| Basic Information | |
|---|---|
| Family ID | F066671 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 42 residues |
| Representative Sequence | RRFSIRPAQVDYLLTRFNEFGTGAQTQNNLRVSTGIVFHF |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.79 % |
| % of genes near scaffold ends (potentially truncated) | 99.21 % |
| % of genes from short scaffolds (< 2000 bps) | 90.48 % |
| Associated GOLD sequencing projects | 104 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.25 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.825 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (31.746 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.556 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.25 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF03544 | TonB_C | 73.02 |
| PF13468 | Glyoxalase_3 | 1.59 |
| PF03641 | Lysine_decarbox | 1.59 |
| PF06155 | GBBH-like_N | 0.79 |
| PF02245 | Pur_DNA_glyco | 0.79 |
| PF01663 | Phosphodiest | 0.79 |
| PF13505 | OMP_b-brl | 0.79 |
| PF00069 | Pkinase | 0.79 |
| PF01553 | Acyltransferase | 0.79 |
| PF12543 | DUF3738 | 0.79 |
| PF04140 | ICMT | 0.79 |
| PF03992 | ABM | 0.79 |
| PF01048 | PNP_UDP_1 | 0.79 |
| PF13701 | DDE_Tnp_1_4 | 0.79 |
| PF00486 | Trans_reg_C | 0.79 |
| PF00195 | Chal_sti_synt_N | 0.79 |
| PF12680 | SnoaL_2 | 0.79 |
| PF08238 | Sel1 | 0.79 |
| PF00106 | adh_short | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 73.02 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 3.17 |
| COG1611 | Nucleotide monophosphate nucleosidase PpnN/YdgH, Lonely Guy (LOG) family | Nucleotide transport and metabolism [F] | 1.59 |
| COG0332 | 3-oxoacyl-[acyl-carrier-protein] synthase III | Lipid transport and metabolism [I] | 0.79 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.79 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.79 |
| COG2094 | 3-methyladenine DNA glycosylase Mpg | Replication, recombination and repair [L] | 0.79 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.79 |
| COG3424 | Predicted naringenin-chalcone synthase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.79 |
| COG3536 | Uncharacterized conserved protein, DUF971 family | Function unknown [S] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.83 % |
| Unclassified | root | N/A | 3.17 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_107670478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1777 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101514031 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 566 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101636645 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300002907|JGI25613J43889_10025321 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1678 | Open in IMG/M |
| 3300002917|JGI25616J43925_10091153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 1266 | Open in IMG/M |
| 3300003368|JGI26340J50214_10000512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 13565 | Open in IMG/M |
| 3300004082|Ga0062384_100538452 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 780 | Open in IMG/M |
| 3300004479|Ga0062595_102192705 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005186|Ga0066676_11029278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 546 | Open in IMG/M |
| 3300005332|Ga0066388_108283287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300005436|Ga0070713_100458461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1198 | Open in IMG/M |
| 3300005440|Ga0070705_100089027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_40CM_4_57_6 | 1918 | Open in IMG/M |
| 3300005467|Ga0070706_101374929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 647 | Open in IMG/M |
| 3300005518|Ga0070699_101578191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 601 | Open in IMG/M |
| 3300005541|Ga0070733_10718837 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300005591|Ga0070761_10388753 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300006755|Ga0079222_11421899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 644 | Open in IMG/M |
| 3300006796|Ga0066665_11079364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 612 | Open in IMG/M |
| 3300006797|Ga0066659_11322141 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300006904|Ga0075424_101356231 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300007258|Ga0099793_10052266 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1805 | Open in IMG/M |
| 3300007265|Ga0099794_10050953 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
| 3300009038|Ga0099829_10128132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2006 | Open in IMG/M |
| 3300009088|Ga0099830_10416523 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
| 3300009088|Ga0099830_11121553 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
| 3300009089|Ga0099828_10279130 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1501 | Open in IMG/M |
| 3300009089|Ga0099828_10320733 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1395 | Open in IMG/M |
| 3300009090|Ga0099827_11897486 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300009101|Ga0105247_10438472 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 939 | Open in IMG/M |
| 3300009137|Ga0066709_100974967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300009177|Ga0105248_11874982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 680 | Open in IMG/M |
| 3300009545|Ga0105237_10325510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1541 | Open in IMG/M |
| 3300009553|Ga0105249_11621262 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300009698|Ga0116216_10681321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 618 | Open in IMG/M |
| 3300010043|Ga0126380_11200121 | Not Available | 654 | Open in IMG/M |
| 3300010104|Ga0127446_1086110 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300010303|Ga0134082_10069662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1367 | Open in IMG/M |
| 3300010322|Ga0134084_10144820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300010358|Ga0126370_10396045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1133 | Open in IMG/M |
| 3300010360|Ga0126372_10971812 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300010362|Ga0126377_10513433 | Not Available | 1232 | Open in IMG/M |
| 3300010362|Ga0126377_11925762 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300010362|Ga0126377_12045009 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300010362|Ga0126377_12399751 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 603 | Open in IMG/M |
| 3300011120|Ga0150983_16563407 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1199 | Open in IMG/M |
| 3300011269|Ga0137392_10295980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1337 | Open in IMG/M |
| 3300011270|Ga0137391_10062483 | All Organisms → cellular organisms → Bacteria | 3190 | Open in IMG/M |
| 3300011270|Ga0137391_10509638 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1018 | Open in IMG/M |
| 3300011270|Ga0137391_11454865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 531 | Open in IMG/M |
| 3300011271|Ga0137393_10637448 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 913 | Open in IMG/M |
| 3300012096|Ga0137389_10257720 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300012189|Ga0137388_10449642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1195 | Open in IMG/M |
| 3300012198|Ga0137364_10336206 | Not Available | 1125 | Open in IMG/M |
| 3300012198|Ga0137364_10412790 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1011 | Open in IMG/M |
| 3300012201|Ga0137365_11252813 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300012202|Ga0137363_10530864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 990 | Open in IMG/M |
| 3300012203|Ga0137399_10019719 | All Organisms → cellular organisms → Bacteria | 4383 | Open in IMG/M |
| 3300012205|Ga0137362_11558570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 547 | Open in IMG/M |
| 3300012205|Ga0137362_11602876 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300012210|Ga0137378_11424621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 606 | Open in IMG/M |
| 3300012211|Ga0137377_11184250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 694 | Open in IMG/M |
| 3300012349|Ga0137387_10569824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300012357|Ga0137384_10859181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300012357|Ga0137384_11002126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300012361|Ga0137360_10696932 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 872 | Open in IMG/M |
| 3300012363|Ga0137390_10623184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1045 | Open in IMG/M |
| 3300012363|Ga0137390_11150637 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300012371|Ga0134022_1160287 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300012378|Ga0134025_1095013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300012407|Ga0134050_1308783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300012685|Ga0137397_10492544 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 913 | Open in IMG/M |
| 3300012901|Ga0157288_10310394 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012918|Ga0137396_10626422 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 795 | Open in IMG/M |
| 3300012922|Ga0137394_10396326 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1177 | Open in IMG/M |
| 3300012929|Ga0137404_10107014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2265 | Open in IMG/M |
| 3300012929|Ga0137404_10343501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1305 | Open in IMG/M |
| 3300012961|Ga0164302_10980218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 657 | Open in IMG/M |
| 3300014325|Ga0163163_13326710 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300015053|Ga0137405_1085355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300015053|Ga0137405_1108172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300015053|Ga0137405_1206463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300015241|Ga0137418_10379369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1159 | Open in IMG/M |
| 3300015358|Ga0134089_10248153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300016357|Ga0182032_11067860 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300017944|Ga0187786_10443234 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300017970|Ga0187783_10691193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300018482|Ga0066669_10321608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1268 | Open in IMG/M |
| 3300020579|Ga0210407_10834232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300020579|Ga0210407_10836980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300020579|Ga0210407_10993651 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300020580|Ga0210403_11532620 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300020583|Ga0210401_11620112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300021088|Ga0210404_10286055 | Not Available | 904 | Open in IMG/M |
| 3300021168|Ga0210406_10472590 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 995 | Open in IMG/M |
| 3300021170|Ga0210400_10002268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 18083 | Open in IMG/M |
| 3300021178|Ga0210408_10870973 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300021401|Ga0210393_11430526 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 552 | Open in IMG/M |
| 3300021402|Ga0210385_11245465 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300021420|Ga0210394_10809280 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 818 | Open in IMG/M |
| 3300021478|Ga0210402_10956905 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300021478|Ga0210402_11623843 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300021478|Ga0210402_11701166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 557 | Open in IMG/M |
| 3300026285|Ga0209438_1138404 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 648 | Open in IMG/M |
| 3300026304|Ga0209240_1127819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 854 | Open in IMG/M |
| 3300026315|Ga0209686_1152178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
| 3300026329|Ga0209375_1187185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 808 | Open in IMG/M |
| 3300026333|Ga0209158_1136357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 908 | Open in IMG/M |
| 3300026333|Ga0209158_1332999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300026342|Ga0209057_1004805 | All Organisms → cellular organisms → Bacteria | 9527 | Open in IMG/M |
| 3300026359|Ga0257163_1058824 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300026481|Ga0257155_1078513 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 535 | Open in IMG/M |
| 3300026555|Ga0179593_1123884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2541 | Open in IMG/M |
| 3300027548|Ga0209523_1070093 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 722 | Open in IMG/M |
| 3300027603|Ga0209331_1071399 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300027610|Ga0209528_1088680 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 684 | Open in IMG/M |
| 3300027775|Ga0209177_10038611 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1296 | Open in IMG/M |
| 3300027812|Ga0209656_10010216 | All Organisms → cellular organisms → Bacteria | 5926 | Open in IMG/M |
| 3300029636|Ga0222749_10173955 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300030399|Ga0311353_11701982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300030991|Ga0073994_11675755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_4_56_7 | 846 | Open in IMG/M |
| 3300031715|Ga0307476_10074989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2352 | Open in IMG/M |
| 3300031753|Ga0307477_10024480 | All Organisms → cellular organisms → Bacteria | 4123 | Open in IMG/M |
| 3300031754|Ga0307475_10064963 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2778 | Open in IMG/M |
| 3300031820|Ga0307473_10355313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 944 | Open in IMG/M |
| 3300032261|Ga0306920_100684009 | All Organisms → cellular organisms → Bacteria | 1513 | Open in IMG/M |
| 3300032770|Ga0335085_11473803 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 710 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 31.75% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.35% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 5.56% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.76% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.76% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.17% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.38% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.59% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.59% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.59% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.79% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.79% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012371 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012378 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012407 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027548 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1076704784 | 3300000955 | Soil | DAKLAKHFSIRPVKVDYLLTRFAAAGADPQSQKNLRVSTGVVF |
| JGIcombinedJ26739_1015140312 | 3300002245 | Forest Soil | GIDYRLSEHFSLRPAKVDYLLTRFNEFGNTNRQTQNNLRVSTGIVFRF* |
| JGIcombinedJ26739_1016366451 | 3300002245 | Forest Soil | HFSLRPLEVDYLPTRFPEAGFGRQTQDNLRASTGIVFHF* |
| JGI25613J43889_100253213 | 3300002907 | Grasslands Soil | RLNSRFSIRPAKVDYLLTRFNEFGNTNRQTQNNLRVSTGIVFRF* |
| JGI25616J43925_100911531 | 3300002917 | Grasslands Soil | SRFSIRPAKVDYLLTRFNEFGNTNRQTQNNLRVSTGIVFRF* |
| JGI26340J50214_100005121 | 3300003368 | Bog Forest Soil | GFDLRINHHWSLRPLDVDYLPTRFPELTNGRQTQNNLRASTGIVFSF* |
| Ga0062384_1005384521 | 3300004082 | Bog Forest Soil | GGGVDYRINNRFSLRPLEVDYLMTRFPEGTPNNQTQDNLRASTGIVIHF* |
| Ga0062595_1021927051 | 3300004479 | Soil | FDVKLAKHFSVRPVKVDYLLTRFAAAGADPQSQKNLRVSTGVVFNF* |
| Ga0066676_110292781 | 3300005186 | Soil | DHFAVRPVKVDYLMTRFSETGTGANTQNNLRVSTGIVFRF* |
| Ga0066388_1082832871 | 3300005332 | Tropical Forest Soil | VTHHFSLRPIEVDYLLTRFNEFGSGAQNQNNLRVSTGVVFHF* |
| Ga0070713_1004584612 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | RFSIRPVQVDYLMTHFNEFGTGAQNQNNLRVSTGVVFHF* |
| Ga0070705_1000890272 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LAKHFSVRPVKVDYLLTRFAATGAAPQSQKNLRVSTGVVFNF* |
| Ga0070706_1013749291 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VDFKVSHRFSIRPVQVDYLMTHFNELGLGAQNQNNLRVSTGVV |
| Ga0070699_1015781912 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | FAMTIGGGIDYRLNQHFSIRPAKVDYLFTHFNEFNSTNAQSQNNLRVSTGIVFRF* |
| Ga0070733_107188372 | 3300005541 | Surface Soil | INNRFSLRPLQVDYLLTRFAEGAANNQTQNNLRASTGIVIHF* |
| Ga0070761_103887532 | 3300005591 | Soil | NNRFSLRPLEVDYLMTRFPEGTPNNQTQDNLRASTGIVIHF* |
| Ga0079222_114218992 | 3300006755 | Agricultural Soil | IRPLQFDYLLTHLPEIGNGNNQTQNNLRVSTGIVFHFK* |
| Ga0066665_110793642 | 3300006796 | Soil | QFDYLLTHFPEIANGNNQTQNNLRVSTGIVLHFK* |
| Ga0066659_113221412 | 3300006797 | Soil | LKVSGRFSLRPVQVDYLLTRFNELGLGAKDQNNLRVSTGVVFHF* |
| Ga0075424_1013562311 | 3300006904 | Populus Rhizosphere | HFSVRPVKVDYLLTRFAAAGADPQSQKNLRVSTGVVFDF* |
| Ga0099793_100522661 | 3300007258 | Vadose Zone Soil | LTDHFAVRPVKVDYLMTRFSETGTGANTQNNLRVSTGIVFRF* |
| Ga0099794_100509531 | 3300007265 | Vadose Zone Soil | GVDYRLSSRFSIRPAQVEYLLTRFNEFTDPRAQSQNNLRVSTGIVFRF* |
| Ga0099829_101281324 | 3300009038 | Vadose Zone Soil | FSIRPLKVDYLMTRFPEGTASNQTQNNLRVSTGILVHF* |
| Ga0099830_104165232 | 3300009088 | Vadose Zone Soil | RDRFSIRPLQFDYLLTHFPEGASGNNLTQNNLRVSTGIVFHFK* |
| Ga0099830_111215531 | 3300009088 | Vadose Zone Soil | SIRPLQFDYLLTHFPEVNNGHNLTQNNLRVSTGIVFHFK* |
| Ga0099828_102791303 | 3300009089 | Vadose Zone Soil | RDRFSIRPLQFDYLLTHLPEIANGNSQTQNNLRVSTGIVFHFK* |
| Ga0099828_103207331 | 3300009089 | Vadose Zone Soil | PLQFDYLLTHFPEGASGNNLTQNNLRVSTGIVFHFK* |
| Ga0099827_118974862 | 3300009090 | Vadose Zone Soil | TDRLAIRPVKLDYLITRFPETGSGAQTQNNLRVSTGIVFRF* |
| Ga0105247_104384721 | 3300009101 | Switchgrass Rhizosphere | VSHRFSLRPVQVDYLLTRFNEFGNGAQNQNNLRVSTGVVFHF* |
| Ga0066709_1009749672 | 3300009137 | Grasslands Soil | SIRPLQFDYLLTHFPEVTNGNNQTQNNLRVSTGIVFHFK* |
| Ga0105248_118749821 | 3300009177 | Switchgrass Rhizosphere | VSHHFSLRPVQVDYLLTHFNEFGNGAQNQNNLRVSTGVVFHF* |
| Ga0105237_103255102 | 3300009545 | Corn Rhizosphere | SLRPVQVDYLLTHFNEFGNGAQNQNNRRVSTGVVFHF* |
| Ga0105249_116212621 | 3300009553 | Switchgrass Rhizosphere | SVRPVKVDYLLTRFAAAGAAAQSQKNLRVSTGVVFNF* |
| Ga0116216_106813212 | 3300009698 | Peatlands Soil | VRDRFSIRPLQFDYLLTHLPEVTNGNTQTQNNLRVSAGIVFHFK* |
| Ga0126380_112001212 | 3300010043 | Tropical Forest Soil | VRPVKVDYLLTRFAAAGADPQSQKNLRVSTGVVFNF* |
| Ga0127446_10861101 | 3300010104 | Grasslands Soil | IRPVKLDYLITRFPETGSGAQTQNNLRVSTGIVFRF* |
| Ga0134082_100696621 | 3300010303 | Grasslands Soil | DRWSIRPLQFDYLLTHLPEIANANNQTQNNLRVSTGIVFHFK* |
| Ga0134084_101448201 | 3300010322 | Grasslands Soil | IRPLQFDYLLTHLPEVTNGNNQTQNNLRVSTGIVFHFK* |
| Ga0126370_103960452 | 3300010358 | Tropical Forest Soil | GGVDANVTHHFSLRPIEVDYLLSHFNEFGNGAQNQNNLRVSTGVVFHF* |
| Ga0126372_109718121 | 3300010360 | Tropical Forest Soil | KHFSVRPVKVDYLLTRFAAKGADPTSQKNLRVSTGVVFHF* |
| Ga0126377_105134331 | 3300010362 | Tropical Forest Soil | KLAKHFSVRPVKVDYLLTRFAAAGAAAQSQKNLRVSSGVVFNF* |
| Ga0126377_119257621 | 3300010362 | Tropical Forest Soil | AKHFSVRPVKVDYLLTRFAAAGAAAQSQKNLRVSTGVVFNF* |
| Ga0126377_120450093 | 3300010362 | Tropical Forest Soil | DVKLAKHFSVRPVKVDYLLTRFAAAGADPQSQKNLRVSTGVVFHF* |
| Ga0126377_123997512 | 3300010362 | Tropical Forest Soil | FDVKLAKHFSVRPVKVDYLLTRFAVAGADPQSQKNLRVSTGVVFHF* |
| Ga0150983_165634072 | 3300011120 | Forest Soil | DWNVRDRFSIRPLQFDYLLTHLPEVTNGNTQTQNNLRVSAGIVFHFK* |
| Ga0137392_102959803 | 3300011269 | Vadose Zone Soil | LQFDYILTHLPEVGNGNNQTQNNLRVSAGIVFHFK* |
| Ga0137391_100624835 | 3300011270 | Vadose Zone Soil | GGLDYRVSSHFSVRAAKVDYLLTRFNELNTTKTQSQNNLRVSTGIVFRF* |
| Ga0137391_105096381 | 3300011270 | Vadose Zone Soil | IRPVQVDYLMTHFNELGTGAQNQNNLRVSTGVVFHF* |
| Ga0137391_114548652 | 3300011270 | Vadose Zone Soil | IRPLQFDYLLTHFPEITNGNNQTQNNLRVSTGIVFHFK* |
| Ga0137393_106374481 | 3300011271 | Vadose Zone Soil | VDYRVSSRFSIRPLKVDYLLTRFNELNTNNAQNQNNLRVSTGIVFRF* |
| Ga0137389_102577203 | 3300012096 | Vadose Zone Soil | SHFSIRAAKVDYLLTRFNELNTTNTQSQNNLRVSTGIVFRF* |
| Ga0137388_104496421 | 3300012189 | Vadose Zone Soil | DWNVRDRFSIRPLQFDYLLTHFPEITNGNNQTQNNLRVSTGIVFHFK* |
| Ga0137364_103362062 | 3300012198 | Vadose Zone Soil | WSIRPLQFDYLLTHLPEVTNGNNQTQNNLRVSTGIVFHFK* |
| Ga0137364_104127901 | 3300012198 | Vadose Zone Soil | QFDYLLTHFPEVTNGNTQTQNNLRVSTGIVFHFK* |
| Ga0137365_112528132 | 3300012201 | Vadose Zone Soil | RFSIRPLQFDYLLTHFPEIANGNNQTQNNLRVSTGIVFHFK* |
| Ga0137363_105308642 | 3300012202 | Vadose Zone Soil | PVQFDYLLTHFPEGTNGNNLTQNNLRVSTGIVFHFK* |
| Ga0137399_100197193 | 3300012203 | Vadose Zone Soil | LKVDYLLTRFNELNTNNAQNQNNLRVSTGIVFRF* |
| Ga0137362_115585702 | 3300012205 | Vadose Zone Soil | WNVRDRFSIRPLQFDYLLTHLPEITNGNNQTQNNLRVSTGIVFHFK* |
| Ga0137362_116028762 | 3300012205 | Vadose Zone Soil | WNVRDRFSIRPLQFDYLLTHLPEIGNGNNQTQNNLRVFTGIVFHFK* |
| Ga0137378_114246212 | 3300012210 | Vadose Zone Soil | TIGGGVDYNLTDRLAIRPVKLDYLITRFPETGSGAQTQNNLRVSTGIVFRF* |
| Ga0137377_111842502 | 3300012211 | Vadose Zone Soil | RPAQVDYLLTRFNEFGTGAQTQNNLRVSTGVVFHF* |
| Ga0137387_105698241 | 3300012349 | Vadose Zone Soil | KLCGRFAIRPVKVDYLMTRFSETGTSNQTQNNLRVSTGIVFRF* |
| Ga0137384_108591812 | 3300012357 | Vadose Zone Soil | KISRRFSIRPAQVDYLLTRFNEFGTGAQTQNNLRVSTGVVFHF* |
| Ga0137384_110021262 | 3300012357 | Vadose Zone Soil | RDRFSIRPLQFDYLLTHLPEVTNGNNQTQNNLRVSTGIVFHFK* |
| Ga0137360_106969321 | 3300012361 | Vadose Zone Soil | GLAYRAHPHSSVRPASEDYLQARRNEFNTTNTQSQNNLRVSTGIVFRF* |
| Ga0137390_106231842 | 3300012363 | Vadose Zone Soil | DFKVSHRFAIRPVQVDYLMTHFNELGTGAQNQNNLRVSTGVVFHF* |
| Ga0137390_111506372 | 3300012363 | Vadose Zone Soil | LQFDYVLTHFPEGASGNNLTQNNLRVSTGIVFHFK* |
| Ga0134022_11602872 | 3300012371 | Grasslands Soil | RPVKLDYLMTRFSETGTSNQTQNNLRVSTGIVFRF* |
| Ga0134025_10950132 | 3300012378 | Grasslands Soil | VDWNVRDRFSIRPLQFDYLLTHFPEVTNGNTQTQNNLRVSTGIVFHFK* |
| Ga0134050_13087832 | 3300012407 | Grasslands Soil | RDRWSIRPLQFDYLLTHLPEVTNGNNQTQNNLRVSTGIVFHFK* |
| Ga0137397_104925442 | 3300012685 | Vadose Zone Soil | HFAVRPVKVDYLMTRFSETGTGANTQNNLRVSTGIVFRF* |
| Ga0157288_103103942 | 3300012901 | Soil | VGGGFDVKLAKHFSVRPVKVDYLLTRFAAAGADPQSQKNLRVSTGVVFHF* |
| Ga0137396_106264222 | 3300012918 | Vadose Zone Soil | WNVRDRFSIRPLQFDYLLTHLPEIGNGNNQTQNNLRVSTGIVFHFK* |
| Ga0137394_103963262 | 3300012922 | Vadose Zone Soil | AVRPVKVDYLMTRFSETGTGANTQNNLRVSTGIVFRF* |
| Ga0137404_101070143 | 3300012929 | Vadose Zone Soil | GGVDVGISRHFAVRPVQLDYLLTRFNEGTNNAQSQNNLRVSTGVVFRF* |
| Ga0137404_103435012 | 3300012929 | Vadose Zone Soil | GVDVRVSHRFSLRPVQVDYLLTHFNEFDLGAQNQNNLRVSTGVVFHF* |
| Ga0164302_109802181 | 3300012961 | Soil | FDVKLAKHFSVRPVKLDYLLTRFAAAGAAPQSQKNLRVSTGVVFNF* |
| Ga0163163_133267101 | 3300014325 | Switchgrass Rhizosphere | HFSVRPVKVDYLLTRFAATGAAPQSQKNLRVSTGVVFNF* |
| Ga0137405_10853552 | 3300015053 | Vadose Zone Soil | CSIRPLQFDYLLTHLPEIGNGNNQTQNNLRVSTGIVFHFK* |
| Ga0137405_11081722 | 3300015053 | Vadose Zone Soil | SIRPLQFDYLLTHLPEIGNGNNQTQNNLRVSTGIVFHFK* |
| Ga0137405_12064631 | 3300015053 | Vadose Zone Soil | SIRPLQFDYLLTHLPEIGNGNNQTQNNNLRVSTGIVFHFK* |
| Ga0137418_103793691 | 3300015241 | Vadose Zone Soil | VRPVKVDYLMTRFSETPSGTNTQNNLRVSTGIVFRF* |
| Ga0134089_102481531 | 3300015358 | Grasslands Soil | RRFSIRPAQVDYLLTRFNEFGTGAQTQNNLRVSTGIVFHF* |
| Ga0182032_110678601 | 3300016357 | Soil | VGGGFDAKLAKHFSVRPVKVDYLLTRFAAAGANPQSQKNLRVSTGVVFHF |
| Ga0187786_104432341 | 3300017944 | Tropical Peatland | GGGFDVKLAKHFSVRPAKVDYLLTRFAAAGAAPQSQKNLRVSTGVVFNF |
| Ga0187783_106911932 | 3300017970 | Tropical Peatland | RLSFRPLQVDYLLTRFGEGTGTSQNQNNLRASTGIVVHF |
| Ga0066669_103216082 | 3300018482 | Grasslands Soil | SDRFAIRPVKLDYLMTRFSETGTRNQTQNNLRVSTGIVFRF |
| Ga0210407_108342321 | 3300020579 | Soil | GVDYRLTNRFALRPLEVDYLLTRFSEGSPNTQTQNNLRASTGIVIHF |
| Ga0210407_108369802 | 3300020579 | Soil | NNRFSLRPLQVDYLMTRFPEGTRNNQTQNNLRASTGIVIHF |
| Ga0210407_109936511 | 3300020579 | Soil | GVDFKVSHRFSIRPLQVDYLMTRFNELGLGAQNQNNLRVSTGVVLHF |
| Ga0210403_115326202 | 3300020580 | Soil | FSLRPLEVDYLLTRFNEGTPNNQTQNNLRASTGIVIHF |
| Ga0210401_116201122 | 3300020583 | Soil | FSIRPLQVDYLLTRFSEGTPNNQTQNNLRASTGIVIHF |
| Ga0210404_102860551 | 3300021088 | Soil | RFTRQVRIRAAEVDYLLTHFSEVTNINTQVQNNLRVSTGLVFRF |
| Ga0210406_104725901 | 3300021168 | Soil | LAIRPVKVDYLLTRFNEFGNNTQTQNNLRVSTGIVFRF |
| Ga0210400_100022681 | 3300021170 | Soil | SIRPAEVDYLLTRFNEFTDPGAQSQNNLRVSTGIVFRF |
| Ga0210408_108709732 | 3300021178 | Soil | RFSIRPLQFDYLLTHFPEVNNGHNLTQNNLRVSTGIVFHFK |
| Ga0210393_114305261 | 3300021401 | Soil | DYRINHRFSLRPVELDYLLSRFPEALTGRDTQNNLRVSTGIVFRF |
| Ga0210385_112454652 | 3300021402 | Soil | HRLSLRPLQVNYLMTCFPEKTSSNQTQNNLRASTGAVIHF |
| Ga0210394_108092801 | 3300021420 | Soil | TDRFSIRPVQVEYLLTRFNELGLGTQSQNNLRVSTGIVFHF |
| Ga0210402_109569051 | 3300021478 | Soil | FAIRPIKVDYLMTRFSETGTGNQTQNNLRVSTGIVFRF |
| Ga0210402_116238431 | 3300021478 | Soil | HLSVRAAKVDYLLTRFNEFNTFGTQSQNNLRVSTGIVFRF |
| Ga0210402_117011662 | 3300021478 | Soil | SLRPVQVDYLLTRFNELGLGSRNQNNLRVSTGVVFHF |
| Ga0209438_11384042 | 3300026285 | Grasslands Soil | SRFSIRPAQVEYLLTRFNEFTDPRAQSQNNLRVSTGIVFRF |
| Ga0209240_11278191 | 3300026304 | Grasslands Soil | RPAKVDYLLTRFNEFGNTNRQTQNNLRVSTGIVFRF |
| Ga0209686_11521781 | 3300026315 | Soil | RWSIRPLQFDYLLTHLPEIGNGNNQTQNNLRVSTGIVFHFK |
| Ga0209375_11871852 | 3300026329 | Soil | LQFDYLLTHFPEVTNGNTQTQNNLRVSTGIVFHFK |
| Ga0209158_11363572 | 3300026333 | Soil | IRPLQFDYLLTHLPEVTNGSNLTQNNLRVSTGLVFHFK |
| Ga0209158_13329991 | 3300026333 | Soil | GVDVKISRRFSIRPAQVDYLLTRFNEFGTGAQTQNNLRVSTGVVFHF |
| Ga0209057_10048051 | 3300026342 | Soil | VDWHVRDRWSIRPLQFDYLLTHLPEVTNGNNQTQNNLRVSTGIVFHFK |
| Ga0257163_10588241 | 3300026359 | Soil | WNVRDRFSIRPVQFDYLLTHFPEGTNGNNLTQNNLRVSTGIVFHFK |
| Ga0257155_10785132 | 3300026481 | Soil | RINNRFSLRPLQVDYLMTRFPEGTPNNQTQNNLRASTGIVIHF |
| Ga0179593_11238845 | 3300026555 | Vadose Zone Soil | LQFDYLLTHFPEVTNGHNLTQNNLRVSTGIVFHFK |
| Ga0209523_10700932 | 3300027548 | Forest Soil | GVDYRLSSRFSIRPAQVEYLLTRFNEFTDPRAQSQNNLRVSTGIVFRF |
| Ga0209331_10713991 | 3300027603 | Forest Soil | IDYRLNSRFSIRPAKVDYLLTRFNEFGSTNTQTQNNLRVSTGIVFRF |
| Ga0209528_10886801 | 3300027610 | Forest Soil | VRPAQVEYLLTRFKEFTIDPRAQSQNNLRVSTGIVFRF |
| Ga0209177_100386111 | 3300027775 | Agricultural Soil | HFSIRPVKVDYLLTRFDETGTGAQSQNNLRVSTGVVFHF |
| Ga0209656_100102168 | 3300027812 | Bog Forest Soil | HHWSLRPLDVDYLPTRFPELTNGRQTQNNLRASTGIVFSF |
| Ga0222749_101739552 | 3300029636 | Soil | ISNRFSLRPLQVDYLMTRFPEGTRNNQTQNNLRASTGIVIHF |
| Ga0311353_117019822 | 3300030399 | Palsa | RPLELDYLLSRFPETATGGRDTQNNLRVSTGIVFHF |
| Ga0073994_116757552 | 3300030991 | Soil | FFSIRPAELDYLLTRFNEFTNTSAQSQNNLRVSTGIVFRF |
| Ga0307476_100749893 | 3300031715 | Hardwood Forest Soil | SLRPLQVDYLLTRFSEGTPNNQTQNNLRASTGIVIHF |
| Ga0307477_100244801 | 3300031753 | Hardwood Forest Soil | PLKVDYLLTRFNEFNTTNNQTQNNLRVSTGIVFRF |
| Ga0307475_100649634 | 3300031754 | Hardwood Forest Soil | RPLQVDYLLTRFREGTGGTAPTQNQNNLRASSGVVIHF |
| Ga0307473_103553131 | 3300031820 | Hardwood Forest Soil | FSIRPLQFDYLLTHLPEVTNGNNQTQNNLRVSTGIVFHFK |
| Ga0306920_1006840091 | 3300032261 | Soil | GFDVRLSKNFSVRPVKVDYLLTRFAAAGADPQSQKNLRVSTGVVFHF |
| Ga0335085_114738032 | 3300032770 | Soil | FSIRPVKVDYLMTRFSENGFGAETQNNLRVSTGVVFHF |
| ⦗Top⦘ |