| Basic Information | |
|---|---|
| Family ID | F066673 |
| Family Type | Metagenome |
| Number of Sequences | 126 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LTELSLGSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQL |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.79 % |
| % of genes near scaffold ends (potentially truncated) | 99.21 % |
| % of genes from short scaffolds (< 2000 bps) | 84.92 % |
| Associated GOLD sequencing projects | 87 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.49 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.413 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (27.778 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.587 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (59.524 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 29.85% β-sheet: 0.00% Coil/Unstructured: 70.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF03772 | Competence | 36.51 |
| PF01642 | MM_CoA_mutase | 3.17 |
| PF00316 | FBPase | 2.38 |
| PF14378 | PAP2_3 | 1.59 |
| PF00756 | Esterase | 0.79 |
| PF13495 | Phage_int_SAM_4 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0658 | DNA uptake channel protein ComEC, N-terminal domain | Intracellular trafficking, secretion, and vesicular transport [U] | 36.51 |
| COG1884 | Methylmalonyl-CoA mutase, N-terminal domain/subunit | Lipid transport and metabolism [I] | 3.17 |
| COG0158 | Fructose-1,6-bisphosphatase | Carbohydrate transport and metabolism [G] | 2.38 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.41 % |
| Unclassified | root | N/A | 1.59 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300005166|Ga0066674_10445480 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005167|Ga0066672_10200377 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1272 | Open in IMG/M |
| 3300005172|Ga0066683_10109634 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
| 3300005172|Ga0066683_10146408 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1449 | Open in IMG/M |
| 3300005172|Ga0066683_10264510 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1067 | Open in IMG/M |
| 3300005172|Ga0066683_10430407 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 812 | Open in IMG/M |
| 3300005174|Ga0066680_10105680 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
| 3300005180|Ga0066685_10106926 | All Organisms → cellular organisms → Bacteria | 1874 | Open in IMG/M |
| 3300005181|Ga0066678_10484444 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 822 | Open in IMG/M |
| 3300005181|Ga0066678_10621448 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 719 | Open in IMG/M |
| 3300005181|Ga0066678_11072918 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005184|Ga0066671_10699017 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300005445|Ga0070708_100524262 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300005450|Ga0066682_10464620 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 803 | Open in IMG/M |
| 3300005450|Ga0066682_10550603 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005530|Ga0070679_100956133 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005545|Ga0070695_100871722 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300005549|Ga0070704_101241506 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 680 | Open in IMG/M |
| 3300005553|Ga0066695_10701298 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 593 | Open in IMG/M |
| 3300005556|Ga0066707_10190769 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1318 | Open in IMG/M |
| 3300005556|Ga0066707_10221238 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300005557|Ga0066704_10634899 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 681 | Open in IMG/M |
| 3300006046|Ga0066652_100608336 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1031 | Open in IMG/M |
| 3300006755|Ga0079222_10987190 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 721 | Open in IMG/M |
| 3300006791|Ga0066653_10152358 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1127 | Open in IMG/M |
| 3300006791|Ga0066653_10413152 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 690 | Open in IMG/M |
| 3300006791|Ga0066653_10431293 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 673 | Open in IMG/M |
| 3300006796|Ga0066665_10851230 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 712 | Open in IMG/M |
| 3300006796|Ga0066665_11032114 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300006797|Ga0066659_10013707 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4446 | Open in IMG/M |
| 3300006797|Ga0066659_10045744 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2733 | Open in IMG/M |
| 3300006797|Ga0066659_11314349 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 603 | Open in IMG/M |
| 3300006845|Ga0075421_100149174 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2922 | Open in IMG/M |
| 3300006847|Ga0075431_100373647 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1430 | Open in IMG/M |
| 3300006852|Ga0075433_10270214 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1507 | Open in IMG/M |
| 3300006854|Ga0075425_100044289 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4972 | Open in IMG/M |
| 3300006854|Ga0075425_102318547 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006854|Ga0075425_102396009 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 586 | Open in IMG/M |
| 3300006871|Ga0075434_102307961 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 541 | Open in IMG/M |
| 3300006914|Ga0075436_100119057 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1846 | Open in IMG/M |
| 3300006914|Ga0075436_100323776 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300007004|Ga0079218_13597803 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 526 | Open in IMG/M |
| 3300009012|Ga0066710_100966971 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1313 | Open in IMG/M |
| 3300009012|Ga0066710_102761808 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 697 | Open in IMG/M |
| 3300009012|Ga0066710_103002628 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 657 | Open in IMG/M |
| 3300009012|Ga0066710_103033696 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 652 | Open in IMG/M |
| 3300009012|Ga0066710_104387749 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 527 | Open in IMG/M |
| 3300009038|Ga0099829_11487880 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 559 | Open in IMG/M |
| 3300009089|Ga0099828_10084479 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2717 | Open in IMG/M |
| 3300009089|Ga0099828_10995801 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 747 | Open in IMG/M |
| 3300009090|Ga0099827_10262602 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1454 | Open in IMG/M |
| 3300009137|Ga0066709_102538093 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 689 | Open in IMG/M |
| 3300009147|Ga0114129_12362098 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 637 | Open in IMG/M |
| 3300009156|Ga0111538_11211446 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300009162|Ga0075423_11840225 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300009597|Ga0105259_1188315 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 503 | Open in IMG/M |
| 3300010303|Ga0134082_10013722 | All Organisms → cellular organisms → Bacteria | 2939 | Open in IMG/M |
| 3300010303|Ga0134082_10360548 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 617 | Open in IMG/M |
| 3300010304|Ga0134088_10303900 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 771 | Open in IMG/M |
| 3300010304|Ga0134088_10307954 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300010323|Ga0134086_10280291 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 642 | Open in IMG/M |
| 3300010323|Ga0134086_10421488 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 540 | Open in IMG/M |
| 3300010325|Ga0134064_10132498 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 848 | Open in IMG/M |
| 3300010333|Ga0134080_10700837 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 502 | Open in IMG/M |
| 3300010335|Ga0134063_10612525 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 555 | Open in IMG/M |
| 3300011270|Ga0137391_10085094 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2731 | Open in IMG/M |
| 3300012200|Ga0137382_10107483 | All Organisms → cellular organisms → Bacteria | 1849 | Open in IMG/M |
| 3300012203|Ga0137399_10008358 | All Organisms → cellular organisms → Bacteria | 6018 | Open in IMG/M |
| 3300012203|Ga0137399_10114935 | All Organisms → cellular organisms → Bacteria | 2105 | Open in IMG/M |
| 3300012203|Ga0137399_10511584 | All Organisms → cellular organisms → Bacteria | 1007 | Open in IMG/M |
| 3300012203|Ga0137399_11673834 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300012228|Ga0137459_1197031 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 589 | Open in IMG/M |
| 3300012349|Ga0137387_10568553 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 822 | Open in IMG/M |
| 3300012349|Ga0137387_11258161 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300012351|Ga0137386_10645138 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 762 | Open in IMG/M |
| 3300012354|Ga0137366_10066805 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas | 2742 | Open in IMG/M |
| 3300012356|Ga0137371_11381453 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 517 | Open in IMG/M |
| 3300012896|Ga0157303_10031351 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
| 3300012922|Ga0137394_10528988 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1000 | Open in IMG/M |
| 3300012922|Ga0137394_11229726 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 612 | Open in IMG/M |
| 3300012925|Ga0137419_10349320 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1144 | Open in IMG/M |
| 3300012929|Ga0137404_11862780 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 560 | Open in IMG/M |
| 3300012930|Ga0137407_11592688 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012931|Ga0153915_10473437 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1429 | Open in IMG/M |
| 3300012972|Ga0134077_10199910 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 814 | Open in IMG/M |
| 3300012975|Ga0134110_10213786 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 812 | Open in IMG/M |
| 3300012976|Ga0134076_10281434 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 716 | Open in IMG/M |
| 3300012977|Ga0134087_10548285 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 590 | Open in IMG/M |
| 3300015245|Ga0137409_10147809 | All Organisms → cellular organisms → Bacteria | 2151 | Open in IMG/M |
| 3300015358|Ga0134089_10161215 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 889 | Open in IMG/M |
| 3300015358|Ga0134089_10519948 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 524 | Open in IMG/M |
| 3300017654|Ga0134069_1269979 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 596 | Open in IMG/M |
| 3300017657|Ga0134074_1017632 | All Organisms → cellular organisms → Bacteria | 2341 | Open in IMG/M |
| 3300017657|Ga0134074_1161117 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 787 | Open in IMG/M |
| 3300017659|Ga0134083_10269235 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 717 | Open in IMG/M |
| 3300018063|Ga0184637_10615556 | Not Available | 611 | Open in IMG/M |
| 3300018431|Ga0066655_10005834 | All Organisms → cellular organisms → Bacteria | 5041 | Open in IMG/M |
| 3300018431|Ga0066655_10085955 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1726 | Open in IMG/M |
| 3300018431|Ga0066655_10393458 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 914 | Open in IMG/M |
| 3300018468|Ga0066662_10223604 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1512 | Open in IMG/M |
| 3300018482|Ga0066669_11747965 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 573 | Open in IMG/M |
| 3300020170|Ga0179594_10293124 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 616 | Open in IMG/M |
| 3300024178|Ga0247694_1043633 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium 13_1_40CM_4_69_5 | 508 | Open in IMG/M |
| 3300025885|Ga0207653_10393911 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 543 | Open in IMG/M |
| 3300025910|Ga0207684_11165513 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 639 | Open in IMG/M |
| 3300026307|Ga0209469_1017462 | All Organisms → cellular organisms → Bacteria | 2567 | Open in IMG/M |
| 3300026327|Ga0209266_1018921 | All Organisms → cellular organisms → Bacteria | 3849 | Open in IMG/M |
| 3300026343|Ga0209159_1006366 | All Organisms → cellular organisms → Bacteria | 7415 | Open in IMG/M |
| 3300026536|Ga0209058_1239298 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 652 | Open in IMG/M |
| 3300026540|Ga0209376_1009868 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 7162 | Open in IMG/M |
| 3300026540|Ga0209376_1051838 | All Organisms → cellular organisms → Bacteria | 2356 | Open in IMG/M |
| 3300026547|Ga0209156_10322846 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 688 | Open in IMG/M |
| 3300026547|Ga0209156_10382442 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 594 | Open in IMG/M |
| 3300027273|Ga0209886_1063657 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 585 | Open in IMG/M |
| 3300027787|Ga0209074_10148250 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 842 | Open in IMG/M |
| 3300028072|Ga0247675_1006037 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
| 3300028715|Ga0307313_10270824 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300028796|Ga0307287_10185343 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300028807|Ga0307305_10328144 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300030620|Ga0302046_10832979 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 741 | Open in IMG/M |
| 3300031547|Ga0310887_11138998 | Not Available | 502 | Open in IMG/M |
| 3300031965|Ga0326597_11582404 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 625 | Open in IMG/M |
| 3300032180|Ga0307471_103099546 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 589 | Open in IMG/M |
| 3300032828|Ga0335080_10708555 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300032829|Ga0335070_11786709 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 556 | Open in IMG/M |
| 3300032955|Ga0335076_10067994 | All Organisms → cellular organisms → Bacteria | 3510 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 27.78% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 15.08% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 9.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 8.73% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.76% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.97% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.38% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.59% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.79% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.79% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.79% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012228 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2 | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300027273 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300028072 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK16 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0066674_104454801 | 3300005166 | Soil | PHYVSTRQGEILTALSLGSAGEMARLDVALLEGFHKVALAPRCGAKPIQL* |
| Ga0066672_102003772 | 3300005167 | Soil | HQGEVLTELSLASDQERAKLDVVLLEGFRKVGLAPRCGAKPVQPV* |
| Ga0066683_101096341 | 3300005172 | Soil | EILTELSLASDGEKAKLDVALLEAFKKVALAPRCGAKPTQL* |
| Ga0066683_101464081 | 3300005172 | Soil | QGEVLTELRLDSDQEKARLDVALLDGFRKVGLAPRCGAKPLQLM* |
| Ga0066683_102645101 | 3300005172 | Soil | TPQGEVLVELRLDSDQEKAKLDVALLEGFGKVGLAPRCGAKPVQLI* |
| Ga0066683_104304072 | 3300005172 | Soil | EVLTELNLDTDQERAKLDVILLEGLRKVALAPRCGAKSVQLM* |
| Ga0066680_101056801 | 3300005174 | Soil | VLTELSLTSDQERAKLDVVLLEGFRKVALAPRCGAKPVQLL* |
| Ga0066685_101069262 | 3300005180 | Soil | VELRLDSDQEKAKLDVALLDAFRRVGLAPRCGARSVQLL* |
| Ga0066678_104844441 | 3300005181 | Soil | LTELNLDTDQERAKLDVILLEGLCKVALAPRCGAKPVQLM* |
| Ga0066678_106214482 | 3300005181 | Soil | VLVELRLDSDQEKAKLDVALLDGFRRVGLAPRCGARPVQLM* |
| Ga0066678_110729182 | 3300005181 | Soil | LTELSLGSDQEKARLDVALVEGIRKVALAPRCGAKPTQL* |
| Ga0066671_106990171 | 3300005184 | Soil | GEILTELSLASDQEKAKLDVGLLEGFRKVALAPRCGAKPAQL* |
| Ga0070708_1005242621 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | EILTELSLASDQEKAKLDVALLEGFRKVALAPRCGAKPSQL* |
| Ga0066682_104646201 | 3300005450 | Soil | EVLVELRLDSDQEKAKLDVALLEGFGKVGLAPRCGAKPVQLI* |
| Ga0066682_105506032 | 3300005450 | Soil | LTELSLASDGEKAKLDVALLEAFKKVALAPRCGAKPTQL* |
| Ga0070679_1009561332 | 3300005530 | Corn Rhizosphere | QGEILTELSLASDGEKAKLDVALLEGFRKVAIAPRCGAKPVQL* |
| Ga0070695_1008717222 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | STRQGEILTELSLQSDGEKARLDVALLEGFKRVALAPRCGAKPSQL* |
| Ga0070704_1012415061 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VSTRQGEILTELSLASDQEKARLDVTLLDGFRKVAAAPRCGAKPTHL* |
| Ga0066695_107012982 | 3300005553 | Soil | GSDQEKAKLDVVLLEGFRKVGLAPRCGAKPVQLV* |
| Ga0066707_101907692 | 3300005556 | Soil | LVELRLDSDQEKAKLDVALLDAFRRVGLAPRCGARSVQLL* |
| Ga0066707_102212382 | 3300005556 | Soil | LDTDQEKAKLDVVLLEGFRKVAAAPRCGSKPVTL* |
| Ga0066704_106348992 | 3300005557 | Soil | LNLDTDQERAKLDVILLEGLCKVALAPRCGAKPVQLM* |
| Ga0066652_1006083361 | 3300006046 | Soil | DSDQEKAKLDVALLEGFGKVGLAPRCGAKPVQLI* |
| Ga0079222_109871902 | 3300006755 | Agricultural Soil | QGEVLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQLM* |
| Ga0066653_101523581 | 3300006791 | Soil | LGSDQEKAKLDVVLLEGFRKVGLAPRCGAKPVQLV* |
| Ga0066653_104131522 | 3300006791 | Soil | LTELSLEPDQERAKLDVVLLEGLRKVALAPRCGAKSVQLM* |
| Ga0066653_104312931 | 3300006791 | Soil | REGEVTTAINLDTDQEKAKLDVVLLEGFRKVAAAPRCGTKPVTL* |
| Ga0066665_108512302 | 3300006796 | Soil | GEVLVELRLDSDQEKAKLDVALLEGFGKVGLAPRCGAKPVQLI* |
| Ga0066665_110321141 | 3300006796 | Soil | QGEILTALSLGSAGEMARLDVALLEGFHKVALAPRCGAKPIQL* |
| Ga0066659_100137071 | 3300006797 | Soil | EVLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM* |
| Ga0066659_100457443 | 3300006797 | Soil | STRHGEILTELSLARHQEKAKLDVALLEGFRKVALAPRCGAKPSQL* |
| Ga0066659_113143491 | 3300006797 | Soil | GEVLVELRLDSDQEKAKLDVALLDGFRRVGLAPRCGARPVQLM* |
| Ga0075421_1001491744 | 3300006845 | Populus Rhizosphere | LGSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQL* |
| Ga0075431_1003736471 | 3300006847 | Populus Rhizosphere | QGEILTELSLGSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQL* |
| Ga0075433_102702141 | 3300006852 | Populus Rhizosphere | PQGEVLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM* |
| Ga0075425_1000442894 | 3300006854 | Populus Rhizosphere | PHYVSTRAGEILTGLTMGTDQETAKVTVILIEGFRRVALAPRCGAKPVTLA* |
| Ga0075425_1023185471 | 3300006854 | Populus Rhizosphere | LQSDQEKAKLDVALLEGFRKVAMAPRCGAKPIQL* |
| Ga0075425_1023960091 | 3300006854 | Populus Rhizosphere | SLGSDQERAKLSVVLIDGFRRVALTPRCGAKPVRLP* |
| Ga0075434_1023079612 | 3300006871 | Populus Rhizosphere | VELRLDSDQEKAKLDVALLDGFRRVGLAPRCGAKSVQLL* |
| Ga0075436_1001190571 | 3300006914 | Populus Rhizosphere | GEVLVELRLDSDQEKAKLDVALLDGFRKVGLAPRCGARPVQLM* |
| Ga0075436_1003237762 | 3300006914 | Populus Rhizosphere | ELSLGSDQEKAKLDVALVEGIRKVALAPRCGAKPTQL* |
| Ga0079218_135978032 | 3300007004 | Agricultural Soil | TSQGEVLVEVALSSDQSKATLDVVLMEALHKVAAAPRCGAKPVALP* |
| Ga0066710_1009669712 | 3300009012 | Grasslands Soil | LSPHYVSTRQGEVLTELSLGSDQERAKLSVVLIDGFRRVGLTPRCGAKPMRLP |
| Ga0066710_1027618081 | 3300009012 | Grasslands Soil | TELSLTSDQERAKLDVVLLEGFRKVALAPRCGAKPVQLV |
| Ga0066710_1030026281 | 3300009012 | Grasslands Soil | NLESDQERAKLDVVLLEAFRKVGLAPRCGAKPVQLM |
| Ga0066710_1030336962 | 3300009012 | Grasslands Soil | TPQGEVLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM |
| Ga0066710_1043877492 | 3300009012 | Grasslands Soil | ELSLTSDQERAKLDVVLLEGLSKVGLAPRCGAKPVQLV |
| Ga0099829_114878802 | 3300009038 | Vadose Zone Soil | QGEVLTELSLGSDQERAKLSVVLIDGFRRIGLTPRCGAKPMRLP* |
| Ga0099828_100844791 | 3300009089 | Vadose Zone Soil | ELSLSSDQEMAKLDVVLLEGFHKVAMAPRCGAKPVQLV* |
| Ga0099828_109958012 | 3300009089 | Vadose Zone Soil | HYVSTRQGEILTELSLSSDQEMAKLDVVLLEGFRKVGMAPRCGAKPVQLV* |
| Ga0099827_102626021 | 3300009090 | Vadose Zone Soil | VSTLQGEVLTEISLGSDQEKARLDVVLLEGFRRVALAPRCGAKSVQLM* |
| Ga0066709_1025380932 | 3300009137 | Grasslands Soil | ELRLDSDQEKAKLDVALLDGFRRVGLAPRCGARPVQLM* |
| Ga0114129_123620982 | 3300009147 | Populus Rhizosphere | VSTRQGEILTELSLASDQEKAKLDVALLEGFGKVALAPRCGAKPVQL* |
| Ga0111538_112114462 | 3300009156 | Populus Rhizosphere | TRQGEILTGLSLDSDGEKAKLDVVLFEGFHKVARAPRCGAKPTQL* |
| Ga0075423_118402251 | 3300009162 | Populus Rhizosphere | LSLQSDGEKAKLDVALLEGFKRVALAPRCGAKPSQL* |
| Ga0105259_11883151 | 3300009597 | Soil | TRQGEILTELRLASDQEKARLDVALLEGFRRVAAAPRCGAKPSQL* |
| Ga0134082_100137221 | 3300010303 | Grasslands Soil | TRQGEVLTELNLDTDQERAKLDVILLEGLRKVAMAPRCGAKAVQLM* |
| Ga0134082_103605481 | 3300010303 | Grasslands Soil | TRQGEVLTELNLDTDQERAKLDVILLEGLRKVAMAPRCGAKPVQLM* |
| Ga0134088_103039001 | 3300010304 | Grasslands Soil | PQGEVLVELRLDSDQEKAKLDVALLEGFGKVGLAPRCGAKPVQLI* |
| Ga0134088_103079542 | 3300010304 | Grasslands Soil | LTELSLSSDQEMAKLDVVLLEGFRKVAMAPRCGAKPVQLV* |
| Ga0134086_102802912 | 3300010323 | Grasslands Soil | SLASDQEKAKLDVALLEGFRKVALAPRCGAKPSQL* |
| Ga0134086_104214882 | 3300010323 | Grasslands Soil | LDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM* |
| Ga0134064_101324981 | 3300010325 | Grasslands Soil | VLVELRLDSDQEKAKLDVALLEGFGKVGLAPRCGAKPVQLI* |
| Ga0134080_107008371 | 3300010333 | Grasslands Soil | LDTDQEKAKLDVVLLEGFRKVAAAPRCGTKPVTL* |
| Ga0134063_106125252 | 3300010335 | Grasslands Soil | SLTSDQERAKLDVVLLEGLSKVGLAPRCGAKPVQLV* |
| Ga0137391_100850941 | 3300011270 | Vadose Zone Soil | EILTELSLSSDQEMAKLDVVLLEGFRKVAMAPRCGAKPVQLV* |
| Ga0137382_101074831 | 3300012200 | Vadose Zone Soil | LGSAGEMARLDVALLEGFHKVALAPRCGAKPIQL* |
| Ga0137399_100083581 | 3300012203 | Vadose Zone Soil | QGEILTELSLASDQEKAKLDVALLEGFRKVALAPRCGAKPSQL* |
| Ga0137399_101149351 | 3300012203 | Vadose Zone Soil | QGEILTELSLASDQEKAKLDVALLEGFRKVAAAPRCGAKPSQL* |
| Ga0137399_105115842 | 3300012203 | Vadose Zone Soil | VSTRQGEILTELTLASDQEKAKLDVALLEGFRKVSAAPRCGAKPTQL* |
| Ga0137399_116738341 | 3300012203 | Vadose Zone Soil | QGEILTELSLASDQEKAKLDVALLEGFRKVAAAPRCGAKPSAL* |
| Ga0137459_11970312 | 3300012228 | Soil | LTELSLGSDQEKAKLDVALLEAFRKVGLAPRCGAKPVQLL* |
| Ga0137387_105685532 | 3300012349 | Vadose Zone Soil | ELRLGSDQEKAKLDVVLLEGFRKVGLAPRCGAKPVQLV* |
| Ga0137387_112581612 | 3300012349 | Vadose Zone Soil | AGEILTGLSLASDQESAKLTVILIEGFRKVALAPRCGAKPTQL* |
| Ga0137386_106451381 | 3300012351 | Vadose Zone Soil | LDSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQLM* |
| Ga0137366_100668053 | 3300012354 | Vadose Zone Soil | TELRLDSDQERAKLDVALLDGFRRVGLAPRCGARSVQLM* |
| Ga0137371_113814532 | 3300012356 | Vadose Zone Soil | QTDQERAKLDVILLEAFRKVALAPRCGAQPVQLM* |
| Ga0157303_100313511 | 3300012896 | Soil | QGEILTELSLASDQEKARLDVTLLDGFRKVAAAPRCGAKPTHL* |
| Ga0137394_105289882 | 3300012922 | Vadose Zone Soil | TELSLGSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQL* |
| Ga0137394_112297261 | 3300012922 | Vadose Zone Soil | MTELSLGSDQEKAKLDVALLEAFRKVGLAPRCGAKSVQLI* |
| Ga0137419_103493201 | 3300012925 | Vadose Zone Soil | APSYVSTPQGEVLVELRLDSDQEKARLDVALLEGFRKVALAPRCAAKPVQLM* |
| Ga0137404_118627802 | 3300012929 | Vadose Zone Soil | LDSDQEKAKLDVALLEGFRKVALAPRCAAKPVQLM* |
| Ga0137407_115926881 | 3300012930 | Vadose Zone Soil | ILTELSLGSDGEKARLDVALIEGFHKVALAPRCGAKPTQL* |
| Ga0153915_104734371 | 3300012931 | Freshwater Wetlands | TPQGEVLVELRLDSDQEKAKLDVALLDGFRRVGLAPRCGARPVQLL* |
| Ga0134077_101999102 | 3300012972 | Grasslands Soil | ELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM* |
| Ga0134110_102137861 | 3300012975 | Grasslands Soil | QGEVLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM* |
| Ga0134076_102814341 | 3300012976 | Grasslands Soil | VLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVHLM* |
| Ga0134087_105482852 | 3300012977 | Grasslands Soil | LRLDSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQLI* |
| Ga0137409_101478091 | 3300015245 | Vadose Zone Soil | TRQGEILTELSLASDGEKAKLDVALLEAFKKVALAPRCGAKPSQL* |
| Ga0134089_101612153 | 3300015358 | Grasslands Soil | LTELRLDSDQEKAKLDVALLDGFRKVGLAPRCGARPVQLL* |
| Ga0134089_105199482 | 3300015358 | Grasslands Soil | VLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM* |
| Ga0134069_12699792 | 3300017654 | Grasslands Soil | LVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM |
| Ga0134074_10176321 | 3300017657 | Grasslands Soil | GEILTELSLASDGEKAKLDVALLEAFKKVALAPRCGAKPTQL |
| Ga0134074_11611171 | 3300017657 | Grasslands Soil | VSTPQGEVLVELRLDSDQEKAKLDVALLEGFGKVGLAPRCEAKPVQLI |
| Ga0134083_102692352 | 3300017659 | Grasslands Soil | VLTELRLDSDQEKARLDVALLDGFRKVGLAPRCGAKPLQLM |
| Ga0184637_106155562 | 3300018063 | Groundwater Sediment | LGTDQEMAKLTVVLIEGYRRVALTPRCGAKPVTLA |
| Ga0066655_100058341 | 3300018431 | Grasslands Soil | TRQGEVLTELNLDTDQERAKLDVILLEGLRKVAMAPRCGAKPVQLM |
| Ga0066655_100859551 | 3300018431 | Grasslands Soil | VLVELRLDSDQEKARLDVALLEGFRKVGLAPRCGARPVQLM |
| Ga0066655_103934582 | 3300018431 | Grasslands Soil | TELRLDSDQEKARLDVALLDGFRKVGLAPRCGAKPLQLM |
| Ga0066662_102236042 | 3300018468 | Grasslands Soil | GEVLTELRLGSDQEKAKLDVVLLEGFRKVGLAPRCGAKPVQLV |
| Ga0066669_117479652 | 3300018482 | Grasslands Soil | SLDTDQERARLDVVLLEAFRKVSLAPRCGALPAQLM |
| Ga0179594_102931241 | 3300020170 | Vadose Zone Soil | RLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM |
| Ga0247694_10436331 | 3300024178 | Soil | LTELSLGTDQQRAKLDVVLMEGFRKVAIAPRCGAKPAQLA |
| Ga0207653_103939111 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | VELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARSVQLM |
| Ga0207684_111655131 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | STRQGEILTELSLQSDGEKARLDVALLEGFKRVALAPRCGAKPSQL |
| Ga0209469_10174623 | 3300026307 | Soil | STRQGEVLTELNLDTDQERAKLDVILLEGLRKVAMAPRCGAKPVQLM |
| Ga0209266_10189214 | 3300026327 | Soil | QGEILTELSLASDGEKAKLDVALLEAFKKVALAPRCGAKPTQL |
| Ga0209159_10063661 | 3300026343 | Soil | RLGSDQEKAKLDVVLLEGFRKVGLAPRCGAKPVQLV |
| Ga0209058_12392982 | 3300026536 | Soil | EVLVELRLDSDQEKARLDVALLEGFRKVGLAPRCGARPVQLM |
| Ga0209376_10098686 | 3300026540 | Soil | LDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM |
| Ga0209376_10518382 | 3300026540 | Soil | TPQGEVLVELRLDSDQEKAKLDVALLEGFGKVGLAPRCGAKPVQLI |
| Ga0209156_103228461 | 3300026547 | Soil | LVELRLDSDQEKAKLDVALLDGFRRVGLAPRCGARPVQLM |
| Ga0209156_103824422 | 3300026547 | Soil | VLVELRLDSDQEKAKLDVALLEGFRKVGLAPRCGARPVQLM |
| Ga0209886_10636572 | 3300027273 | Groundwater Sand | QGEIHTELSLSTDQEKAKLDVVLLEGFRKIGLAPRCGAKPATVL |
| Ga0209074_101482501 | 3300027787 | Agricultural Soil | VLVELRLDSDQEKAKLDVALLDGFRRVGLAPRCGAKSVQLL |
| Ga0247675_10060371 | 3300028072 | Soil | TGITMGTDQETAKLTVILIEGFRRVALAPRCGAKPVTLP |
| Ga0307313_102708241 | 3300028715 | Soil | EILTELSLGSDGEKAKLDVALVEAFRKVALAPRCGAKPTQL |
| Ga0307287_101853432 | 3300028796 | Soil | QGEILTELSLGSDGEKAKLDVALVEAFRKVALAPRCGARPTQL |
| Ga0307305_103281442 | 3300028807 | Soil | LTELSLGSDQEKAKLDVALLEGFRKVGLAPRCGAKPVQL |
| Ga0302046_108329792 | 3300030620 | Soil | EISLSSDQEKARLDVVLMEGLRKVAFAPRCGAKPVNLA |
| Ga0310887_111389981 | 3300031547 | Soil | QGEILTEFSLASDQEKARLDVALLDGFRKVAAAPRCGAKPTHL |
| Ga0326597_115824041 | 3300031965 | Soil | LGTDQEMAKLTVVLIEGYRRVALAPRCGAKPVTLA |
| Ga0307471_1030995461 | 3300032180 | Hardwood Forest Soil | RLDSDQEKAKLDVALLDGFRRVGLAPRCGAKSVQLL |
| Ga0335080_107085552 | 3300032828 | Soil | LSLSTDQARAKTDVVLMEGFRKVALAPRCGAAPVQLP |
| Ga0335070_117867092 | 3300032829 | Soil | GEVLTELSLGSDQEKAKLDVVLLEGFRKVALAPRCGAQPVQLL |
| Ga0335076_100679943 | 3300032955 | Soil | VLTGISLETDQEKAKLDVVLLEAFRKVALAPRCGARAVQLM |
| ⦗Top⦘ |