelMOSum2010_1006064363300000101MarineMRNNEYHGDEHILDEDEYPPMQQWEIDEALADILGDDKWLAKQQAKTNDNI*
DelMOSum2010_1006214863300000101MarineMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNV*
DelMOSum2010_1008758213300000101MarineMKXXEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNL*
DelMOSum2010_1022325533300000101MarineMTRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDRWLEKQQAKTNDNI*
DelMOSum2011_1001884563300000115MarineMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNL*
OpTDRAFT_1016922123300000928Freshwater And MarineMRNNEYHGDEHXXXXEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI*
JGI20154J14316_1013018523300001348Pelagic MarineMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNL*
Water_10129223300002930Estuary WaterMTRNNEYHGDEHLLADDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI*
Water_10185913300002930Estuary WaterMTRNNEYHGDEHILDEDEYPPMQQWEIDEALADILGDEKWLEKQREKTNDNI*
JGI26115J46592_104557633300003268MarineTGVFYMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNI*
JGI26114J46594_100265743300003271MarineMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNI*
Ga0055584_10252631023300004097Pelagic MarineDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQARTNDNL*
Ga0066224_108010923300004457MarineMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI*
Ga0066223_117845523300004461MarineMKNNEYHGDEHLLDDDEYPPMQPWEIDEALADIIGDDKWLEKQQAKTNDNI*
Ga0079367_101682353300005782Marine SedimentMKNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNL*
Ga0070743_1011180523300005941EstuarineMKNNEYHGDEHLLDEDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI*
Ga0070742_1014072413300005942EstuarineNNEYHGDEHLLDDDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNI*
Ga0075466_103205153300006029AqueousMTRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNL*
Ga0075466_103683353300006029AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNI*
Ga0075466_112803813300006029AqueousMKNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDN
Ga0101443_13275813300006617Marine Surface WaterMKNNEYHGDEHILDEDEYPPMQQWEIDEALADILGDDKWLEKQREKTNDNL*
Ga0098038_115317543300006735MarineMKNNEYHGDEHILDEDEYPPMQQWEIDEALADILGDDRWLQRQQEKAE*
Ga0098055_132843823300006793MarineMTRNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLAKQQAKTNDNI*
Ga0070749_1060194223300006802AqueousMTRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI*
Ga0075467_1004726713300006803AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDEKWLEKQQAKTNDNI*
Ga0075481_1034048923300006868AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLAKQQAKTNDNI*
Ga0070746_1045395333300006919AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQRAKTNDNL*
Ga0070748_107013333300006920AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDRWLEKQQAKTNDNI*
Ga0070748_117057323300006920AqueousMRNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLAKQQAKTNDNI*
Ga0098050_107289613300006925MarineDEYLPDADDYPPMQQWEIDEALADILGDDRWLQRQQEKAE*
Ga0075468_1004737723300007229AqueousMTRNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLEKQREKTNDNI*
Ga0075468_1018562723300007229AqueousMKNNEYHGDEHILDEDEYPPMQQWEIDEALADILGDDKWLAKQQAKTNDNL*
Ga0075469_1011516633300007231AqueousMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNL*
Ga0075469_1014738913300007231AqueousMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLAK
Ga0070752_131254213300007345AqueousDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI*
Ga0070753_129192513300007346AqueousEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI*
Ga0099851_128780913300007538AqueousYIGVFYMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDRWLEKQREKTNDNL*
Ga0099851_130695233300007538AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDD
Ga0099849_123104813300007539AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNNNI*
Ga0099847_113075513300007540AqueousMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDRWLEKQREKTNDNL*
Ga0099847_119439333300007540AqueousDDDEYPPMQQWEIDEALADIIGDEKWLEKQQAKTNDNI*
Ga0099847_121208013300007540AqueousMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDRW
Ga0115362_10011488113300008416SedimentMTRNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLEKQRERTNDNL*
Ga0115550_110104323300009076Pelagic MarineMRNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI*
Ga0102815_1034740233300009080EstuarineMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI*
Ga0115562_129804733300009434Pelagic MarineDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI*
Ga0115563_136724213300009442Pelagic MarineMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQREKTNDNL*
Ga0115565_1013913053300009467Pelagic MarineMRNNEYHGDEHLLDDDEYAPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI*
Ga0115565_1051308933300009467Pelagic MarineTGVFYMTRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNL*
Ga0115571_123067453300009495Pelagic MarineEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNL*
Ga0115564_1037418913300009505Pelagic MarineMKNNEYHGDEHLLDDDEYAPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI*
Ga0115564_1062515733300009505Pelagic MarineMTRNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLEKQREKTNDNL*
Ga0098061_105942313300010151MarineIGVFNMKNNEYHGDEHILDEDEYPPMQQWEIDEALADILGDDRWLQRQQEKAE*
Ga0129324_1010040043300010368Freshwater To Marine Saline GradientMTRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQKAKTNVDI*
Ga0114922_1091631843300011118Deep SubsurfaceGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI*
Ga0114922_1132748433300011118Deep SubsurfaceMTRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDRWLEKQQAKTNDNL*
Ga0151676_107104933300011251MarineMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNL*
Ga0129331_111411653300012524AqueousMTRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQARTNDNL*
Ga0129331_118635413300012524AqueousHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI*
Ga0163180_1044907233300012952SeawaterMTRNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI*
Ga0129332_114907513300012969AqueousGVFYMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQARTNDNL*
Ga0129327_1031076453300013010Freshwater To Marine Saline GradientEHLLDDDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNI*
Ga0129327_1043236933300013010Freshwater To Marine Saline GradientMKNNEYHGDEHLLDDDEYPPMQQWEINEALADIIGDDKWLEKQQAKTNDNI*
Ga0180120_1027772733300017697Freshwater To Marine Saline GradientMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLAKQQAKTNDN
Ga0181431_100823463300017735SeawaterEYHGDEHLLDDDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNI
Ga0181431_105636053300017735SeawaterMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADILGDDKWLEKQQA
Ga0181399_108113933300017742SeawaterMRNNEYHGDEHILDEDEYPPMQQWEIDEALADILGDEKWLEKQREKTNDNL
Ga0181402_112686823300017743SeawaterMRNNEYHGDEHILDEDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNL
Ga0181392_118514623300017749SeawaterMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLAKQQAKTNDNL
Ga0181400_115626233300017752SeawaterMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQ
Ga0181400_121666923300017752SeawaterMRNNEYHGDEHILDEDEYPPMQQWEIDDALADILGDDKWLEKQQAKTNDNL
Ga0181406_118711023300017767SeawaterMKNNEYHGDEHILDEDEYPPMQQWEIDDALADILGDDKWLEKQQAKTNDNI
Ga0206128_121281833300020166SeawaterMTRNNEYHGDEHLLDDHEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI
Ga0206124_1003377573300020175SeawaterMRNNEYHGDEHILDEDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNI
Ga0206131_1008217223300020185SeawaterMTRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI
Ga0206131_1020029913300020185SeawaterLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQARTNDNL
Ga0206130_1009727663300020187SeawaterMTRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQARTNDNL
Ga0206682_1013561253300021185SeawaterMRNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI
Ga0213869_1026322943300021375SeawaterMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI
Ga0213869_1031764823300021375SeawaterMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDEKWLEKQQAKTNDNI
Ga0213861_1001028553300021378SeawaterMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLAKQQAKTNDNI
Ga0213861_1023520633300021378SeawaterMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNI
Ga0222717_1008337713300021957Estuarine WaterMKNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLAKQQAKTNDNI
Ga0222717_1022764013300021957Estuarine WaterYTGVFYMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLAKQQAKTNDNI
Ga0222716_1016658763300021959Estuarine WaterMKNNEYHGDEHILDEDEYPPMQQWEIDEALADILGDDKWLAKQQAKTNDNL
Ga0222716_1062057323300021959Estuarine WaterMKNNEYHGDEHILDEDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNI
Ga0222715_1032270643300021960Estuarine WaterYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLAKQQAKTNDNI
Ga0212030_102484233300022053AqueousMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDRWLEKQREKTNDNL
Ga0196889_1004508103300022072AqueousMTRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNL
Ga0196889_100796743300022072AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGEDKWLEKQQAKTNDNI
Ga0196889_101690053300022072AqueousMKNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNL
Ga0196889_107776633300022072AqueousMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNL
Ga0212022_104240813300022164AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADILGDDKWL
Ga0196903_101269623300022169AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQRAKTNDNL
Ga0196903_102323433300022169AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAK
Ga0196903_102990123300022169AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDN
Ga0196903_103133223300022169AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKW
Ga0196887_103861943300022178AqueousMTRNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLEKQREKTNDNI
Ga0196887_104802543300022178AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNV
Ga0196887_105064453300022178AqueousMRNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLAKQQAKTNDNI
Ga0228696_1000094123300023568SeawaterFYMKNNEYHGDEHILDEDEYPPMQQWEIDEALADILGDDRWLQRQQEKAE
Ga0232119_100014743300023702SeawaterMKNNEYHGDERILDEDEYPPMQQWEIDEALADILGDDRWLQRQQEKAE
Ga0228668_1000425113300024180SeawaterMKNNEYHGDEHILDEDEYPPMQQWEIDEALADILGDDRWLQRQQEKAE
(restricted) Ga0233444_1003099963300024264SeawaterMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNI
Ga0244775_1003686663300024346EstuarineMKNNEYHGDEHLLDEDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI
(restricted) Ga0255049_1025484613300024517SeawaterGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI
(restricted) Ga0255046_1056856913300024519SeawaterMKNNEYHGDEHILDEDEYPPMQQWEIDEALADILGDDKWLEKQRAKTNDNI
Ga0208148_109541413300025508AqueousMKNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLE
Ga0208303_100735923300025543AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNL
Ga0208303_1013252103300025543AqueousMTRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQKAKTNVDI
Ga0208303_104542333300025543AqueousMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDRWLEKQQAKTNDNI
Ga0208303_111676313300025543AqueousDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI
Ga0208643_108316023300025645AqueousMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNL
Ga0208545_110661513300025806AqueousFYMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI
Ga0209199_115028223300025809Pelagic MarineMKNNEYHGDEHLLDDDEYAPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI
Ga0209199_115516923300025809Pelagic MarineMRNNEYHGDEHLLDDDEYAPMQQWEIDEALADIIGDDKWLEKQREKTNDNL
Ga0209199_127098413300025809Pelagic MarineMTRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKTTGENQ
Ga0209307_121181133300025832Pelagic MarineTGVFYMTRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNI
Ga0208644_140156413300025889AqueousNEYHGDEHLLDDDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNI
(restricted) Ga0255041_1032165333300027837SeawaterFYMRNNEYHGDEHILDEDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNI
(restricted) Ga0233415_1013292933300027861SeawaterMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKTTGENQ
(restricted) Ga0255055_1021826313300027881SeawaterHGDEHILDEDEYPPMQQWEIDEALADILGDDKWLEKQQAKTNDNI
Ga0316203_121732823300032274Microbial MatMRNNEYHGDEHILDEDEYPPMQQWEIDEALADIIGDDKWLEKQQAKTNDNL
Ga0316202_1004319963300032277Microbial MatMKNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGDDKWLEKQ
Ga0316202_1006003013300032277Microbial MatMRNNEYHGDEHLLDDDEYPPMQQWEIDEALADIIGD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.