| Basic Information | |
|---|---|
| Family ID | F066621 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MPDVVRALAISGSILIAVVILIIIVSFVTVRRGEVAMAEDGKGHGGQAHH |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 70.63 % |
| % of genes near scaffold ends (potentially truncated) | 26.98 % |
| % of genes from short scaffolds (< 2000 bps) | 79.37 % |
| Associated GOLD sequencing projects | 84 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.54 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.016 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (23.016 % of family members) |
| Environment Ontology (ENVO) | Unclassified (42.063 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (67.460 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.56% β-sheet: 0.00% Coil/Unstructured: 47.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF03255 | ACCA | 14.29 |
| PF13601 | HTH_34 | 7.94 |
| PF13376 | OmdA | 6.35 |
| PF14579 | HHH_6 | 3.17 |
| PF00782 | DSPc | 3.17 |
| PF01039 | Carboxyl_trans | 3.17 |
| PF00436 | SSB | 2.38 |
| PF00420 | Oxidored_q2 | 0.79 |
| PF00753 | Lactamase_B | 0.79 |
| PF04325 | DUF465 | 0.79 |
| PF00691 | OmpA | 0.79 |
| PF07676 | PD40 | 0.79 |
| PF01894 | UPF0047 | 0.79 |
| PF01336 | tRNA_anti-codon | 0.79 |
| PF13174 | TPR_6 | 0.79 |
| PF07238 | PilZ | 0.79 |
| PF08818 | DUF1801 | 0.79 |
| PF00034 | Cytochrom_C | 0.79 |
| PF00958 | GMP_synt_C | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0825 | Acetyl-CoA carboxylase alpha subunit | Lipid transport and metabolism [I] | 17.46 |
| COG0777 | Acetyl-CoA carboxylase beta subunit | Lipid transport and metabolism [I] | 3.17 |
| COG4799 | Acetyl-CoA carboxylase, carboxyltransferase component | Lipid transport and metabolism [I] | 3.17 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 2.38 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 2.38 |
| COG0432 | Thiamin phosphate synthase YjbQ, UPF0047 family | Coenzyme transport and metabolism [H] | 0.79 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.79 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.79 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.02 % |
| Unclassified | root | N/A | 26.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_100803608 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6848 | Open in IMG/M |
| 3300000559|F14TC_100278173 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3898 | Open in IMG/M |
| 3300000789|JGI1027J11758_12342841 | Not Available | 587 | Open in IMG/M |
| 3300000955|JGI1027J12803_101993416 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1557 | Open in IMG/M |
| 3300002558|JGI25385J37094_10000139 | All Organisms → cellular organisms → Bacteria | 15410 | Open in IMG/M |
| 3300004633|Ga0066395_10017411 | All Organisms → cellular organisms → Bacteria | 2795 | Open in IMG/M |
| 3300005166|Ga0066674_10012781 | All Organisms → cellular organisms → Bacteria | 3515 | Open in IMG/M |
| 3300005166|Ga0066674_10021643 | All Organisms → cellular organisms → Bacteria | 2781 | Open in IMG/M |
| 3300005166|Ga0066674_10090051 | All Organisms → cellular organisms → Bacteria | 1418 | Open in IMG/M |
| 3300005171|Ga0066677_10413175 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005174|Ga0066680_10094749 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300005178|Ga0066688_10030498 | All Organisms → cellular organisms → Bacteria | 2976 | Open in IMG/M |
| 3300005180|Ga0066685_10207861 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1344 | Open in IMG/M |
| 3300005180|Ga0066685_10368391 | All Organisms → cellular organisms → Bacteria | 997 | Open in IMG/M |
| 3300005181|Ga0066678_10964900 | Not Available | 554 | Open in IMG/M |
| 3300005186|Ga0066676_10948538 | Not Available | 575 | Open in IMG/M |
| 3300005332|Ga0066388_101103117 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
| 3300005332|Ga0066388_101876766 | Not Available | 1069 | Open in IMG/M |
| 3300005332|Ga0066388_102778721 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300005332|Ga0066388_103748587 | Not Available | 776 | Open in IMG/M |
| 3300005332|Ga0066388_107626938 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300005445|Ga0070708_101066759 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300005446|Ga0066686_10130097 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
| 3300005446|Ga0066686_10418450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 916 | Open in IMG/M |
| 3300005446|Ga0066686_10460842 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300005450|Ga0066682_10304566 | Not Available | 1028 | Open in IMG/M |
| 3300005450|Ga0066682_10389248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300005454|Ga0066687_10834829 | Not Available | 549 | Open in IMG/M |
| 3300005468|Ga0070707_102179218 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
| 3300005529|Ga0070741_11339065 | Not Available | 597 | Open in IMG/M |
| 3300005536|Ga0070697_100083338 | All Organisms → cellular organisms → Bacteria | 2637 | Open in IMG/M |
| 3300005558|Ga0066698_10793480 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
| 3300005586|Ga0066691_10373359 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
| 3300005713|Ga0066905_100651205 | All Organisms → cellular organisms → Bacteria | 898 | Open in IMG/M |
| 3300005713|Ga0066905_101531947 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300005719|Ga0068861_102183217 | Not Available | 554 | Open in IMG/M |
| 3300005764|Ga0066903_103613540 | All Organisms → cellular organisms → Bacteria | 833 | Open in IMG/M |
| 3300005764|Ga0066903_106304850 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005937|Ga0081455_10984514 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300006796|Ga0066665_10319956 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300006797|Ga0066659_11536724 | Not Available | 558 | Open in IMG/M |
| 3300006844|Ga0075428_101387611 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300006845|Ga0075421_100121118 | All Organisms → cellular organisms → Bacteria | 3284 | Open in IMG/M |
| 3300006852|Ga0075433_10078794 | All Organisms → cellular organisms → Bacteria | 2903 | Open in IMG/M |
| 3300006852|Ga0075433_10330442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1348 | Open in IMG/M |
| 3300009012|Ga0066710_101804472 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300009012|Ga0066710_104919261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300009088|Ga0099830_11690470 | Not Available | 528 | Open in IMG/M |
| 3300009137|Ga0066709_100318237 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2122 | Open in IMG/M |
| 3300009137|Ga0066709_101117305 | Not Available | 1159 | Open in IMG/M |
| 3300009147|Ga0114129_10000427 | All Organisms → cellular organisms → Bacteria | 49990 | Open in IMG/M |
| 3300009162|Ga0075423_10778323 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300010046|Ga0126384_11300371 | All Organisms → cellular organisms → Bacteria | 674 | Open in IMG/M |
| 3300010046|Ga0126384_11782843 | Not Available | 584 | Open in IMG/M |
| 3300010047|Ga0126382_10034168 | All Organisms → cellular organisms → Bacteria | 2825 | Open in IMG/M |
| 3300010047|Ga0126382_10176483 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300010047|Ga0126382_12280333 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010104|Ga0127446_1100747 | Not Available | 710 | Open in IMG/M |
| 3300010128|Ga0127486_1089786 | Not Available | 539 | Open in IMG/M |
| 3300010140|Ga0127456_1250081 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300010303|Ga0134082_10091544 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300010304|Ga0134088_10037364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2207 | Open in IMG/M |
| 3300010325|Ga0134064_10381697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300010362|Ga0126377_13577866 | Not Available | 503 | Open in IMG/M |
| 3300010398|Ga0126383_11061070 | Not Available | 899 | Open in IMG/M |
| 3300011119|Ga0105246_10219565 | Not Available | 1489 | Open in IMG/M |
| 3300011416|Ga0137422_1047371 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300012199|Ga0137383_10039326 | All Organisms → cellular organisms → Bacteria | 3353 | Open in IMG/M |
| 3300012206|Ga0137380_11328611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 604 | Open in IMG/M |
| 3300012207|Ga0137381_10031693 | All Organisms → cellular organisms → Bacteria | 4270 | Open in IMG/M |
| 3300012207|Ga0137381_11757127 | Not Available | 510 | Open in IMG/M |
| 3300012212|Ga0150985_100838341 | Not Available | 518 | Open in IMG/M |
| 3300012349|Ga0137387_10941113 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 623 | Open in IMG/M |
| 3300012373|Ga0134042_1188346 | Not Available | 510 | Open in IMG/M |
| 3300012379|Ga0134058_1120291 | Not Available | 1094 | Open in IMG/M |
| 3300012390|Ga0134054_1316323 | Not Available | 717 | Open in IMG/M |
| 3300012469|Ga0150984_103508264 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300012469|Ga0150984_108705375 | Not Available | 1255 | Open in IMG/M |
| 3300012582|Ga0137358_10661888 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 699 | Open in IMG/M |
| 3300012685|Ga0137397_10965380 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300012944|Ga0137410_11376975 | Not Available | 612 | Open in IMG/M |
| 3300012948|Ga0126375_10004924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5046 | Open in IMG/M |
| 3300012971|Ga0126369_10014338 | All Organisms → cellular organisms → Bacteria | 6199 | Open in IMG/M |
| 3300012971|Ga0126369_11553515 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300012976|Ga0134076_10048472 | All Organisms → cellular organisms → Bacteria | 1597 | Open in IMG/M |
| 3300015359|Ga0134085_10360363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 648 | Open in IMG/M |
| 3300015371|Ga0132258_10229859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4518 | Open in IMG/M |
| 3300015371|Ga0132258_10471067 | All Organisms → cellular organisms → Bacteria | 3135 | Open in IMG/M |
| 3300015373|Ga0132257_100101650 | All Organisms → cellular organisms → Bacteria | 3310 | Open in IMG/M |
| 3300015373|Ga0132257_100118190 | All Organisms → cellular organisms → Bacteria | 3076 | Open in IMG/M |
| 3300015374|Ga0132255_102415637 | Not Available | 802 | Open in IMG/M |
| 3300016357|Ga0182032_10523617 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 978 | Open in IMG/M |
| 3300016422|Ga0182039_12191182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 510 | Open in IMG/M |
| 3300017654|Ga0134069_1361673 | Not Available | 522 | Open in IMG/M |
| 3300017656|Ga0134112_10033829 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300018431|Ga0066655_10030153 | All Organisms → cellular organisms → Bacteria | 2634 | Open in IMG/M |
| 3300018431|Ga0066655_10275558 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300018431|Ga0066655_10315419 | Not Available | 1020 | Open in IMG/M |
| 3300018431|Ga0066655_10625662 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300018433|Ga0066667_10786255 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
| 3300018433|Ga0066667_12174168 | Not Available | 516 | Open in IMG/M |
| 3300018482|Ga0066669_10176592 | All Organisms → cellular organisms → Bacteria | 1605 | Open in IMG/M |
| 3300018482|Ga0066669_10201762 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
| 3300018482|Ga0066669_10302315 | All Organisms → cellular organisms → Bacteria | 1300 | Open in IMG/M |
| 3300019233|Ga0184645_1330604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300021560|Ga0126371_13477165 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 532 | Open in IMG/M |
| 3300025922|Ga0207646_10006754 | All Organisms → cellular organisms → Bacteria | 11809 | Open in IMG/M |
| 3300025936|Ga0207670_10302907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1252 | Open in IMG/M |
| 3300026307|Ga0209469_1056929 | Not Available | 1216 | Open in IMG/M |
| 3300026318|Ga0209471_1330253 | Not Available | 505 | Open in IMG/M |
| 3300026329|Ga0209375_1179179 | Not Available | 842 | Open in IMG/M |
| 3300026333|Ga0209158_1145724 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300026537|Ga0209157_1091729 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1464 | Open in IMG/M |
| 3300026547|Ga0209156_10344606 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300026550|Ga0209474_10427222 | Not Available | 679 | Open in IMG/M |
| 3300027873|Ga0209814_10090165 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300027873|Ga0209814_10215434 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
| 3300027874|Ga0209465_10023257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2871 | Open in IMG/M |
| 3300031719|Ga0306917_10265045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Kallotenuales → Kallotenuaceae → Kallotenue → Kallotenue papyrolyticum | 1320 | Open in IMG/M |
| 3300031820|Ga0307473_10388886 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
| 3300031820|Ga0307473_10509537 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300031965|Ga0326597_10279476 | All Organisms → cellular organisms → Bacteria | 1910 | Open in IMG/M |
| 3300032180|Ga0307471_101051469 | Not Available | 981 | Open in IMG/M |
| 3300032180|Ga0307471_102700763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 630 | Open in IMG/M |
| 3300032205|Ga0307472_101157977 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300032261|Ga0306920_100023429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8668 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 11.11% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.32% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.73% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.73% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 7.14% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.35% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.97% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 3.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.17% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.17% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.59% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.59% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.79% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.79% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.79% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.79% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010104 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_2_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010128 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011416 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT551_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012379 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012390 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019233 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_10080360810 | 3300000364 | Soil | MAPDVVRALAISGSFLIGVVVLIIIVTKVTVGRGEIEMAEDAKRHGHSTHH* |
| F14TC_1002781732 | 3300000559 | Soil | MAPDVVRALAISGSILIGVVVLIIIVTKVTVGRGEIEMAEEAKRHGHSTHH* |
| JGI1027J11758_123428412 | 3300000789 | Soil | MAPDVVRALAISGSILIGVVVLIIIVTKVTVXRGEIXMAEDAKRHGHSTHH* |
| JGI1027J12803_1019934161 | 3300000955 | Soil | MAPDVVRALAISGSILIGVVVLIIIVTKVTVGRGEIEMAEDAKRHGHSTHH* |
| JGI25385J37094_1000013914 | 3300002558 | Grasslands Soil | MPDLLRALAISGSILIAVVIFIVVVSYVTVRRGEVAMAEDVKRTGGGSAHH* |
| Ga0066395_100174113 | 3300004633 | Tropical Forest Soil | MAPDVIRALAISGSILIGVVVLIIIVTKVTVGRGEIQMAEDAKRHGHSTHH* |
| Ga0066674_100127817 | 3300005166 | Soil | MPDVLRALAISGSILIGVFIIVTIVAFVTVKRGEAGMAEDARHHGHSAH* |
| Ga0066674_100216434 | 3300005166 | Soil | MPDLLRALAISGSILIAVVILIVVVSYVTVRRGELAMTEDAKQTGGGSAHH* |
| Ga0066674_100900514 | 3300005166 | Soil | MPDVLRALAISGSILIGVFIIVTIVAFVTVKRGEAGMGEDATHHGRSAH* |
| Ga0066677_104131751 | 3300005171 | Soil | MPDTLRALMISGSILIAVVIFTIIISFVTVRRGEAAMAEDARRHGGPA |
| Ga0066680_100947493 | 3300005174 | Soil | MPDLLRALAISGSILIAVVILIVVVSYVTVRRGEVAMAEDVKRTGGGSAHH* |
| Ga0066688_100304983 | 3300005178 | Soil | MISGSILIAVVIFTIIISFVTVRRGEAAMAEDARRHGGPAHH* |
| Ga0066685_102078611 | 3300005180 | Soil | AISGSILIGVVILIVIISFVTVRRGEVGMAEDAKQHGPSGQH* |
| Ga0066685_103683911 | 3300005180 | Soil | MPDLLRALAISGSILIAVVILIVVVSFVTVRRGEVAMGEDVKHTGPRPAHH* |
| Ga0066678_109649001 | 3300005181 | Soil | MTPDLIRALAISGSILLGVVILTIIISIVTVRRGEVEMTQDERHHGHSGHR* |
| Ga0066676_109485383 | 3300005186 | Soil | SILIAVVILIVVVSFVTVRRGEVAMGEDVKHTGPRPAHH* |
| Ga0066388_1011031172 | 3300005332 | Tropical Forest Soil | MPDVVRALAISGSILIAVVILIVIVSFAAVRRGEISMAEDSKAHGGKAHH* |
| Ga0066388_1018767662 | 3300005332 | Tropical Forest Soil | MTPDLIRALAISGSILIGVVVLIIVVSTVTVRRGEVAMSEDSKPHGRSGRH* |
| Ga0066388_1027787212 | 3300005332 | Tropical Forest Soil | MAPDVIRALEISGSILIAVVVLIIIVTKVTVGRGEVQMAEDAKRHGHSAHH* |
| Ga0066388_1037485872 | 3300005332 | Tropical Forest Soil | MSPDVIRALAISGSILIAVVVLIIIVTKVTIGRAEIQMAEDAKRHGHSAHP* |
| Ga0066388_1076269382 | 3300005332 | Tropical Forest Soil | MAPDVIRALAISGSILIGVVVLIIIVTKVTVGRGEIQMAEDAKRH |
| Ga0070708_1010667591 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MISGSILFAVVIFIIIICFVTVRRGEAAMAEDARRQGGPAHH* |
| Ga0066686_101300972 | 3300005446 | Soil | MAPDVIRALAISGSILIGVVILIVIISFVTVRRGEVGMAEDAKQHGRSGQH* |
| Ga0066686_104184502 | 3300005446 | Soil | MPDVLRALAISGSILIGVFIVVTIVAFVTVKRGEAGMHEDATHHGHSSH* |
| Ga0066686_104608421 | 3300005446 | Soil | MPDVLRALAISGSILIGVFIVVTIVAFVTVKRGEAGMHEDATHHGHS |
| Ga0066682_103045663 | 3300005450 | Soil | MPDLLRALAISGSILIAVVIFIVVVSYVTVRRGELAMAEDVKRTGGGSAHH* |
| Ga0066682_103892482 | 3300005450 | Soil | MPDLLRALAISGSILIAVVIFIVIVSYVTVRRGEVAMAEDVKRTGGGSAHH* |
| Ga0066687_108348291 | 3300005454 | Soil | MPDVVRALAISGSILIAVVILIVICSFAAVRRGEVAMAEDAKAHGGKAHH* |
| Ga0070707_1021792182 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDTLRALMISGSILIAVLIFIIIISFVTVRRGEAAMAEDAKQHGGPAHH* |
| Ga0070741_113390652 | 3300005529 | Surface Soil | VRALAISGSILIAVVILTIIVSFITVRRGEVSMAEDGKGHGAAHH* |
| Ga0070697_1000833384 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MISGSILIAVVIFTIIISFVTVRRGEAAMAEDTRRHGGPAHH* |
| Ga0066698_107934802 | 3300005558 | Soil | MPDVLRALAISGSILIGVFIVVTIVAFVTVKRGEAGMHEDATHHGHSAH* |
| Ga0066691_103733593 | 3300005586 | Soil | AVVILIVVVSFVTVRRGEVAMGEDVKHTGPRPAHH* |
| Ga0066905_1006512052 | 3300005713 | Tropical Forest Soil | MPDLLRALAISGSILIAVVILIVVVSYVTVRRGELAMAEDAKQTGSGSAHH* |
| Ga0066905_1015319471 | 3300005713 | Tropical Forest Soil | MAPDVIRALAISGSILLAVVVLIIIVSKLTVGRGENAMAEDAKRHGHSA |
| Ga0068861_1021832172 | 3300005719 | Switchgrass Rhizosphere | MSPDLIHALTISGAILIGVVVLIIGVSLVTVRRGEASMAEDAKRRR* |
| Ga0066903_1036135402 | 3300005764 | Tropical Forest Soil | MTPDLARALAISGSILIAVFILIVIVSVITVKRGEVEMAADARQRGHSTRH* |
| Ga0066903_1063048502 | 3300005764 | Tropical Forest Soil | MAPDVVRALAISGSFLIGVVVLIIIVTKVTVGRGEIQMAEDAKRHGHSTHH* |
| Ga0081455_109845142 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MTPDLIRSLAISGSILLGVLILIIIVSMVAVRRGELEMAEDARQHG |
| Ga0066665_103199562 | 3300006796 | Soil | MPDTLRALMISGSILIAVVIFTIIISFVTVRRGEAAMAEDAKQHGAPPHH* |
| Ga0066659_115367241 | 3300006797 | Soil | MPDVVRALAISGSILIAVVILIVICSFAAVRRGEVAMAEDAKAAGGKAHH* |
| Ga0075428_1013876112 | 3300006844 | Populus Rhizosphere | MAPDVVRALAISGSILIGVVVLIIIVTKVTVGRGEIQMAEDAKRHGHSTHH* |
| Ga0075421_1001211182 | 3300006845 | Populus Rhizosphere | MAPDVVRALAISGSFLIGVVVLIIIVTKVTVGRGEIQMAEEAKRHGHSTHH* |
| Ga0075433_100787943 | 3300006852 | Populus Rhizosphere | MTPDLIRALAISGGILIAVVILTVLVSVVTVRRGEVEMAERATEHRGRSARH* |
| Ga0075433_103304422 | 3300006852 | Populus Rhizosphere | MPDTLRALMISGSILIAVVIFTIIISFVTVRRGDAAMAEDARQHGGPAHH* |
| Ga0066710_1018044722 | 3300009012 | Grasslands Soil | MPDVVRALAISGSILIAVVILIVIVSFAAVRRGEVAMAEDTKAQGGKAHH |
| Ga0066710_1049192611 | 3300009012 | Grasslands Soil | MPDVLRALAISGSILIGVFIIVTIVAFVTVKRGEAGMGEDATHHGRSAH |
| Ga0099830_116904701 | 3300009088 | Vadose Zone Soil | MPDVVRALAISGSILFAVVILIIIVSFVTVRRGEVAMAEDGKGHGGQPHH* |
| Ga0066709_1003182374 | 3300009137 | Grasslands Soil | LFEGSFMPDVLRALAISGSILIGVFIIVTIVAFVTVKRGEAGMAEDARHHGHSAH* |
| Ga0066709_1011173053 | 3300009137 | Grasslands Soil | MSPDLVHALTISGSILIAVFLLIVGISVVTVRRGELEMSEDARRRNHSGRH* |
| Ga0114129_1000042745 | 3300009147 | Populus Rhizosphere | MTPDLIRALAISGGILIAVVILTVLVSVVTVRRGEVEMAERAAEHRGRSARH* |
| Ga0075423_107783232 | 3300009162 | Populus Rhizosphere | MISGSILIAVVIFTIIISFVTVRRGDAAMAEDARQHGGPAHH* |
| Ga0126384_113003712 | 3300010046 | Tropical Forest Soil | MEPDLIRALSISGSILIGVVLLIIIVTFVTVHRGEVEMEKDAKRHGGTAHH* |
| Ga0126384_117828431 | 3300010046 | Tropical Forest Soil | MTPDLMRALAISGSILIAVFILVIVVSIVTVRRGEIGMSEDAKPPGEAGRH* |
| Ga0126382_100341683 | 3300010047 | Tropical Forest Soil | MAPDVVRALANSGSFLIGVVVLIIIVTKVTVGRGEIQMAEDAKRHGHSTHH* |
| Ga0126382_101764832 | 3300010047 | Tropical Forest Soil | MAPDVIRALAISGSILLAVVVLIIIVSKLTVGRGENAMAEDAKRHGHSAHH* |
| Ga0126382_122803332 | 3300010047 | Tropical Forest Soil | MTPDLIRALAISGSILIGVVVLIIVVSTVTVRRGEVAMSEDSKPHGRSG |
| Ga0127446_11007471 | 3300010104 | Grasslands Soil | KGMPDLLRALAISGSILIAVVILIVVVSYVTVRRGELAMTEDAKQTGGGSAHH* |
| Ga0127486_10897861 | 3300010128 | Grasslands Soil | DLLRALAISGSILIAVVILIVVVSYVTVRRGELAMTEDAKQTGGGSAHH* |
| Ga0127456_12500811 | 3300010140 | Grasslands Soil | KGMPDLLRALAISGSILIAVVILIVVVSYVTVRRGELAMAEDAKQTGGGSAHH* |
| Ga0134082_100915443 | 3300010303 | Grasslands Soil | MPDLLRALAISGSILIAVVIFIVVVSYVTVRRGEVAMAEDVKRSGGGSAHH* |
| Ga0134088_100373643 | 3300010304 | Grasslands Soil | MPDLLRALAISGSILIAVVILIVVVSYVTVRLGELAMTEDAKQTGGGSAHH* |
| Ga0134064_103816972 | 3300010325 | Grasslands Soil | MISGSILIAVVIFTIIISFVTVRRGEAAMSEDAKQHGGPPHH* |
| Ga0126377_135778661 | 3300010362 | Tropical Forest Soil | MAPDLVRALTISGSILIGVVVLIIIVTKVTVGRGEIQMAEDAKRHGHSTHH* |
| Ga0126383_110610702 | 3300010398 | Tropical Forest Soil | LMPDVVRALAISGSILIAVVILIVIVSFAAVRRGEIAMAEDSKAHGGKAHH* |
| Ga0105246_102195652 | 3300011119 | Miscanthus Rhizosphere | MTPDLIRALAISGSILIAVAIFIVIVSIVTVRRGEVEMAEDAKHHDGSAHR* |
| Ga0137422_10473712 | 3300011416 | Soil | MEPDLVRALAISGSLLIAVVLLIIVVSIVTVRRGEVSMADDAKGPGNSGRH* |
| Ga0137383_100393263 | 3300012199 | Vadose Zone Soil | MRALAISGSILIAVVIFITVITFVTIRRAEAEMAEDAKRHGGSAH* |
| Ga0137380_113286112 | 3300012206 | Vadose Zone Soil | MSPDVMRALAISSSILIAVVVFITVITFVTIRRAEAEMAEDAKRHGGTAH* |
| Ga0137381_100316933 | 3300012207 | Vadose Zone Soil | MPDLLRALAISGSILIAVVIFIVIVSYVTVRRGEVAMAEDVKRSGGGSAHH* |
| Ga0137381_117571272 | 3300012207 | Vadose Zone Soil | MRALAISGSILVAVVIFITVIAFVTVRRGEAAMDEDAKRHGGTAH* |
| Ga0150985_1008383412 | 3300012212 | Avena Fatua Rhizosphere | MAISGSILLGVVILITIVAFATVKRGEVEMAEDAKRHGGGHGHK* |
| Ga0137387_109411131 | 3300012349 | Vadose Zone Soil | MPDVLRALAISGSILIGVFILVTIVAFVTVKRGEASMAEDAKQHGRSAH* |
| Ga0134042_11883461 | 3300012373 | Grasslands Soil | LLRALAISGSILIAVVIFIVVVSYVTVRRGEVAMAEDVKRTGGGSAHH* |
| Ga0134058_11202912 | 3300012379 | Grasslands Soil | LLRALAISGSILIAVVILIVVVSYVTVRRGELAMTEDAKQTGGGSAHH* |
| Ga0134054_13163232 | 3300012390 | Grasslands Soil | SILIAVVILIVVVSYVTVRRGELAMAEDAKQTGGGSAAHH* |
| Ga0150984_1035082641 | 3300012469 | Avena Fatua Rhizosphere | MPDVLRAMAISGSILLGVVILITIVAFATVKRGEVEMAEDAKRH |
| Ga0150984_1087053753 | 3300012469 | Avena Fatua Rhizosphere | MPDVVRALAISGSILIAVVILIIIVSFVAVRRGEVTMAAEAKSHGGGHAHH* |
| Ga0137358_106618881 | 3300012582 | Vadose Zone Soil | MPDVVRALAISGSILIAVVIFIIIISFVTVRRGEVAMGEDAKGHGGKAHH* |
| Ga0137397_109653801 | 3300012685 | Vadose Zone Soil | EVAFMPDVVRALAISGGILLIVVFIVIGISYVVVRRGEAGMAEDAKHHGHSTH* |
| Ga0137410_113769751 | 3300012944 | Vadose Zone Soil | MPDVVRALAISGSILIAVVILIIIVSFVTVRRGEVAMAEDGKGHGGQAHH* |
| Ga0126375_100049244 | 3300012948 | Tropical Forest Soil | LAISGSILIGVVVLIIIVTKVTVGRGEIQMAEDAKRHGHSTHH* |
| Ga0126369_100143383 | 3300012971 | Tropical Forest Soil | MAPDVIRALAISGSILIGVVVLIIIVTKVTVGRGEVQMAEDAKRHGHSTHH* |
| Ga0126369_115535152 | 3300012971 | Tropical Forest Soil | MPDVVRALAISGSILIAVVILIVIVSFAAVRRGEIAMAEDSKAHGGKAHH* |
| Ga0134076_100484722 | 3300012976 | Grasslands Soil | MPDLLRALAISGSILIAVVILIVVVSYVTVRRGELAMTEDAKKTGGGSAHH* |
| Ga0134085_103603631 | 3300015359 | Grasslands Soil | MPDVLRALAISGSILIGVFIIVTIVAFVTVKRGEAGMGEDATHHGRSAP* |
| Ga0132258_102298595 | 3300015371 | Arabidopsis Rhizosphere | MPDVVRALAISGSLLFAVVILMIVISFVTVRRGEVSMSEDAKGHGKAHH* |
| Ga0132258_104710673 | 3300015371 | Arabidopsis Rhizosphere | MSDVLHAMAISGSILLGVVILLTIVAFVTVNRGEVEMEEDARKHGHSAHH* |
| Ga0132257_1001016501 | 3300015373 | Arabidopsis Rhizosphere | IRALAISGGILIAVVILTVLVSVVTVRRGEVEMAERATEHRGRSARH* |
| Ga0132257_1001181905 | 3300015373 | Arabidopsis Rhizosphere | MTPDLIRALAISGGILIAVVILTVLVSVVTVRRGEVEMAERATEHRRRSARH* |
| Ga0132255_1024156371 | 3300015374 | Arabidopsis Rhizosphere | DLIHALTISGAILIGVVVLIIGVSLVTVRRGEASMAEDAKRRR* |
| Ga0182032_105236171 | 3300016357 | Soil | MPDLIRALAISGGILFLVVILIVIVSIATVNRGAAEMGHAEHAQETE |
| Ga0182039_121911821 | 3300016422 | Soil | ISGSILIAVVILTIAVSFVTVRRGETAMSEDAKQHGAAHH |
| Ga0134069_13616732 | 3300017654 | Grasslands Soil | MPDLLRALAISGSILIAVVIFIVIVSYVTVRRGEVAMAENVKQAGGGSAHH |
| Ga0134112_100338294 | 3300017656 | Grasslands Soil | MPDLLRALAISGSILIAVVIFIVVVSYVTVRRGEVAMAEGVKRTGG |
| Ga0066655_100301532 | 3300018431 | Grasslands Soil | MPDLLRALAISGSILIAVVILIVVVSYVTVRRGELAMTEDAKQTGGGSAHH |
| Ga0066655_102755582 | 3300018431 | Grasslands Soil | MPDVLRALAISGSILIGVFIIVTIVAFVTVKRGEAGMAEDARHHGHSAH |
| Ga0066655_103154192 | 3300018431 | Grasslands Soil | MPDLLRALAISGSILIAVVIFIVVVSYVTVRRGEVAMAEDVKRTGGGSAHH |
| Ga0066655_106256621 | 3300018431 | Grasslands Soil | MISGSILIAVVIFTIIISFVTVRRGEAAMAEDARRHGGPAHH |
| Ga0066667_107862552 | 3300018433 | Grasslands Soil | MPDVLRALAISGSILVAVVILIVVVSFATVRRGEVAMSEDVKKAGQRPAHH |
| Ga0066667_121741681 | 3300018433 | Grasslands Soil | SDVVRALAISGSILIAVVILIVIVSFAAVRRGEVAMAEDTKAQGGKAHH |
| Ga0066669_101765922 | 3300018482 | Grasslands Soil | MPDTLRALMISGSILIAVVIFTIIISFVTVRRGEAAMAEDAKQHGGPAHH |
| Ga0066669_102017622 | 3300018482 | Grasslands Soil | MPDVVRALAISGSILIAVVILIVICSFAAVRRGEVAMAEDAKAAGGKAHH |
| Ga0066669_103023152 | 3300018482 | Grasslands Soil | MPDLLRALAISGSILIAVVIFIVVVSYVTVRRGELAMAEDVKRTGGGSAHH |
| Ga0184645_13306042 | 3300019233 | Groundwater Sediment | PDVLRALAISGSILIGVVIIVTIVAFVTVKRGEAGMGEDATHHGRSAH |
| Ga0126371_134771652 | 3300021560 | Tropical Forest Soil | MPDVVRALAISGSILIAVVILIVIVSFAAVRRGEIAMAEDGKGQKAHH |
| Ga0207646_100067547 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MISGSILFAVVIFIIIICFVTVRRGEAAMAEDARRQGGPAHH |
| Ga0207670_103029072 | 3300025936 | Switchgrass Rhizosphere | MSPDLIHALTISGAILIGVVVLIIGVSLVTVRRGEASMAEDAKRRR |
| Ga0209469_10569291 | 3300026307 | Soil | MPDLLRALAISGSILIAVVIFIVVVSYVTVRRGEVAMAENVKQAGGGSAHH |
| Ga0209471_13302532 | 3300026318 | Soil | MPDLLRALAISGSILIAVVILIVVVSFVTVRRGEVAMGEDVKHTGPRPAHH |
| Ga0209375_11791792 | 3300026329 | Soil | MPDLLRALAISGSILIAVVIFIVIVSYVTVRRGEVAMAEDVKRTGGGSAHH |
| Ga0209158_11457241 | 3300026333 | Soil | ISCSILIAVVILIVVVSFVTVRRGEVAMGEDVKHTGPRPAHH |
| Ga0209157_10917291 | 3300026537 | Soil | MAPDVIRALAISGSILIGVVILIVIISFVTVRRGEVGMAEDAKQHGRSGQH |
| Ga0209156_103446061 | 3300026547 | Soil | MPDLLRALAISGSILIAVVIFIVVVSYVTVRRGEVAMAEDVKRTGGGS |
| Ga0209474_104272221 | 3300026550 | Soil | ALAISGSILIAVVIFIVVVSYVTVRRGELAMAEDVKRTGGGSAHH |
| Ga0209814_100901652 | 3300027873 | Populus Rhizosphere | MAPDVVRALAISGSILIGVVVLIIIVTKVTVGRGEIQMAEDAKRHGHSTHH |
| Ga0209814_102154342 | 3300027873 | Populus Rhizosphere | MTPDLIRALAISGGILIAVVILTVLVSVVTVRRGEVEMAERAAEHRGRSARH |
| Ga0209465_100232576 | 3300027874 | Tropical Forest Soil | MAPDVIRALAISGSILIGVVVLIIIVTKVTVGRGEIQMAEDAKRHGHSTHH |
| Ga0306917_102650451 | 3300031719 | Soil | MPDVVRALLISGSILIAVVILTIAVSFVTVRRGETAMSEDAKQ |
| Ga0307473_103888861 | 3300031820 | Hardwood Forest Soil | MISGSILIAVVIFTIIISFVTVRRGEAAMAEDSWRHGGPTHH |
| Ga0307473_105095371 | 3300031820 | Hardwood Forest Soil | MPDVVRALAISGSILIAVVVFTIIVSFVTVRRGEASMAEDSKGHG |
| Ga0326597_102794763 | 3300031965 | Soil | MPDVLRAMAITGSILLGVVIIITIVAFVVVKRGEIEMAEDSKQHGRGHQPTH |
| Ga0307471_1010514691 | 3300032180 | Hardwood Forest Soil | MPDLLRALAISGSILIAVVILIVVVSYVTVRRSEVAMAENVKQAGGGSAHH |
| Ga0307471_1027007631 | 3300032180 | Hardwood Forest Soil | LNFDKREAKGMPDLLRALAISGSILIAVVILIVVVSYVTVRRGELAMAEDAKQTGGGSAH |
| Ga0307472_1011579772 | 3300032205 | Hardwood Forest Soil | MISGSILIAVVIFTIIISFVTVRRGDAAMADDTWRPGGPAHH |
| Ga0306920_1000234293 | 3300032261 | Soil | MPDVVRALLISGSILIAVVILTIAVSFVTVRRGETAMSEDAKQHGAAHH |
| ⦗Top⦘ |