NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F066606

Metagenome Family F066606

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066606
Family Type Metagenome
Number of Sequences 126
Average Sequence Length 47 residues
Representative Sequence VLLGHLGFNDVVVKERFDCFRGTSKEGVARKYGVVGVNVYARKPR
Number of Associated Samples 111
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 64.80 %
% of genes near scaffold ends (potentially truncated) 34.92 %
% of genes from short scaffolds (< 2000 bps) 87.30 %
Associated GOLD sequencing projects 102
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.063 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(17.460 % of family members)
Environment Ontology (ENVO) Unclassified
(25.397 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.651 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.07%    β-sheet: 21.92%    Coil/Unstructured: 63.01%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF13847Methyltransf_31 40.48
PF13649Methyltransf_25 13.49
PF02635DrsE 7.94
PF12847Methyltransf_18 5.56
PF08241Methyltransf_11 3.97
PF07690MFS_1 3.97
PF13360PQQ_2 3.17
PF01206TusA 1.59
PF01797Y1_Tnp 0.79
PF13442Cytochrome_CBB3 0.79
PF12697Abhydrolase_6 0.79
PF07274DUF1440 0.79
PF09837DUF2064 0.79
PF00230MIP 0.79
PF13701DDE_Tnp_1_4 0.79
PF07992Pyr_redox_2 0.79
PF01451LMWPc 0.79
PF02771Acyl-CoA_dh_N 0.79
PF08704GCD14 0.79
PF00903Glyoxalase 0.79
PF13489Methyltransf_23 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 126 Family Scaffolds
COG0425Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis)Translation, ribosomal structure and biogenesis [J] 1.59
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.79
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.79
COG1960Acyl-CoA dehydrogenase related to the alkylation response protein AidBLipid transport and metabolism [I] 0.79
COG2519tRNA A58 N-methylase Trm61Translation, ribosomal structure and biogenesis [J] 0.79
COG3477Uncharacterized membrane protein YagU, involved in acid resistance, DUF1440 familyFunction unknown [S] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.06 %
UnclassifiedrootN/A7.94 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2162886013|SwBSRL2_contig_10518446All Organisms → cellular organisms → Bacteria1101Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_10471224Not Available548Open in IMG/M
3300000574|JGI1357J11328_10038999All Organisms → cellular organisms → Bacteria2012Open in IMG/M
3300000787|JGI11643J11755_11238345All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium524Open in IMG/M
3300000890|JGI11643J12802_11298136All Organisms → cellular organisms → Bacteria576Open in IMG/M
3300002223|C687J26845_10021208All Organisms → cellular organisms → Bacteria2879Open in IMG/M
3300004114|Ga0062593_100235409All Organisms → cellular organisms → Bacteria1497Open in IMG/M
3300004156|Ga0062589_102899788All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300004157|Ga0062590_100944345All Organisms → cellular organisms → Bacteria → Acidobacteria813Open in IMG/M
3300004157|Ga0062590_102588923Not Available539Open in IMG/M
3300004463|Ga0063356_103038857All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Ectothiorhodospiraceae → Thioalkalivibrio723Open in IMG/M
3300004480|Ga0062592_100569489All Organisms → cellular organisms → Bacteria955Open in IMG/M
3300005172|Ga0066683_10174534All Organisms → cellular organisms → Bacteria1324Open in IMG/M
3300005176|Ga0066679_10270927All Organisms → cellular organisms → Bacteria1098Open in IMG/M
3300005180|Ga0066685_10144501All Organisms → cellular organisms → Bacteria1615Open in IMG/M
3300005180|Ga0066685_10662196All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300005181|Ga0066678_10295222All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300005181|Ga0066678_10931215All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300005290|Ga0065712_10119565All Organisms → cellular organisms → Bacteria1690Open in IMG/M
3300005294|Ga0065705_10126230All Organisms → cellular organisms → Bacteria → Proteobacteria2665Open in IMG/M
3300005345|Ga0070692_10895811All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300005445|Ga0070708_100391181All Organisms → cellular organisms → Bacteria1311Open in IMG/M
3300005445|Ga0070708_101868819All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium557Open in IMG/M
3300005446|Ga0066686_10450294All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300005467|Ga0070706_100791459All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300005518|Ga0070699_101010042All Organisms → cellular organisms → Bacteria763Open in IMG/M
3300005536|Ga0070697_101907787All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3532Open in IMG/M
3300005542|Ga0070732_10000423All Organisms → cellular organisms → Bacteria27445Open in IMG/M
3300005555|Ga0066692_10548606All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300005557|Ga0066704_10764982All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300005558|Ga0066698_10335965All Organisms → cellular organisms → Bacteria → Proteobacteria1045Open in IMG/M
3300005558|Ga0066698_10539034All Organisms → cellular organisms → Bacteria → Proteobacteria793Open in IMG/M
3300005575|Ga0066702_10615972All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300005576|Ga0066708_10875647All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300005616|Ga0068852_101488650All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300005618|Ga0068864_101083092All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300005713|Ga0066905_100121067All Organisms → cellular organisms → Bacteria1826Open in IMG/M
3300005937|Ga0081455_10631471All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300006032|Ga0066696_11013710All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300006034|Ga0066656_10564598All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300006042|Ga0075368_10272174All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300006800|Ga0066660_11123503All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300006806|Ga0079220_10846072All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300006844|Ga0075428_100982438All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300006844|Ga0075428_102403088Not Available541Open in IMG/M
3300006853|Ga0075420_101935162All Organisms → cellular organisms → Bacteria504Open in IMG/M
3300006880|Ga0075429_100931430All Organisms → cellular organisms → Bacteria760Open in IMG/M
3300006894|Ga0079215_10124869All Organisms → cellular organisms → Bacteria → Proteobacteria1182Open in IMG/M
3300006904|Ga0075424_102272280All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria570Open in IMG/M
3300006914|Ga0075436_100947472All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300007004|Ga0079218_10198196All Organisms → cellular organisms → Bacteria → Acidobacteria1529Open in IMG/M
3300009012|Ga0066710_100186521All Organisms → cellular organisms → Bacteria2936Open in IMG/M
3300009012|Ga0066710_103425062All Organisms → cellular organisms → Bacteria → Proteobacteria602Open in IMG/M
3300009078|Ga0105106_10414985All Organisms → cellular organisms → Bacteria970Open in IMG/M
3300009087|Ga0105107_10058736All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales2717Open in IMG/M
3300009089|Ga0099828_10527637All Organisms → cellular organisms → Bacteria → Proteobacteria1064Open in IMG/M
3300009090|Ga0099827_11099497Not Available690Open in IMG/M
3300009101|Ga0105247_10771926All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300009137|Ga0066709_102085694All Organisms → cellular organisms → Bacteria → Acidobacteria784Open in IMG/M
3300009137|Ga0066709_103007523All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300009174|Ga0105241_10635585All Organisms → cellular organisms → Bacteria968Open in IMG/M
3300009177|Ga0105248_10800021All Organisms → cellular organisms → Bacteria1064Open in IMG/M
3300009545|Ga0105237_11967293All Organisms → cellular organisms → Bacteria593Open in IMG/M
3300009815|Ga0105070_1085064All Organisms → cellular organisms → Bacteria613Open in IMG/M
3300010040|Ga0126308_10222804All Organisms → cellular organisms → Bacteria → Acidobacteria1219Open in IMG/M
3300010304|Ga0134088_10164137All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300012022|Ga0120191_10002424All Organisms → cellular organisms → Bacteria1749Open in IMG/M
3300012034|Ga0137453_1003180All Organisms → cellular organisms → Bacteria2016Open in IMG/M
3300012035|Ga0137445_1075591All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300012681|Ga0136613_10799380Not Available502Open in IMG/M
3300012975|Ga0134110_10338386All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria656Open in IMG/M
3300014265|Ga0075314_1016817All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300014268|Ga0075309_1196547All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300015241|Ga0137418_11271062All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300015359|Ga0134085_10476687All Organisms → cellular organisms → Bacteria → Acidobacteria568Open in IMG/M
3300015371|Ga0132258_10499958All Organisms → cellular organisms → Bacteria3040Open in IMG/M
3300015371|Ga0132258_11739600All Organisms → cellular organisms → Bacteria1572Open in IMG/M
3300015371|Ga0132258_13579326All Organisms → cellular organisms → Bacteria → Acidobacteria1063Open in IMG/M
3300016319|Ga0182033_11325239All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300017656|Ga0134112_10160282All Organisms → cellular organisms → Bacteria868Open in IMG/M
3300018078|Ga0184612_10341045All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300018082|Ga0184639_10123337All Organisms → cellular organisms → Bacteria1374Open in IMG/M
3300018431|Ga0066655_10286258All Organisms → cellular organisms → Bacteria1068Open in IMG/M
3300018433|Ga0066667_11252586All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300018468|Ga0066662_10199748All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300018476|Ga0190274_10146320All Organisms → cellular organisms → Bacteria1985Open in IMG/M
3300018481|Ga0190271_10661594All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300018482|Ga0066669_10794232All Organisms → cellular organisms → Bacteria838Open in IMG/M
3300019360|Ga0187894_10043672All Organisms → cellular organisms → Bacteria → Proteobacteria2707Open in IMG/M
3300019360|Ga0187894_10502730All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300019362|Ga0173479_10167639All Organisms → cellular organisms → Bacteria → Acidobacteria895Open in IMG/M
3300025155|Ga0209320_10219831All Organisms → cellular organisms → Bacteria → Proteobacteria818Open in IMG/M
3300025165|Ga0209108_10164328Not Available1163Open in IMG/M
3300025167|Ga0209642_10591933All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300025319|Ga0209520_10542754All Organisms → cellular organisms → Bacteria → Proteobacteria676Open in IMG/M
3300025322|Ga0209641_10200947All Organisms → cellular organisms → Bacteria1497Open in IMG/M
3300025324|Ga0209640_10212213All Organisms → cellular organisms → Bacteria1642Open in IMG/M
3300025914|Ga0207671_10189862All Organisms → cellular organisms → Bacteria1602Open in IMG/M
3300025922|Ga0207646_11368990All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300025925|Ga0207650_10159969All Organisms → cellular organisms → Bacteria1784Open in IMG/M
3300026075|Ga0207708_10129006All Organisms → cellular organisms → Bacteria1976Open in IMG/M
3300026324|Ga0209470_1338612All Organisms → cellular organisms → Bacteria → Acidobacteria542Open in IMG/M
3300026537|Ga0209157_1319088All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300026540|Ga0209376_1172370Not Available1014Open in IMG/M
3300027543|Ga0209999_1063693All Organisms → cellular organisms → Bacteria703Open in IMG/M
3300027657|Ga0256865_1225232Not Available502Open in IMG/M
3300027815|Ga0209726_10011086All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria8951Open in IMG/M
3300027815|Ga0209726_10099679All Organisms → cellular organisms → Bacteria1762Open in IMG/M
3300027818|Ga0209706_10238901Not Available873Open in IMG/M
3300027842|Ga0209580_10000201All Organisms → cellular organisms → Bacteria39021Open in IMG/M
3300027909|Ga0209382_10183525All Organisms → cellular organisms → Bacteria2406Open in IMG/M
3300028812|Ga0247825_10450765All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300031740|Ga0307468_101702127All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium593Open in IMG/M
3300031770|Ga0318521_10758890All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300031796|Ga0318576_10345780All Organisms → cellular organisms → Bacteria → Acidobacteria703Open in IMG/M
3300031820|Ga0307473_11292670All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300031911|Ga0307412_10437493All Organisms → cellular organisms → Bacteria → Acidobacteria1074Open in IMG/M
3300031954|Ga0306926_10266927All Organisms → cellular organisms → Bacteria → Acidobacteria2120Open in IMG/M
3300031954|Ga0306926_11795322All Organisms → cellular organisms → Bacteria → Acidobacteria696Open in IMG/M
3300031965|Ga0326597_10131850All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3005Open in IMG/M
3300031965|Ga0326597_10191613All Organisms → cellular organisms → Bacteria → Proteobacteria2406Open in IMG/M
3300031965|Ga0326597_10681904All Organisms → cellular organisms → Bacteria → Proteobacteria1085Open in IMG/M
3300032001|Ga0306922_11750206All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300032013|Ga0310906_10560622All Organisms → cellular organisms → Bacteria → Acidobacteria782Open in IMG/M
3300033290|Ga0318519_10652038All Organisms → cellular organisms → Bacteria → Acidobacteria642Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil17.46%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil6.35%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere6.35%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.56%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.56%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.17%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.17%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil3.17%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.17%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.38%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater2.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.38%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.38%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.38%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.38%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.59%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.59%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.59%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere1.59%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.59%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.59%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks1.59%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere1.59%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.59%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.79%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.79%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.79%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.79%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.79%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.79%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2162886013Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300002223Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006042Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3Host-AssociatedOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006853Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009087Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009815Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300012022Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C6EnvironmentalOpen in IMG/M
3300012034Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2EnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012681Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06)EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300014265Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2EnvironmentalOpen in IMG/M
3300014268Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300025155Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025319Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 1EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026324Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes)EnvironmentalOpen in IMG/M
3300026537Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027543Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)Host-AssociatedOpen in IMG/M
3300027657Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 HiSeqEnvironmentalOpen in IMG/M
3300027815Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes)EnvironmentalOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
SwBSRL2_0017.000042102162886013Switchgrass RhizosphereLTAAGFEQVAIRERFDSFRGTTKERTARKFGVIGVNVYAAKPK
ICChiseqgaiiFebDRAFT_1047122413300000363SoilLLGHRGFERVVVKERFDCFRGTSKERVAAKYGVAGVNVYARKPR*
JGI1357J11328_1003899933300000574GroundwaterMEILRGIGFQDVELRRRFDPFRATTKEAVARKFGVVGVNVYARKPN*
JGI11643J11755_1123834513300000787SoilLPEAELLALLTQIGFRDVAVTDRFDCFDDTTKERTARKYGVVGVNVYAAKX*
JGI11643J12802_1129813623300000890SoilQIGFRDVAVTDRFDCFDDTTKERTARKYGVVGVNVYAAKS
C687J26845_1002120833300002223SoilLLNDLGFRDVRVVQRFDCFRATSKERTARNYGVRGVNVLARKPHSLTRSRY*
Ga0062593_10023540923300004114SoilVLLGHLGFDEVDVKERFDCFRGTSKEGVARKYGVVGVNVYARKPLSTVR*
Ga0062589_10289978813300004156SoilVVLTQTGFQNVAIRERFDCFRGTSKERTARTYGVIGVNVYATKPR*
Ga0062590_10094434513300004157SoilGQIGFEDVAIQERFDCFRGTSKERVAMKYGVVGVNVYARKPGRR*
Ga0062590_10258892323300004157SoilLVALLGHLRFDDVVVKERFDCFRGTSKEGVARKYGVVGVNVYAQKPAVTMKVIS*
Ga0063356_10303885723300004463Arabidopsis Thaliana RhizosphereVALLEQIGFSGVVIKQRFDCFRGTSKEGVAKKYGVVGVNVYAHKANRL*
Ga0062592_10056948923300004480SoilVALLEQIGFSGVVIKQRFDCFRGTSKEGVAKKYGVIGVNVYAHKANRL*
Ga0066683_1017453423300005172SoilVGLLTQLGFQGVVAKERFDCFRGTSKEGVARKYGVVGVNVHACKPVG*
Ga0066679_1027092733300005176SoilELVGLLGHLGFNDVVVKERFDCFRGTSKEGVARKYGVVGVNVYARKPR*
Ga0066685_1014450113300005180SoilLPEAELIAVLSQIGFTDVVVRDRFDCFRGTSKEGVAKKYGVVGVNVYASKGRDGAPKN*
Ga0066685_1066219633300005180SoilLLTQIGFQGVIVKERFDCFRGTSKEGVAKKYGVSGVNVYASKP*
Ga0066678_1029522213300005181SoilIGFQNVELRERFDPFRGTSKEKIARQFGVVGVNVYAQKRKV*
Ga0066678_1093121523300005181SoilRSLDRLNCRRSAELITLLTQIGFQGVVVKERFDCFRGTSKEGVAKKYGVSGVNVYASKP*
Ga0065712_1011956533300005290Miscanthus RhizosphereVLLGHLGFDEVDVKERFHCFRGTSKEGVARKYGVVGVNVYARKPLSTVR*
Ga0065705_1012623033300005294Switchgrass RhizosphereLTAAGFEQVAIRERFDSFRGTTKERTARKFGVIGVNVYAAKPK*
Ga0070692_1089581123300005345Corn, Switchgrass And Miscanthus RhizosphereVALLEQIGFSDVVIRQRFDCFRGTSKEGVATKYGVVGVNLYAHKANRL*
Ga0070708_10039118123300005445Corn, Switchgrass And Miscanthus RhizosphereVLAAAGFRDVEIRERFDCFRGTSKEAIARKYGVMGVNVFGCKPS*
Ga0070708_10186881913300005445Corn, Switchgrass And Miscanthus RhizosphereELAVVLHQIGFHDVAIRERFDCFRGSSKERTARKYGVIGVNVYARKDE*
Ga0066686_1045029423300005446SoilLIQVLRGIGFQNVELRERFDPFRGTSKEKIARQFGVVGVNVYAQKRKV*
Ga0070706_10079145913300005467Corn, Switchgrass And Miscanthus RhizosphereVLGRVGLSDVRVTDRYDCFRGTSKEGVARKYGVIGVNVYARKPELP*
Ga0070699_10101004223300005518Corn, Switchgrass And Miscanthus RhizosphereMLLGQIGFEGVVLKERFNCFRGTSKEGVATKYGVVGVNVYALRG
Ga0070697_10190778713300005536Corn, Switchgrass And Miscanthus RhizosphereVGLSDVRVTDRYDCFRGTSKEGVARKYGVVGVNVYARKPELP*
Ga0070732_1000042363300005542Surface SoilVAELLNVLSAVGFGQVEVRERFDCFRGTTKERTARKYGVMGVNVHARKPA*
Ga0066692_1054860613300005555SoilIGFQGVIVKERFDCFRGTSKEGVAKKYGVSGVNVYASKP*
Ga0066704_1076498223300005557SoilLIQVLRGIGFQNVELRERLDPFRGTSKEKIARQFGVIGVNVYAQKRKV*
Ga0066698_1033596533300005558SoilVLLGHLGFNDVVVKERFDCFRGTSKEGVARKYGVVGVNVY
Ga0066698_1053903423300005558SoilLIQVLRGIGFQNVELRERFDPFRGTSKEKIARQFGVIGVNVYAQKRKV*
Ga0066702_1061597223300005575SoilVGLLTQLGFESVAVKERFDCFRGTSKEDVARKYGVVGVNVHASRPDRR*
Ga0066708_1087564723300005576SoilVLLGHLGFNDVVVKERFDCFRGTSKEGVARKYGVVGVNVYARKPR*
Ga0068852_10148865023300005616Corn RhizosphereVLTQAGFSNVRALDHFDCFRQTSKERTARKYGVMGVNVY
Ga0068864_10108309213300005618Switchgrass RhizosphereLLGHLGFDDVVVKERFDCFRGTSKERVAMKYGVIGVNVYARKPR*
Ga0066905_10012106733300005713Tropical Forest SoilVLARVGFSSVRVTDRYDCFRATAKESVARKFGVIGVNVYARKPS*
Ga0081455_1063147123300005937Tabebuia Heterophylla RhizosphereVLKATGFEQVEVREQFDCFRGTSKERTARKYGVVGLNVYARKPFQE*
Ga0066696_1101371023300006032SoilVGLLTQLGFQGVVAKERFDCFRGTSKEGVARKYGVVGVNVHASRPDRR*
Ga0066656_1056459813300006034SoilMTLLTQIGFQRVVVKERFDCFRGTSKEGVAKKYGVSGVNLYAAKPKPEAP*
Ga0075368_1027217423300006042Populus EndosphereVLGRVGFADVRVVERFDCFQGTTKERTAQKYGVIGVNVYARKE*
Ga0066660_1112350323300006800SoilGALPEAELVGLLTQLGFQDVVAKERFDCFRGTSKEGVAKKYGVVGVNVHASKPHRP*
Ga0079220_1084607223300006806Agricultural SoilVLTETGFSDVAITHRFDCFHGTSKEGTARKYGVIGVNVFARRAQ*
Ga0075428_10098243823300006844Populus RhizosphereVALLEQIGFSDIVIKQRFDCFRGTSKEGVAKKYGVVGVNVYAHKANRP*
Ga0075428_10240308813300006844Populus RhizosphereELVALLGHLGFDDVVVKERFDCFRGTSKERVAAKYGVVGVNVYARKPR*
Ga0075420_10193516213300006853Populus RhizosphereLLGDIGFEGVAVRQHFDCFRGTSKEGVARKYEVVGVNVFAHTPGKR*
Ga0075429_10093143013300006880Populus RhizosphereVALLEQIGFSDIVLKQRFDCFRGTSKEGVAKKYGVVGVNVYAHKANRP*
Ga0079215_1012486913300006894Agricultural SoilVTLLGHLGFERVVVKERFDCFRGTSKERVAAKYGVAGVNVY
Ga0075424_10227228013300006904Populus RhizosphereEAELLALLGQIGFDDVAAKQRFDCFRGTSKEGVARKYGVVGVNVYARKPNRR*
Ga0075436_10094747223300006914Populus RhizosphereVLTRVGFSGARVTDRFDCFRGTSKEGVARKYGVLGVNVYARRPD*
Ga0079218_1019819633300007004Agricultural SoilVTLLGHLGFERVVVKERFDCFRGTSKERVAAKYGVAGVNVYARKPR*
Ga0066710_10018652123300009012Grasslands SoilVLNAIGFTMVDVTEHFDCFAGTSKEGTARKYGVFGVNVHARKP
Ga0066710_10342506223300009012Grasslands SoilLIQVLRGIGFQNVELRERFDPFRGTSKEKIARQFGVVGVNVYAQKRKV
Ga0105106_1041498523300009078Freshwater SedimentMEILRGIGFQDVELRRRFDPFRATTKEPVARKFGVIGVNVYARKPN*
Ga0105107_1005873623300009087Freshwater SedimentVAELVEALGSAGLSDVRVDRSFDCFRGTSKENVASKYGVRGVNVYGRKRA*
Ga0099828_1052763723300009089Vadose Zone SoilLIQVLQGIGFQNVELRERFDPFRGTSKEKIARQFGVIGVNVYAQKRKV*
Ga0099827_1109949723300009090Vadose Zone SoilLIQVLRGVGFQNVELRERFDPFRGTSKEKIARQFGVIGVNVYAQKRKV*
Ga0105247_1077192623300009101Switchgrass RhizosphereVLTQAGFSNVRALDHFDCFRQTSKERTARKYGVMGVNVYARKA*
Ga0066709_10208569423300009137Grasslands SoilLLAQIGFQGVVVNERFDCFRGTSKEGVARKYGVAGVNLHACKPR*
Ga0066709_10300752323300009137Grasslands SoilMTLLTQIGFQGVIVKERFDCFRGTSKEDVAKKYGVSGVNVYASKP*
Ga0105241_1063558523300009174Corn RhizosphereVLTQAGFSNVRVLDHFDCFRQTSKERTARKYGVMGVNVYARKA*
Ga0105248_1080002133300009177Switchgrass RhizosphereGRLGFIGVRVTERFDAFRGTSKERTAQKYGVIGVNVYAQKRATGETL*
Ga0105237_1196729313300009545Corn RhizosphereVGFIDIRVTDRFECFRGTSKERTALKYGVIGVNVYARKPTAQ*
Ga0105070_108506413300009815Groundwater SandLGGAGFEAVEIRERFDCFAGTTKERVARKYGVSGVNVYARKPART*
Ga0126308_1022280433300010040Serpentine SoilELVALLGHLGFEDVVIRERFDRFRRTSKEGVARKYGVAGVNVYARKPRRR*
Ga0134088_1016413723300010304Grasslands SoilMTLLTQIGFQGVIVKERFDCFRGTSKEGVAKKYGVSGVNVYASKP*
Ga0120191_1000242423300012022TerrestrialVPFLNLIGFSDITIKERFDCFRGTRKEGTARKYGVAGMNVFARKPPRR*
Ga0137453_100318023300012034SoilALPEAELIALLREVGFHDVALKERFDCFRGTSKEAIAAKYGVIGVNVYARKPNRG*
Ga0137445_107559113300012035SoilGFERVEIRERFDCFRGTTKERTARKYGVMGVNVYARKP*
Ga0136613_1079938013300012681Polar Desert SandMLGSIGFRDVEVRERFDSFRGTSKERFARKYGVMGVNVYARKP*
Ga0134110_1033838623300012975Grasslands SoilLIQVLRGIGFQNVELRERFDPFRGTSKEKIARQFGVIGVNVYAQKQKV*
Ga0075314_101681733300014265Natural And Restored WetlandsVALLAQIGFDDVVVKERFDCFRGTSKEGVATKYGVVGVNVHARRPNRR*
Ga0075309_119654723300014268Natural And Restored WetlandsMTLLADLGFHAAEVRDRFDCFRGTSKERVALKYGVTGVNVYAVKPH*
Ga0137418_1127106213300015241Vadose Zone SoilEAELVVLLGDLGFNDVVVKERFDCFRGTSKEGVARKYGVVGVNVYARKPR*
Ga0134085_1047668723300015359Grasslands SoilGHLGFDGVVVKERFDCFRGTSTERVAMKYGVVGVNVYARKPLSTVR*
Ga0132258_1049995823300015371Arabidopsis RhizosphereVALLAQVGFRDVAVTDRFDCFHDTSKERVARTYGVVGVNVYAARP*
Ga0132258_1173960033300015371Arabidopsis RhizosphereLVRVGFSGVRVTERYDCFRATSKESVARKFGVVGVNVHARKP*
Ga0132258_1357932623300015371Arabidopsis RhizosphereVLRAAGFAPVEVRGRFDCFIGTSKERTAKKYGVIGLNVFARRPVR*
Ga0132257_10186593313300015373Arabidopsis RhizosphereMEVLSSIGFKDVNVAERFDPFRGTSKEGTAQKFGVTGVNVLARKP*
Ga0182033_1132523923300016319SoilVALLGHLGFADVIVKERFDCFRGTSKERVAMKYGVVGVNVYARKPR
Ga0134112_1016028213300017656Grasslands SoilMTLLTQIGFQRVVVKERFDCFRGTSKEGVAKKYGVSGVNLYAAKPKPEAP
Ga0184612_1034104523300018078Groundwater SedimentVLAGVGFEAVELRERFDCFRGTTKEGVARKYGVTGVNVYARKPDRTA
Ga0184639_1012333743300018082Groundwater SedimentALNGIGFHDVEVRERFDPFRGTSKERIARKFGVLGVNVYARKPDPTAAEPRGRHR
Ga0066655_1028625823300018431Grasslands SoilVLLGHLGFNDVVVKERFDCFRGTSKEGVARKYGVVGVNVYARKPR
Ga0066667_1125258623300018433Grasslands SoilVALLTQLGFQGVVVKERFDCFRGTSKEGVARKYGVIGVNVHASKPDRR
Ga0066662_1019974823300018468Grasslands SoilMTLLTEIGFQGVVVKERFDCFRGTSKEGVAKKYGVSGVNVYASKP
Ga0190274_1014632033300018476SoilVGLIDIRVTDRFECFRGTSKERTALKYGVIGVNVYARKPTAP
Ga0190271_1066159423300018481SoilVTLLGHLGFEEVVVKERFDCFRGTSKERVAAKYGVVGVNVYARKPR
Ga0066669_1079423223300018482Grasslands SoilVRLLTQLGFESVAVKERFDCFRGTSKEDVARKYGVVGVNVHASRPDRR
Ga0187894_1004367233300019360Microbial Mat On RocksLRATGFEHVAVRKQFDCFRGSSKERTAKKYGVVGVNVYARKPMCTEVRSIR
Ga0187894_1050273013300019360Microbial Mat On RocksVLGRVGFAAVREVERFDCFQGTTKERTARKYGVMGVNVYARKD
Ga0173479_1016763923300019362SoilGHLSFDDVVVTERFDCFRGTSKEGVARKYGVVGVNVYAHKPAVTLKVIS
Ga0209320_1021983123300025155SoilMEILSGIGFKDVEFRGRFDPFRTTTKESVARKFGVIGVNVYARKPN
Ga0209108_1016432833300025165SoilLTAAGFEQVAIPERFDCFRGTTKERTARKYGVMGVNVYAVKPE
Ga0209642_1059193313300025167SoilEAELVQLLNDLGFRDVRVVQRFDCFRATSKERTARNYGVRGVNVLARKPHSLTRSRY
Ga0209520_1054275423300025319SoilMEILSGIGFQDVELRARFDPFRATTKEPVARKFGVIGVNVFARKPN
Ga0209641_1020094743300025322SoilIGFKDVEFRGRFDPFRTTTKESVARKFGVIGVNVYARKPN
Ga0209640_1021221323300025324SoilMVGFEQVEIRERFDCFRGTTKERTARKYGVMGVNVYAAKPM
Ga0207671_1018986223300025914Corn RhizosphereVLTQAGFSNVRALDHFDCFRQTSKERTARKYGVMGVNVYARKA
Ga0207646_1136899013300025922Corn, Switchgrass And Miscanthus RhizosphereVLGRVGLSDVRVTDRYDCFRGTSKEGVARKYGVIGVNVYARKPELP
Ga0207650_1015996923300025925Switchgrass RhizosphereVLLGHLGFDEVDVKERFDCFRGTSKEGVARKYGVVGVNVYARKPLSTVR
Ga0207708_1012900633300026075Corn, Switchgrass And Miscanthus RhizosphereVALLEQIGFSDVVIRQRFDCFRGTSKEGVATKYGVVGVNLYAHKANRL
Ga0209470_133861223300026324SoilPEAELVGLLGHLGFNDVVVKERFDCFRGTSKEGVARKYGVVGVNVYARKPR
Ga0209157_131908823300026537SoilVGLLTQLGFQGVVAKERFDCFRGTSKEGVARKYGVVGVNVHACKPVG
Ga0209376_117237043300026540SoilVLSQIGFTDVVVRDRFDCFRGTSKEGVAKKYGVVGVNVYASKGRDGAPKN
Ga0209999_106369313300027543Arabidopsis Thaliana RhizosphereVALLEQIGFSGVVIKQRFDCFRGTSKEGVAKKYGVVGVNVYAHKANRL
Ga0256865_122523223300027657SoilIAGALPEAELLALLGQIGFSDVVVKDRYACFRGTSKEGVAAKYGVVGVNVYARRPN
Ga0209726_1001108673300027815GroundwaterMEILRGIGFQDVELRRRFDPFRATTKEAVARKFGVVGVNVYARKPN
Ga0209726_1009967913300027815GroundwaterMTTILSQIGFRDVEVRERFDPFRSTSKEQVARKFGVMGVNVYARKPEVNL
Ga0209706_1023890113300027818Freshwater SedimentVAELVEALGSAGLSDVRVDRSFDCFRGTSKENVASKYGVRGVNVYGRKRA
Ga0209580_10000201113300027842Surface SoilVAELLNVLSAVGFGQVEVRERFDCFRGTTKERTARKYGVMGVNVHARKPA
Ga0209382_1018352543300027909Populus RhizosphereVALLEQIGFSDIVIKQRFDCFRGTSKEGVAKKYGVVGVNVYAHKANRP
Ga0247825_1045076523300028812SoilVTLLGRLGFEEVVVKERFDCFRGTSKERVAAKYGVVGVNVYARKPR
Ga0307468_10170212713300031740Hardwood Forest SoilRVGFSDVRVTDRYDCFRGTSKEGVARKFGVIGVNVYARKP
Ga0318521_1075889013300031770SoilHLGFEDVVIKERFDCFRGTSKERTALKYGVIGVNVHARRPR
Ga0318576_1034578023300031796SoilELVALLGHLGFDDVVVKERFDCFRATSKERVAMKYRVVGVNVYARKLR
Ga0307473_1129267023300031820Hardwood Forest SoilVLTRVGFSGVRVTDRYDCFRGTSKENVARTFGVIGVNVHARKPSRR
Ga0307412_1043749313300031911RhizosphereAELVALLGHLGFNDVVVKERFDCFRGTAKEAVARKYRVVGVNVSARKPR
Ga0306926_1026692743300031954SoilAELVALLGHLGFADVIVKERFDCFRGTSKERVAMKYGVVGVNVYARKPR
Ga0306926_1179532223300031954SoilLLGHLGFEDVVIKERFDCFRGTSKERTALKYGVIGVNVHARRPR
Ga0326597_1013185063300031965SoilMEILRGIGFQDVELRRRFDPFRATTKEAVARKFGVIGVNVYARKPN
Ga0326597_1019161333300031965SoilVLTAVGFGQVEIRGRFDCFRGTTKERTARKYGVIGVNVYARKPVGQS
Ga0326597_1068190423300031965SoilMVSGLTEAGFAGVRVVERFDCYRGTPKEKVARQYGVHGVNVYARKP
Ga0306922_1175020613300032001SoilVELLGHIGLEGVAVQERFDCFRGTSKERVAMKYGVVGVNVYARKPR
Ga0310906_1056062213300032013SoilVALLGHLGFDDVVVKERFDCFRGTSKERVAMKYGVVGVNVYARKPLSTLR
Ga0318519_1065203833300033290SoilFDDVVVKERFDCFRATSKERVAMKYRVVGVNVYARKLR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.