 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F066586 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 42 residues |
| Representative Sequence | METLKQVSLTWFRAAASAAIALYLAGETDVKTLGAAALAGF |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 99.18 % |
| % of genes near scaffold ends (potentially truncated) | 96.03 % |
| % of genes from short scaffolds (< 2000 bps) | 84.13 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.48 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (80.952 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (23.016 % of family members) |
| Environment Ontology (ENVO) | Unclassified (47.619 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (56.349 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.83% β-sheet: 0.00% Coil/Unstructured: 52.17% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF13884 | Peptidase_S74 | 2.38 |
| PF12810 | Gly_rich | 0.79 |
| PF00535 | Glycos_transf_2 | 0.79 |
| PF01755 | Glyco_transf_25 | 0.79 |
| PF13641 | Glyco_tranf_2_3 | 0.79 |
| PF05345 | He_PIG | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG3306 | Glycosyltransferase involved in LPS biosynthesis, GR25 family | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 80.95 % |
| All Organisms | root | All Organisms | 19.05 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 23.02% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 18.25% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.29% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.52% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 7.14% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 5.56% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.59% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 1.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.59% |
| Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.59% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.59% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.59% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.79% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.79% |
| Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.79% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.79% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.79% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.79% |
| Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.79% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.79% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.79% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.79% |
| Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.79% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300002206 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - OCT 2012 | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005417 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005418 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel3S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005420 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005421 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
| 3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008264 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009051 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-02 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300011984 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012715 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES122 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012764 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES155 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012970 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020524 | Freshwater microbial communities from Lake Mendota, WI - 16NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020557 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020561 | Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
| 3300024350 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8d | Environmental | Open in IMG/M |
| 3300024357 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300024358 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8d | Environmental | Open in IMG/M |
| 3300024531 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024548 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300024562 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028265 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Law_RepB_8h | Environmental | Open in IMG/M |
| 3300029286 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18m | Environmental | Open in IMG/M |
| 3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
| 3300029933 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727_2 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
| 3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12421J11937_101169542 | 3300000756 | Freshwater And Sediment | MEQFKQLALTWFRAAAAAVLVVYMTGEYSAKTLAAAAVAGMAGPVL |
| JGI12421J11937_101355342 | 3300000756 | Freshwater And Sediment | MEXFKQIALTWFRAAAASAIALFLAGEQDLKTLAMAAVAGFAGPLLK |
| metazooDRAFT_13011281 | 3300002206 | Lake | MDKKKLKAMAATWFRAAASAAVALYLAGETDPKKLGAAALA |
| B570J29032_1097337091 | 3300002408 | Freshwater | MEQFKQLGLTWFRAAAASAVALFLAGESDPKTLAMAAIA |
| JGI25908J49247_101539231 | 3300003277 | Freshwater Lake | MEQFKQIALTWFRAAAASAIALYLAGETDLKTLAMAAVAGFAGPVL |
| Ga0007763_114526691 | 3300004796 | Freshwater Lake | MEQFKQLSLTWFRAAASAAVALYLAGETDLKTLGAAALAGFAG |
| Ga0068884_15806611 | 3300005417 | Freshwater Lake | MEVLKQVSLTWFRASAAAAIALYLAGETDLKVLGTAALAGFLGPVLKW |
| Ga0068881_15022672 | 3300005418 | Freshwater Lake | MEQLKQISLTWFRAAASAAIALYLAGETNWKTLGAAALAGFLG |
| Ga0068879_10213343 | 3300005420 | Freshwater Lake | METLKQVSLTWFRAAASAAIALYLAGETDFKTLGMAALAGFLGPVLKWL |
| Ga0068882_10021463 | 3300005421 | Freshwater Lake | MKEQLKQISLTWFRAAAAAAIALYLAGETDLKVLGTAALAGFLGPVLKW |
| Ga0068876_101793101 | 3300005527 | Freshwater Lake | MKEQLKQVSLTWFRASAAAAIALYLAGETDFKVLGTAALAGFLGPVLK |
| Ga0068872_101195621 | 3300005528 | Freshwater Lake | MEQFKQIGLTWFRAAAASAVALYLAGETDLKTLAMAAVAGFAGPLL |
| Ga0068872_106705402 | 3300005528 | Freshwater Lake | METLKQVSLTWFRAAAAAAIALYLAGETDLKVLGTAALAGFLGPVLKW |
| Ga0075470_100094664 | 3300006030 | Aqueous | MKEQLKQVSLTWFRAAASAAIALYLAGETDVKVLGTAALAGFLGPVLKW |
| Ga0070749_105756541 | 3300006802 | Aqueous | METLKQVSLTWFRAAAAAAIALYLAGETNIKVLGTAALAGFL |
| Ga0075473_101301124 | 3300006875 | Aqueous | MDKKFKAMAASWFRAAASAAVALYLAGETDPKKLGAAALAGFLGPVLKWL |
| Ga0102689_10086074 | 3300007304 | Freshwater Lake | MKEQLKQVSLTWFRAAAAAAIALYLAGETDLKTLGTAALAGFLGPVLKW |
| Ga0102689_11338641 | 3300007304 | Freshwater Lake | METLKQVSLTWFRAAASAAIALYLAGETDLKTLGTAALAGFLGPVLK |
| Ga0102689_11569261 | 3300007304 | Freshwater Lake | METLKQISLTWFRAAASAAIALYLAGETDLKTLGTAALAGFLGPVLK |
| Ga0099848_10338474 | 3300007541 | Aqueous | MEQLKQVGLTWFRASAAAAIALYLAGETNLKVLGTAALAGFLGPVL |
| Ga0102863_10899261 | 3300007622 | Estuarine | MEQFKQVALTWFRAAAASAVALFLAGESDLKTLSMA |
| Ga0105746_10941533 | 3300007973 | Estuary Water | MEQFKQIALTWFRASAASAVALFLAGESDPKTLAMAALA |
| Ga0114340_11009514 | 3300008107 | Freshwater, Plankton | MEALKQVSLTWFRAAASAAIALYLAGETNWKTLGAAA |
| Ga0114346_10333671 | 3300008113 | Freshwater, Plankton | MEQFKQITLSWFRAAAAASIALYLAGETDLKTLGMAALAGAAGPILKW |
| Ga0114346_11440684 | 3300008113 | Freshwater, Plankton | METLKQVSLTWFRAAASAAIALYLAGETDFKTLGMA |
| Ga0114350_11043663 | 3300008116 | Freshwater, Plankton | METLKQVSLTWFRAAASAAIALYLAGETNIKTLGMA |
| Ga0114355_11664573 | 3300008120 | Freshwater, Plankton | MKINEQFKQMSLTWFRAAASAAVALYLAGETDPKVLGTAA |
| Ga0114355_12119503 | 3300008120 | Freshwater, Plankton | MNAKLQSAALSWFRAAAAAAVALYLAGETDLKTLGMAALTGFLGPV |
| Ga0114841_10415581 | 3300008259 | Freshwater, Plankton | MEALKQVSLTWFRAAASAAIALYLAGETDFKTLGM |
| Ga0114841_10728831 | 3300008259 | Freshwater, Plankton | MNAKFQAVALSWFRAAASAAVALYLTGVTDFKTLGMAALAGFL |
| Ga0114337_10087261 | 3300008262 | Freshwater, Plankton | MEQFKQISLSWFRAAAAAAIALYLAGETDLKTLGMAAL |
| Ga0114337_11511332 | 3300008262 | Freshwater, Plankton | METLKQVSLTWFRAAASAAIALYLAGETDVKTLGAAALAGFLGSRVVCR* |
| Ga0114353_12543373 | 3300008264 | Freshwater, Plankton | MEALKQVSLTWFRAAASAAIALYLAGETDLKTLGMAAL |
| Ga0114363_11224523 | 3300008266 | Freshwater, Plankton | MEQLKQASLSWFRAAASAAIALYLAGETDFKTLGAAALAGFLGPVLK |
| Ga0114880_12265752 | 3300008450 | Freshwater Lake | MKINEQFKQMSLTWFRAAASAAVALYLAGETDPKVL |
| Ga0102864_12189112 | 3300009051 | Estuarine | METLKQVALTWFRAAASAAIALYLAGETDFKTLGAAALAGFLGPVLK |
| Ga0105103_108027861 | 3300009085 | Freshwater Sediment | MEQFKQLALTWFRAAASAAIALYLAGETDLKTLAMAAAAGF |
| Ga0129336_106851871 | 3300010370 | Freshwater To Marine Saline Gradient | METLKQVSLTWFRAAAAAAIALYLAGETDLKVLGTAALA |
| Ga0119931_10278062 | 3300011984 | Drinking Water Treatment Plant | MEQFKQVALTWFRAAAASAVALYLAGQTDLKVLGTAALTGFLGPVLK |
| Ga0153799_10542503 | 3300012012 | Freshwater | MEQFKQIALTWFRAAAASAIALYLAGETDLKTLAM |
| Ga0157599_11804571 | 3300012715 | Freshwater | MEQFKQLGLTWFRAAAASAVALFLAGESDPKTLAMAAIAGFAGPLLKW |
| Ga0157616_12371593 | 3300012731 | Freshwater | MEQFKQIALSWFRAAASAAVALYLVGETDLKTLGLA |
| Ga0157624_11800983 | 3300012764 | Freshwater | MEQFKQIALSWFRAAASAAVALYLVGETDLKTLGLAALSGAAGPVLK |
| Ga0129338_14463654 | 3300012970 | Aqueous | MEALKQVSLTWFRAAASAAIALYLAGETDVKTLGAA |
| Ga0164293_104696531 | 3300013004 | Freshwater | MEALKQVSLTWFRAAASAAIALYLAGETDIKTLGMAALA |
| Ga0164292_101876163 | 3300013005 | Freshwater | MNAKFQAAALSWFRAAAASAIALYLAGQTDLKVLATAALTGFLGPV |
| (restricted) Ga0172376_100599425 | 3300014720 | Freshwater | MEALKQVSLTWFRAAASAAIALYLAGETDFKTLGMAALAGFLGPVLK |
| (restricted) Ga0172376_106339192 | 3300014720 | Freshwater | METLKQVSLTWFRAAAAAAIALYLAGETDFKVLGTAA |
| Ga0181364_10110311 | 3300017701 | Freshwater Lake | MEALKQVALTWFRAAASAAIALYLAGETNFKTLGMAALAG |
| Ga0181350_11220071 | 3300017716 | Freshwater Lake | MEQFKQIALTWFRAAAASAIALYLAGETDLKTLAMAAVAGFAG |
| Ga0181365_11462312 | 3300017736 | Freshwater Lake | MEQLKQVSLTWFRAAAAAAIALYLAGETNLKVLGTAALA |
| Ga0181343_11031111 | 3300017766 | Freshwater Lake | VETLKQISLTWFRAAASAAIALYLAGETDLKTLGAAALAGFLGPV |
| Ga0181355_11486504 | 3300017785 | Freshwater Lake | MEQFKQLALTWFRAAASAAVALYLAGETDLKTLAMA |
| Ga0181355_13288952 | 3300017785 | Freshwater Lake | METLKQVSLTWFRAAASAAIALYLAGETDFKTLGMAALAGFLGPVLK |
| Ga0181563_102465491 | 3300018420 | Salt Marsh | MNAKFKAVSVTWFRAAASAAVALYLAGETDPKKLGAAAL |
| Ga0181359_11578371 | 3300019784 | Freshwater Lake | MEQFKQIALTWFRAAAASAIALFLAGENDLKTLGYAALAGAAGP |
| Ga0207193_18580632 | 3300020048 | Freshwater Lake Sediment | MEQFKQLALTWFRAAASAAVALYLAGETDLKTLAMAAAA |
| Ga0211731_107448601 | 3300020205 | Freshwater | MEQFKQLGLTWFRAAASAAVALYLAGETDLKTLGAAALAGFAGPLLK |
| Ga0208858_10180101 | 3300020524 | Freshwater | MEQFKQIGLTWFRAAAASAIALYLAGETDLKTLAMAAVAGFAGPL |
| Ga0208855_10451641 | 3300020553 | Freshwater | MEQFKQIALSWFRAAASAAVALYLVGETDLKTLGLAALS |
| Ga0208231_10390793 | 3300020557 | Freshwater | MEQFKQLSLTWFRAAASAAVALYLAGETDLKTLGAAALAGFAGPLLKWL |
| Ga0207934_10881912 | 3300020561 | Freshwater | MEQFKQLALTWFRAAAAAVVAIYMTGETNPKTLAAAATTPIKI |
| Ga0222714_103963461 | 3300021961 | Estuarine Water | METLKQVSLTWFRAAASAAIALYLAGETDVKTLGAAALAGFLG |
| Ga0222713_104292091 | 3300021962 | Estuarine Water | MEQLKQVGLTWFRASAAAAIALYLAGETNLKVLGTAALAGFLVPV |
| Ga0181354_10359291 | 3300022190 | Freshwater Lake | MEQFKQIALSWFRAAAAAAIALYLAGETDLKTLGM |
| Ga0255147_10840392 | 3300024289 | Freshwater | METLKQISLTWFRAAASAAIALYLAGETDVKTLGAAALAGFLGPVLK |
| Ga0255167_10038805 | 3300024350 | Freshwater | METLKQISLTWFRAAASAAIALYLAGETDVKTLGAAALAGFLGPVLKW |
| Ga0255165_10768601 | 3300024357 | Freshwater | METLKQVSLTWFRAAASAAIALYLAGETDVKTLGAAALA |
| Ga0255173_10306973 | 3300024358 | Freshwater | METLKQVSLTWFRAAASAAIALYLAGETDVKTLGAAALAGFLGPV |
| Ga0255228_10587253 | 3300024531 | Freshwater | MEALKQVALTWFRAAASAAIALYLAGETNFKTLGMAAL |
| Ga0256342_11013541 | 3300024548 | Freshwater | MKEQLKQVSLTWFRAAASAAIALYLAGETDVKTLGTAALAGFLGPVLKW |
| Ga0256336_10357911 | 3300024562 | Freshwater | METLKQVSLTWFRAAASAAIALYLAGETDVKTLGAAALAGF |
| Ga0208004_10157684 | 3300025630 | Aqueous | MEKFKQVSLTWFRAAASAAIALYLTGVTDWKTLGTA |
| Ga0208161_11315472 | 3300025646 | Aqueous | METLKQVSLTWFRAAASAAIALYLTGVTDWKTLGTAALAGF |
| Ga0255146_10050424 | 3300027396 | Freshwater | METLKQISLTWFRAAASAAIALYLAGETDVKTLGAAALAG |
| Ga0209651_10007541 | 3300027581 | Freshwater Lake | MEQFKQIALTWFRAAAASAIALFLAGENDLKTLGYAALA |
| Ga0209356_10588251 | 3300027644 | Freshwater Lake | MEQLKQIGLTWFRAAAAAAIALYLAGETDLKTLGMAAIAG |
| Ga0209617_101386403 | 3300027720 | Freshwater And Sediment | MEQFKQIALTWFRAAAASAIALYLAGETDLKTLAMAA |
| Ga0209134_102066581 | 3300027764 | Freshwater Lake | MEQFKQIALSWFRAAASAAVALYLVGETDLKTLGLAALSGAA |
| Ga0209768_104483912 | 3300027772 | Freshwater Lake | MEQFKQVALTWFRAAASAAVALYLAGETNLKVLGT |
| Ga0209972_101696851 | 3300027793 | Freshwater Lake | MKEQLKQVSLTWFRAAAAAAIALYLAGETDLKVLGTAA |
| Ga0209990_100470464 | 3300027816 | Freshwater Lake | MEQFKQLGLTWFRAAAASAVALYLAGETDLKTLAMAAVAGF |
| Ga0209990_103285192 | 3300027816 | Freshwater Lake | MEQLKQISLTWFRAAASAAIALYLAGETNWKTLGAAALAGFLGPVLK |
| Ga0209990_104075661 | 3300027816 | Freshwater Lake | MDALKQISLTWFRAAASAAIALYLAGETDLKTLGMAALAGF |
| Ga0209990_104618111 | 3300027816 | Freshwater Lake | MEQFKQITLSWFRAAAAAAIALYLAGETDLKTLGMAALAGA |
| Ga0247723_11350752 | 3300028025 | Deep Subsurface Sediment | MNAKVQAAALSWFRAAAAAAVALYLAGETDLKTLGMAALTGFLGPVLK |
| Ga0255197_10425912 | 3300028265 | Freshwater | METLKQVSLTWFRAAASAAIALYLAGETDVKTLGAAALAGFLGPVL |
| (restricted) Ga0247841_100797785 | 3300029286 | Freshwater | METLKQVGLTWFRAAAAAAIALYLAGETDLKVLGTAALAGFLGPV |
| Ga0119944_10335611 | 3300029930 | Aquatic | METLKQVSLSWFRAAASAAIALYLAGETDLKVLGTAALAGFLGPVLKW |
| Ga0119945_10365852 | 3300029933 | Aquatic | METLKQVSLSWFRAAASAAIALYLAGETDLKVLGTAALA |
| Ga0307377_108054391 | 3300031673 | Soil | MEQFKQVSLTWFRAAAAAAVALYLAGETNLKVLGTAALAGFL |
| Ga0315907_104248994 | 3300031758 | Freshwater | MEQFKQLSLTWFRAAASAAVALYIAGETDLKTLGAAALAGFAG |
| Ga0315907_104700654 | 3300031758 | Freshwater | MKVNEQLKQVSLTWFRAAAAAAIALFLAGETDLKTL |
| Ga0315907_105640963 | 3300031758 | Freshwater | MEALKQVSLTWFRAAASAAIALYLAGETDFKTLGMA |
| Ga0315907_108374501 | 3300031758 | Freshwater | MKINEQFKQMSLTWFRAAASAAVALYIAGETDPKVLGTAALAGFLGP |
| Ga0315907_110989242 | 3300031758 | Freshwater | METLKQISLTWFRAAASAAIALYLAGETDFKTLGMAALAGF |
| Ga0315900_108411521 | 3300031787 | Freshwater | METLKQVSLTWFRAAASAAIALYLAGETDVKTLGAAALAGFLGPVLKW |
| Ga0315909_100855011 | 3300031857 | Freshwater | MLEQLKQVSLTWFRAAASAAIALYLAGETDIKTLGVAAL |
| Ga0315909_102291521 | 3300031857 | Freshwater | MKEQFKQVALTWFRASAAAAIALYLAGETDLKVLGTA |
| Ga0315909_108629492 | 3300031857 | Freshwater | MKEQLKQVSLTWFRAAASAAIALYLAGETDVKVLG |
| Ga0315904_100936521 | 3300031951 | Freshwater | MKEQFKQVALTWFRASAAAAIALYLAGETDLKVLG |
| Ga0315904_103986771 | 3300031951 | Freshwater | METLKQVSLTWFRAAAAAAIALYLAGETDLKVLGTA |
| Ga0315904_107375391 | 3300031951 | Freshwater | MKEQLKQVSLTWFRAAASAAIALYLAGETDIKTLGT |
| Ga0315904_109551691 | 3300031951 | Freshwater | METLKQISLTWFRAAASAAIALYLAGETDVKTLGAA |
| Ga0315904_114159021 | 3300031951 | Freshwater | MEQFKQISLSWFRAAAAAAIALYLAGETDLKTLGMAALAGAAGP |
| Ga0315294_110333432 | 3300031952 | Sediment | MEQFKQLALSWFRAAATAVVAIYMTGETNPKTLAAAALAGVA |
| Ga0315901_107151601 | 3300031963 | Freshwater | METLKQVSLTWFRAAASAAIALYLAGETDIKTLAVAALA |
| Ga0315901_108688522 | 3300031963 | Freshwater | MEALKQVSLTWFRAAASAAIALYLAGETDIKTLGMAALAGFLGPVLK |
| Ga0315906_106575601 | 3300032050 | Freshwater | MEALKQVSLTWFRAAASAAIALYLAGETDIKTLGMAALAGF |
| Ga0315905_110056272 | 3300032092 | Freshwater | MEALKQVSLTWFRAAASAAIALYLAGETNWKTLGAAALAGFL |
| Ga0315905_110567252 | 3300032092 | Freshwater | MEQLKQVGLTWFRAAAAAAIALYLAGETDLKVLGTAA |
| Ga0315902_108257901 | 3300032093 | Freshwater | VETLKQISLTWFRAAASAAIALYLAGETDLKTLGAAALAGFL |
| Ga0315902_111428661 | 3300032093 | Freshwater | MEALKQVSLTWFRAAASAAIALYLAGETNFKTLGAA |
| Ga0315903_1000846823 | 3300032116 | Freshwater | MKINEQFKQMSLTWFRAAASAAVALYLAGETDPKVLGTAALAGF |
| Ga0315903_106151333 | 3300032116 | Freshwater | MEQFKQLSLTWFRAAASAAVALYLAGETDLKTLGAAALAGFAGPL |
| Ga0334986_0141577_1290_1397 | 3300034012 | Freshwater | MEQFKQLGLTWFRAAASAAVALYLAGETDLKTLGAA |
| Ga0334986_0616508_368_514 | 3300034012 | Freshwater | MEQFKQLSLTWFRAAASAVVALYLVGETDLKTLAMAGMAGFAGPLLKWL |
| Ga0334995_0641012_487_609 | 3300034062 | Freshwater | MEQFKQVAATWFRAAAASAVALYLAGETDLKTLAYAALAGA |
| Ga0335000_0168725_2_148 | 3300034063 | Freshwater | MEQFKQLSLSWFRAAASAAVALYLVGETDLKTLAMAALTGFAGPLLKWL |
| Ga0335019_0130153_3_131 | 3300034066 | Freshwater | MEQFKQIALSWFRAAASAAVALYLVGETDLKTLGLAALSGAAG |
| Ga0310130_0140519_1_111 | 3300034073 | Fracking Water | MEQLKQVGLTWFRAAAAAAIALYLAGETNLKVLGTAA |
| Ga0335027_0724995_450_584 | 3300034101 | Freshwater | MEQFKQLSLSWFRAAASAAVALYLVGETDLKTLAMAALTGFAGPL |
| Ga0335027_0742917_1_111 | 3300034101 | Freshwater | METLKQVSLTWFRAAASAAIALYLAGETDIKTLGMAA |
| Ga0335031_0827500_1_114 | 3300034104 | Freshwater | MEQFKQIALSWFRAAASAAVALYLVGETDLKTLGLAAL |
| Ga0335049_0327068_3_137 | 3300034272 | Freshwater | MEQFKQIALSWFRAAASAAVALYLVGETDLKTLGLAALSGAAGPV |
| Ga0335048_0317107_1_126 | 3300034356 | Freshwater | MEQLKQVGLTWFRASAAAAIALYLAGETDLKVLGTAALAGFL |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |