| Basic Information | |
|---|---|
| Family ID | F066658 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 46 residues |
| Representative Sequence | TDLPTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQLR |
| Number of Associated Samples | 103 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 7.94 % |
| % of genes near scaffold ends (potentially truncated) | 89.68 % |
| % of genes from short scaffolds (< 2000 bps) | 89.68 % |
| Associated GOLD sequencing projects | 97 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.206 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (27.778 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (39.683 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.05% β-sheet: 0.00% Coil/Unstructured: 45.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF04389 | Peptidase_M28 | 69.84 |
| PF12836 | HHH_3 | 3.17 |
| PF05157 | T2SSE_N | 1.59 |
| PF00437 | T2SSE | 1.59 |
| PF05635 | 23S_rRNA_IVP | 0.79 |
| PF02669 | KdpC | 0.79 |
| PF08242 | Methyltransf_12 | 0.79 |
| PF02481 | DNA_processg_A | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0758 | Predicted Rossmann fold nucleotide-binding protein DprA/Smf involved in DNA uptake | Replication, recombination and repair [L] | 1.59 |
| COG2156 | K+-transporting ATPase, KdpC subunit | Inorganic ion transport and metabolism [P] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.21 % |
| Unclassified | root | N/A | 0.79 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002561|JGI25384J37096_10099137 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300002562|JGI25382J37095_10084360 | All Organisms → cellular organisms → Bacteria | 1161 | Open in IMG/M |
| 3300002908|JGI25382J43887_10017567 | All Organisms → cellular organisms → Bacteria | 3765 | Open in IMG/M |
| 3300005166|Ga0066674_10054295 | All Organisms → cellular organisms → Bacteria | 1813 | Open in IMG/M |
| 3300005172|Ga0066683_10491806 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005176|Ga0066679_10444782 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300005176|Ga0066679_10733704 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300005187|Ga0066675_10355391 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300005441|Ga0070700_100652952 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300005446|Ga0066686_10456906 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300005518|Ga0070699_100212750 | All Organisms → cellular organisms → Bacteria | 1721 | Open in IMG/M |
| 3300005549|Ga0070704_100311035 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300005554|Ga0066661_10066368 | All Organisms → cellular organisms → Bacteria | 2098 | Open in IMG/M |
| 3300005555|Ga0066692_10581746 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300005557|Ga0066704_10411732 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300005557|Ga0066704_10511936 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300005557|Ga0066704_10641286 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300005557|Ga0066704_10811362 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300005566|Ga0066693_10068515 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300005568|Ga0066703_10172579 | All Organisms → cellular organisms → Bacteria | 1305 | Open in IMG/M |
| 3300005568|Ga0066703_10248827 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300005836|Ga0074470_11153942 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300005843|Ga0068860_101803190 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300006031|Ga0066651_10771176 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006791|Ga0066653_10087223 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1391 | Open in IMG/M |
| 3300006797|Ga0066659_11585532 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300006797|Ga0066659_11653963 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300006806|Ga0079220_10976026 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300006844|Ga0075428_100421797 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300006844|Ga0075428_102611535 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300006845|Ga0075421_101912907 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 635 | Open in IMG/M |
| 3300006854|Ga0075425_100385036 | All Organisms → cellular organisms → Bacteria | 1615 | Open in IMG/M |
| 3300006854|Ga0075425_101084162 | All Organisms → cellular organisms → Bacteria | 912 | Open in IMG/M |
| 3300006903|Ga0075426_10576045 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300006903|Ga0075426_11424040 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300007076|Ga0075435_100217347 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| 3300007258|Ga0099793_10589162 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300009012|Ga0066710_101441696 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300009012|Ga0066710_101909631 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300009088|Ga0099830_11211612 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300009089|Ga0099828_10385939 | All Organisms → cellular organisms → Bacteria | 1263 | Open in IMG/M |
| 3300009089|Ga0099828_11206459 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300009100|Ga0075418_11700335 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium RBG_16_66_8 | 686 | Open in IMG/M |
| 3300009813|Ga0105057_1044462 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300010301|Ga0134070_10459633 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300010304|Ga0134088_10107285 | All Organisms → cellular organisms → Bacteria | 1316 | Open in IMG/M |
| 3300010304|Ga0134088_10184600 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300010323|Ga0134086_10333034 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300010329|Ga0134111_10101871 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300010337|Ga0134062_10784170 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300011269|Ga0137392_10669347 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300011429|Ga0137455_1065906 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1036 | Open in IMG/M |
| 3300011434|Ga0137464_1241881 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300012039|Ga0137421_1234489 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300012189|Ga0137388_10001701 | All Organisms → cellular organisms → Bacteria | 13538 | Open in IMG/M |
| 3300012200|Ga0137382_10054893 | All Organisms → cellular organisms → Bacteria | 2501 | Open in IMG/M |
| 3300012202|Ga0137363_10942791 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300012202|Ga0137363_11292935 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 618 | Open in IMG/M |
| 3300012204|Ga0137374_10230348 | All Organisms → cellular organisms → Bacteria | 1570 | Open in IMG/M |
| 3300012204|Ga0137374_11201387 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 531 | Open in IMG/M |
| 3300012206|Ga0137380_11105658 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300012206|Ga0137380_11669881 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300012207|Ga0137381_10274771 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1466 | Open in IMG/M |
| 3300012208|Ga0137376_10699453 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300012211|Ga0137377_10782806 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300012349|Ga0137387_10776546 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 693 | Open in IMG/M |
| 3300012351|Ga0137386_10645210 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300012355|Ga0137369_10174557 | All Organisms → cellular organisms → Bacteria | 1684 | Open in IMG/M |
| 3300012355|Ga0137369_10435184 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300012357|Ga0137384_10327597 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300012358|Ga0137368_10919189 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300012360|Ga0137375_10386695 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300012362|Ga0137361_10445100 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300012362|Ga0137361_11201500 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300012362|Ga0137361_11522730 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300012532|Ga0137373_10625435 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300012683|Ga0137398_10512602 | All Organisms → cellular organisms → Bacteria | 825 | Open in IMG/M |
| 3300012918|Ga0137396_10239538 | All Organisms → cellular organisms → Bacteria | 1337 | Open in IMG/M |
| 3300012918|Ga0137396_10950291 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300012925|Ga0137419_10089858 | All Organisms → cellular organisms → Bacteria | 2100 | Open in IMG/M |
| 3300012925|Ga0137419_11550186 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 562 | Open in IMG/M |
| 3300012972|Ga0134077_10124714 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300012975|Ga0134110_10235419 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300014166|Ga0134079_10039590 | All Organisms → cellular organisms → Bacteria | 1618 | Open in IMG/M |
| 3300015241|Ga0137418_10036120 | All Organisms → cellular organisms → Bacteria | 4564 | Open in IMG/M |
| 3300015356|Ga0134073_10088488 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300015373|Ga0132257_102164729 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300017654|Ga0134069_1138357 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300017656|Ga0134112_10441928 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300018071|Ga0184618_10151579 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
| 3300018071|Ga0184618_10152640 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300018076|Ga0184609_10078604 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300018078|Ga0184612_10019443 | All Organisms → cellular organisms → Bacteria | 3482 | Open in IMG/M |
| 3300018482|Ga0066669_11386552 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300019789|Ga0137408_1454482 | All Organisms → cellular organisms → Bacteria | 1604 | Open in IMG/M |
| 3300019880|Ga0193712_1025628 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300019883|Ga0193725_1123491 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300020022|Ga0193733_1177031 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300021081|Ga0210379_10022743 | All Organisms → cellular organisms → Bacteria | 2384 | Open in IMG/M |
| 3300022195|Ga0222625_1317818 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300022204|Ga0224496_10199769 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300022214|Ga0224505_10385036 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300022694|Ga0222623_10103342 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1108 | Open in IMG/M |
| 3300022694|Ga0222623_10164946 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300025155|Ga0209320_10179038 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300025324|Ga0209640_11255671 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300026075|Ga0207708_11204319 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300026295|Ga0209234_1267410 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300026298|Ga0209236_1012625 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4914 | Open in IMG/M |
| 3300026301|Ga0209238_1122604 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300026301|Ga0209238_1272039 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 508 | Open in IMG/M |
| 3300026309|Ga0209055_1217536 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300026529|Ga0209806_1019563 | All Organisms → cellular organisms → Bacteria | 3493 | Open in IMG/M |
| 3300027490|Ga0209899_1090969 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300027748|Ga0209689_1012619 | All Organisms → cellular organisms → Bacteria | 5504 | Open in IMG/M |
| 3300027862|Ga0209701_10230505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1091 | Open in IMG/M |
| 3300030606|Ga0299906_10454253 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300031576|Ga0247727_10594033 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300031962|Ga0307479_10680795 | Not Available | 1008 | Open in IMG/M |
| 3300032828|Ga0335080_10740678 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300032955|Ga0335076_10098621 | All Organisms → cellular organisms → Bacteria | 2851 | Open in IMG/M |
| 3300033432|Ga0326729_1006418 | All Organisms → cellular organisms → Bacteria | 2191 | Open in IMG/M |
| 3300033502|Ga0326731_1058929 | All Organisms → cellular organisms → Bacteria | 895 | Open in IMG/M |
| 3300033815|Ga0364946_162278 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300034147|Ga0364925_0140178 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300034178|Ga0364934_0283526 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 27.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 17.46% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 9.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 7.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.14% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.17% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.17% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.38% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.38% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.59% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.59% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.59% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.59% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.59% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.59% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.79% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.79% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011434 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300022195 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022204 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
| 3300027490 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
| 3300033502 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF9FY SIP fraction | Environmental | Open in IMG/M |
| 3300033815 | Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17 | Environmental | Open in IMG/M |
| 3300034147 | Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25384J37096_100991371 | 3300002561 | Grasslands Soil | AQLTMDTDLPTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGXLR* |
| JGI25382J37095_100843602 | 3300002562 | Grasslands Soil | SLSAGFQMAYLVNDERQASRKTSQLVITAFVNLSTSVGQIR* |
| JGI25382J43887_100175675 | 3300002908 | Grasslands Soil | NMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQLR* |
| Ga0066674_100542954 | 3300005166 | Soil | PSLSAGFQMAYLVNDERQFNHKTAQLVITAFVNLSTSVGQIR* |
| Ga0066683_104918062 | 3300005172 | Soil | LTMDTDFPPTLSAGLQMAYLVNEERQINRKTAQLVITAFVQLNTSVGQIR* |
| Ga0066679_104447821 | 3300005176 | Soil | TLSAGFQMAYLVNEERQANRKTSQLVITAFVELHTSVGRIQ* |
| Ga0066679_107337041 | 3300005176 | Soil | PTLSAGFQMAYLVNDERQANRKTSQLVITAFVELHTSVGQLQ* |
| Ga0066675_103553912 | 3300005187 | Soil | GAGLQMAYVLNEERQTNRKIAQFVLTAFVQLSTSVGQIR* |
| Ga0070700_1006529521 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAGLQMAYVLNEERQSNRKISQFGVTAFVQLSASVGQLR* |
| Ga0066686_104569062 | 3300005446 | Soil | MDTDFPPSLSAGLQMAYVVNEERQFSRKTAQLVITAFVQLTTSVGQLR* |
| Ga0070699_1002127503 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LTLDTDLPTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQVSTSVGQIR* |
| Ga0070704_1003110353 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | PNMSAGLQMAYLLNEERQTSRKVRQIVITAFVQLQTSVGQIR* |
| Ga0066661_100663684 | 3300005554 | Soil | TDLPPSMSAGLQVASITNEERNANRKTRQLVITAFINLSTSVGQLR* |
| Ga0066692_105817462 | 3300005555 | Soil | QVSMDTDVPPNFSAGFQVAYLLNDERQANRKTSQVVVTAFLELHTSVGDLR* |
| Ga0066704_104117322 | 3300005557 | Soil | QTQLTMDTDFPPSLSAGLQMAYVVNEERQFNTKTAQLVITAFVQLTTSVGQLR* |
| Ga0066704_105119361 | 3300005557 | Soil | SAGFQMAYLVNEERQANRKTSQLVITAFVELHTSVGRIQ* |
| Ga0066704_106412862 | 3300005557 | Soil | AGLQMAYLVNDERQSSHKTAQLVITAFVNLSTSVGQIR* |
| Ga0066704_108113622 | 3300005557 | Soil | FPPSLSAGLQMAYLVNDERQASRKTSQLVITAFVNLSTSVGQIR* |
| Ga0066693_100685151 | 3300005566 | Soil | DSDLPSNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQIR* |
| Ga0066703_101725791 | 3300005568 | Soil | TLDTDLPTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQIR* |
| Ga0066703_102488272 | 3300005568 | Soil | TDFPPTMSAGLQMAYLVNEERQINRKTAQLVITAFVQLNTSVGQIR* |
| Ga0074470_111539421 | 3300005836 | Sediment (Intertidal) | QFTFDTDFPPSLSAGFQMAYVVNDERQTNYKTAQLVITAFVNLSTSVGQIR* |
| Ga0068860_1018031902 | 3300005843 | Switchgrass Rhizosphere | LQMAYVLNEERQSNRKISQFGVTAFVQLSASVGQLR* |
| Ga0066651_107711761 | 3300006031 | Soil | GLQMAYLLSEERQTSRRVRQIVITAFVQLQTSVGQIR* |
| Ga0066653_100872231 | 3300006791 | Soil | QLTMDTDLPTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQLR* |
| Ga0066659_115855322 | 3300006797 | Soil | RASQTQLTFDSDFPPSLSAGLQMAYVVNEERQFNHKTAQLAVTAFVNLSTSVGQLR* |
| Ga0066659_116539631 | 3300006797 | Soil | VTATQLTMDTDFPPSLSAGFQMAYTLDDERQAFRKVSQLTITAFVQLNTSVGQIR* |
| Ga0079220_109760262 | 3300006806 | Agricultural Soil | SLSAGLQMAYIVNQESQANSKTAQLVITAFVNLSTSVGQFR* |
| Ga0075428_1004217971 | 3300006844 | Populus Rhizosphere | QMAYVLNEERQSNRKISQFGVTAFVQISTSVGQLR* |
| Ga0075428_1026115351 | 3300006844 | Populus Rhizosphere | AGLQMAYVLNEERQTNRKIAQFGVTAFVQLSTSVGQLR* |
| Ga0075421_1019129072 | 3300006845 | Populus Rhizosphere | RQTSTQLTMDTDLPPSLGAGLQVAYLLNEERQTNRKTSQFVITAFVSFTTSVGQLR* |
| Ga0075425_1003850364 | 3300006854 | Populus Rhizosphere | TMDTDLPSSMTAGLQMAYVLNEERQSNRKISQFVITAFVQLSTSVGQLR* |
| Ga0075425_1010841621 | 3300006854 | Populus Rhizosphere | AQLTMDTDLPSSMTAGLQMAYVLNEERQSNRKISQFVITAFVQLSTSVGQLR* |
| Ga0075426_105760452 | 3300006903 | Populus Rhizosphere | GLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQIR* |
| Ga0075426_114240402 | 3300006903 | Populus Rhizosphere | DLPSSMTAGLQMAYVLNEERQSNRKISQFVITAFVQLSTSVGQLR* |
| Ga0075435_1002173474 | 3300007076 | Populus Rhizosphere | LTMDTDLPSSMTAGLQMAYVLNEERQSNRKISQFVITAFVQLSTSVGQLR* |
| Ga0099793_105891622 | 3300007258 | Vadose Zone Soil | LTMDTDFPPTMSGGLQLAYLVNEERQINRKTAQLVITAFVQLNTSVGQIR* |
| Ga0066710_1014416961 | 3300009012 | Grasslands Soil | RQYRAELTTDSDFPPSLRAGLQMAYVVNEERQFNTKTAQLGITAFVQLTTSVGQLR |
| Ga0066710_1019096312 | 3300009012 | Grasslands Soil | FPPSLSAGLQMAYLVNDERQASRKTSQLVITAFVNLSTSVGQIR |
| Ga0099830_112116121 | 3300009088 | Vadose Zone Soil | GLQMAYVVNEERQFSRKTAQLVITAFVQLTTSVGQLR* |
| Ga0099828_103859391 | 3300009089 | Vadose Zone Soil | MDTDFPPSLSAGFQMAYVVNEERQFSRKTAQLVITAFVQLSTTVGQLR* |
| Ga0099828_112064591 | 3300009089 | Vadose Zone Soil | TDFPPSLSAGLQMAYVVNEERQFSRKTAQLVITAFVQLTTSVGQLR* |
| Ga0075418_117003352 | 3300009100 | Populus Rhizosphere | SMAYLINEERQASRKIAQLVITAFVNLTTTVGQLR* |
| Ga0105057_10444621 | 3300009813 | Groundwater Sand | TLDTSFPPSLSAGLQMAYLLNDERQINRKVSQLVLTAFVQLNTSAGQLR* |
| Ga0134070_104596331 | 3300010301 | Grasslands Soil | QAQLTMDTDLPSNMSAGLQMAYLLNEERQTNRKVAQVVITAFVQLSTSVGQLR* |
| Ga0134088_101072853 | 3300010304 | Grasslands Soil | LQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQIR* |
| Ga0134088_101846001 | 3300010304 | Grasslands Soil | LSAGFQMAYLVNDERQANRKTSQLVITAFVELHTSVGQIQ* |
| Ga0134086_103330342 | 3300010323 | Grasslands Soil | LPPTLSAGFQMAYLVNEERQANRKTSQLVITAFVELHTSVGRIQ* |
| Ga0134111_101018711 | 3300010329 | Grasslands Soil | MAYVLNEERQTNRKISQFVITAFVQLSTIVGQLR* |
| Ga0134062_107841701 | 3300010337 | Grasslands Soil | AQLTMDTDFPPTMSAGLQMAYLVNEEQQINRKTAQLVITAFVQLNTSVGQIR* |
| Ga0137392_106693472 | 3300011269 | Vadose Zone Soil | GFQMAYLVNDERQASRKTSQLVITAFVNLSTSVGQIR* |
| Ga0137455_10659062 | 3300011429 | Soil | MDTDLPPNMSAGLQMAYVLNEERQTNRKVRQIVITAFVQLATSVGQLR* |
| Ga0137464_12418812 | 3300011434 | Soil | SNMSAGLQMAYVLNEERQSNRKISQLGVTAFVQLSTSVGQLR* |
| Ga0137421_12344892 | 3300012039 | Soil | PSLSAGFQMAYVVNDERQTNYKTAQLVITAFVNLSTSVGQIR* |
| Ga0137388_100017011 | 3300012189 | Vadose Zone Soil | MDSDLPSNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQIR* |
| Ga0137382_100548931 | 3300012200 | Vadose Zone Soil | PTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQLR* |
| Ga0137363_109427911 | 3300012202 | Vadose Zone Soil | AGLQMAYVLNEERQSNRKISQFVITAFVQLSTSVGQLR* |
| Ga0137363_112929351 | 3300012202 | Vadose Zone Soil | GFQFAYLVTEERQINHKVAQMVITAFVQLNTSVGQVR* |
| Ga0137374_102303481 | 3300012204 | Vadose Zone Soil | QAQLTMDTDLPTNMSAGLQMAYVLNEERQTNRKIAQFVITAFVQLSTSVGQIR* |
| Ga0137374_112013872 | 3300012204 | Vadose Zone Soil | MDTDLPPNLSAGFQMAYLLNEERQTNRKVRQIVITAFVQLQTSVGQLR* |
| Ga0137380_111056581 | 3300012206 | Vadose Zone Soil | QAQLTMDTDLPTNMSAGLQMAYVLHEERQTNRKISQFVITAFVQLSTSVGQIR* |
| Ga0137380_116698812 | 3300012206 | Vadose Zone Soil | MDTDFPPTLSAGLQMAYLVNAERQINRKTAQLVITAFVQLNTSVGQIR* |
| Ga0137381_102747713 | 3300012207 | Vadose Zone Soil | QAQLTMETDLPPNMSAGLQVASITNEERSANRKTRQLVITAFVNLSTSVGQLR* |
| Ga0137376_106994532 | 3300012208 | Vadose Zone Soil | LTMDTDLPTNMTAGLQMAYVLNEERQSNRKISQFVITAFVQLSTSVGQLR* |
| Ga0137377_107828061 | 3300012211 | Vadose Zone Soil | SQVSMDTDVPPNFSAGFQVAYLLNDERQANRKTSQVVVTAFLELHTSVGELR* |
| Ga0137387_107765462 | 3300012349 | Vadose Zone Soil | MDTDLPTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQLR* |
| Ga0137386_106452101 | 3300012351 | Vadose Zone Soil | NNMGAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQIR* |
| Ga0137369_101745573 | 3300012355 | Vadose Zone Soil | TMDTDLPNNMGAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQIR* |
| Ga0137369_104351842 | 3300012355 | Vadose Zone Soil | QLTMDTDLPTNMSAGLQMAYVLNEERQTNRQIAQFVITAFVQLSTSVGQIR* |
| Ga0137384_103275971 | 3300012357 | Vadose Zone Soil | MDTDVPPNFSAGFQVAYLLNDERQANRKTSQVVVTAFLELHTSVGELR* |
| Ga0137368_109191892 | 3300012358 | Vadose Zone Soil | MSAGLQMAYVLNEERQTNRKIAQFVITAFVQLSTSVGQIR* |
| Ga0137375_103866952 | 3300012360 | Vadose Zone Soil | QAQLTMDTDLPTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQLR* |
| Ga0137361_104451001 | 3300012362 | Vadose Zone Soil | DLPPTLSAGFQMAYLVNEERQANRKTSQLVITAFVELHTSVGRIQ* |
| Ga0137361_112015001 | 3300012362 | Vadose Zone Soil | VDSRQSQTQLTLDTDFPHSLTAGFQMAYQVNDQRQFNHKTGQLGITAFVSMSTSVGQIR* |
| Ga0137361_115227302 | 3300012362 | Vadose Zone Soil | QAQLTMDTDLPSNMTAGLQMAYVLNEERQSNRKISQFVITAFVQLSTSVGQLR* |
| Ga0137373_106254351 | 3300012532 | Vadose Zone Soil | VDSRQTQAQLTMDTDLPTNMTAGLQMAYVLNEERQSNRKISQFVITAFVQLSTSVGHLR* |
| Ga0137398_105126022 | 3300012683 | Vadose Zone Soil | GLQMAYVLNEERQSNRKISQFVITAFVQLSTSVGQLR* |
| Ga0137396_102395381 | 3300012918 | Vadose Zone Soil | QMAYVLNEERQTNRKISQFVITAFVQLSTSVGQIR* |
| Ga0137396_109502912 | 3300012918 | Vadose Zone Soil | FPPTLSAGFQMAYVVNDERQANRKTSQLVITAFIELRTSAGQLR* |
| Ga0137419_100898581 | 3300012925 | Vadose Zone Soil | TQAQLTMDTDLPTNMTAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQLR* |
| Ga0137419_115501862 | 3300012925 | Vadose Zone Soil | MDTDLPTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQIR* |
| Ga0134077_101247141 | 3300012972 | Grasslands Soil | PSNMSAGLQMAYVLNEERQTNRKIAQFVITAFVQLSTSVGQIR* |
| Ga0134110_102354191 | 3300012975 | Grasslands Soil | LSAGFQMAYLVNEERQANRKTSQLVITAFVELHTSVGRIQ* |
| Ga0134079_100395901 | 3300014166 | Grasslands Soil | MAYVLNEERQTNRKVSQFVITAFVQLSTSVGQLK* |
| Ga0137418_100361201 | 3300015241 | Vadose Zone Soil | LTMDTDLPTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQIR* |
| Ga0134073_100884882 | 3300015356 | Grasslands Soil | PPTLSAGFQMAYLVNDERQANRKTSQLVITAFVELHTSVGQIQ* |
| Ga0132257_1021647292 | 3300015373 | Arabidopsis Rhizosphere | MDTDLPKNMSAGLQMAYVLNEERQTNRKISQLGVTAFIQLSASVGQLR* |
| Ga0134069_11383571 | 3300017654 | Grasslands Soil | RQSQSQLSLDTDVPPNFSAGFQVAYLLNDERQANRKTSQLLVTAFVELHTSVGEIR |
| Ga0134112_104419281 | 3300017656 | Grasslands Soil | IPPTLSAGFQMAYLVNDERQANRKTSQLVITAFVELHTSVGQLR |
| Ga0184618_101515792 | 3300018071 | Groundwater Sediment | QLTMDTDLPTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQLR |
| Ga0184618_101526402 | 3300018071 | Groundwater Sediment | QLTMDTDLPTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQIR |
| Ga0184609_100786041 | 3300018076 | Groundwater Sediment | MSAGLQMAYVLNEERQTNRKISQFVITAFVQLSASVGQLK |
| Ga0184612_100194435 | 3300018078 | Groundwater Sediment | DTDLPTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSASVGQLR |
| Ga0066669_113865521 | 3300018482 | Grasslands Soil | SRAARSSDLPPTLSAGFQMAYLMNDERQANRKTSQLVITAFVELHTSVGQIQ |
| Ga0137408_14544822 | 3300019789 | Vadose Zone Soil | MDTDLPTNMTAGLQMAYVLNEERQSNRKISQFVITAFVQLSTSVGQLR |
| Ga0193712_10256281 | 3300019880 | Soil | TDFPPSLSAGFQMAYLVNDERQTNRKTAQLVITAFVNFSTSVGHIR |
| Ga0193725_11234912 | 3300019883 | Soil | GQLTMDTELPPNMSAGIQMAYLLNEERQTNRKVRQLVITAFVQLATSVGQLR |
| Ga0193733_11770312 | 3300020022 | Soil | LPTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQIR |
| Ga0210379_100227434 | 3300021081 | Groundwater Sediment | MDTDLPPNMSAGLQMAYVLNEERQTNRKVRQIVITAFVQLATSVGQLR |
| Ga0222625_13178181 | 3300022195 | Groundwater Sediment | SRQTQAQLTMDTDLPTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQLR |
| Ga0224496_101997692 | 3300022204 | Sediment | TQLTLDTDLPPSLGAGIQVAYLINEERQTNRKTSQLIFTAFVSFTTSVGQI |
| Ga0224505_103850362 | 3300022214 | Sediment | TLDTDLPPSLGAGIQVAYLINEERQTNRKTSQLIFTAFVSFTTSVGQI |
| Ga0222623_101033422 | 3300022694 | Groundwater Sediment | MDTDLPPNMSAGIQMAYVLNEERQTNRKVRQLVITAFVQLATSVGQLR |
| Ga0222623_101649462 | 3300022694 | Groundwater Sediment | DLPPNMSAGLQMAYLLNEERQTNRRVRQIVITAFVQLATNVGQLR |
| Ga0209320_101790383 | 3300025155 | Soil | SQTQLTMDTDLPPSFSAGIQMARVVNDERQANRKTSQLVITAFVELHTSVGQLR |
| Ga0209640_112556711 | 3300025324 | Soil | SRNIQAQLTMDTDLPPNMSAGLQMAYVLTEERQMNRKVAQLVITAFVQLATSVGRIQ |
| Ga0207708_112043191 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSAGLQMAYVLNEERQSNRKISQFGVTAFVQLSASVGQLR |
| Ga0209234_12674101 | 3300026295 | Grasslands Soil | AQLTLDTEFPPSLSAGFQMAYLVNDERQASRKTSQLVITAFVNLSTSVGQIR |
| Ga0209236_10126251 | 3300026298 | Grasslands Soil | TDLPTNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQLR |
| Ga0209238_11226041 | 3300026301 | Grasslands Soil | QLSLDTDLPPTLSAGFQMAYLVNEERQANRKTSQLVITAFVELHTSVGRIQ |
| Ga0209238_12720392 | 3300026301 | Grasslands Soil | MDTDFPPTMSAGLQMAYLVNEERQINRKTAQLVITAFVQLNTSVGQIR |
| Ga0209055_12175362 | 3300026309 | Soil | QLTMDSDLPSNMSAGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQIR |
| Ga0209806_10195634 | 3300026529 | Soil | TDFPPTMSAGLQMAYLVNEERQINRKTAQLVITAFVQLNTSVGQIR |
| Ga0209899_10909691 | 3300027490 | Groundwater Sand | MDTDLPSNMSAGLQMAYVLNEERQTNRKVSQFVITAFVQLSANVGQLK |
| Ga0209689_10126191 | 3300027748 | Soil | SLDTDLPPTLSAGFQMAYLVNDERQANRKTSQLVITAFVELHTSVGQLQ |
| Ga0209701_102305053 | 3300027862 | Vadose Zone Soil | AGLQMAYVLNEERQTNRKISQFVITAFVQLSTSVGQIR |
| Ga0299906_104542531 | 3300030606 | Soil | DLPPNMSAGLQMAYVLTEERQMNRKVAQLVITAFVQLATSVGRIQ |
| Ga0247727_105940331 | 3300031576 | Biofilm | FPPSLSAGLQMAYVLNDERQINRKVSQLVLTAFVQLNTSVGQLR |
| Ga0307479_106807951 | 3300031962 | Hardwood Forest Soil | METDLPPNMSAGLQVASITNEERNANRKTRQLVITAFINLSTSVGQLR |
| Ga0335080_107406782 | 3300032828 | Soil | FSAGLQVAYIVNQQMQLNQTTAQLTITAYVSLSTSVGQFR |
| Ga0335076_100986214 | 3300032955 | Soil | SLSAGLQMAYVVNDQRQFNHKTAQLVVTAFVNMSTSVGRIR |
| Ga0326729_10064181 | 3300033432 | Peat Soil | PPILTAGIQMAYVLNDERQISRKTSQLVLTAFVQLNTSVGQVR |
| Ga0326731_10589292 | 3300033502 | Peat Soil | FDTDFPPSLSAGFQMAYLVNDERQTNHKTAQLVITAFVNFSTSVGQIR |
| Ga0364946_162278_380_502 | 3300033815 | Sediment | MSAGLQMAYILNDERQSNRRNSQLVITAFVQMQTSVGQLR |
| Ga0364925_0140178_2_157 | 3300034147 | Sediment | QVTFDTDFPPSLSAGFQMAYVVNDERQTNYKTAQLVITAFVNLSTSVGQIR |
| Ga0364934_0283526_462_608 | 3300034178 | Sediment | MDTDLPPNMSAGLQMAYILNDERQSNRRNSQLVITAFVQMQTSVGQLR |
| ⦗Top⦘ |