| Basic Information | |
|---|---|
| Family ID | F066578 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 126 |
| Average Sequence Length | 44 residues |
| Representative Sequence | FSFDLMDVPEPEWFNHWMPATTEFARSNKVSKLVGYLPIEEAVQL |
| Number of Associated Samples | 95 |
| Number of Associated Scaffolds | 126 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.62 % |
| % of genes from short scaffolds (< 2000 bps) | 92.06 % |
| Associated GOLD sequencing projects | 86 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.36 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.032 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.254 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.460 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.59% β-sheet: 21.92% Coil/Unstructured: 68.49% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 126 Family Scaffolds |
|---|---|---|
| PF00145 | DNA_methylase | 20.63 |
| PF02945 | Endonuclease_7 | 11.11 |
| PF09723 | Zn-ribbon_8 | 8.73 |
| PF13578 | Methyltransf_24 | 5.56 |
| PF05869 | Dam | 3.97 |
| COG ID | Name | Functional Category | % Frequency in 126 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 20.63 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.97 % |
| Unclassified | root | N/A | 46.03 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002294|B570J29584_1008006 | Not Available | 679 | Open in IMG/M |
| 3300002408|B570J29032_109468556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 787 | Open in IMG/M |
| 3300002835|B570J40625_100689568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 917 | Open in IMG/M |
| 3300003404|JGI25920J50251_10122274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 582 | Open in IMG/M |
| 3300003986|Ga0063233_10259382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 538 | Open in IMG/M |
| 3300004096|Ga0066177_10538896 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300004124|Ga0066178_10259359 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300004481|Ga0069718_15713484 | Not Available | 550 | Open in IMG/M |
| 3300005517|Ga0070374_10093778 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300005517|Ga0070374_10123142 | All Organisms → Viruses → Predicted Viral | 1349 | Open in IMG/M |
| 3300005517|Ga0070374_10559469 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300005527|Ga0068876_10261848 | All Organisms → cellular organisms → Bacteria | 989 | Open in IMG/M |
| 3300005528|Ga0068872_10141533 | All Organisms → Viruses → Predicted Viral | 1408 | Open in IMG/M |
| 3300005583|Ga0049085_10200528 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300006803|Ga0075467_10658387 | Not Available | 534 | Open in IMG/M |
| 3300006805|Ga0075464_11102348 | Not Available | 500 | Open in IMG/M |
| 3300007992|Ga0105748_10482726 | Not Available | 540 | Open in IMG/M |
| 3300007992|Ga0105748_10485474 | Not Available | 539 | Open in IMG/M |
| 3300008107|Ga0114340_1082765 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300008108|Ga0114341_10017613 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5161 | Open in IMG/M |
| 3300008108|Ga0114341_10196074 | Not Available | 1132 | Open in IMG/M |
| 3300008110|Ga0114343_1039501 | All Organisms → Viruses → Predicted Viral | 1899 | Open in IMG/M |
| 3300008110|Ga0114343_1185309 | Not Available | 621 | Open in IMG/M |
| 3300008113|Ga0114346_1182394 | Not Available | 859 | Open in IMG/M |
| 3300008116|Ga0114350_1037823 | Not Available | 1852 | Open in IMG/M |
| 3300008116|Ga0114350_1087787 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1692 | Open in IMG/M |
| 3300008117|Ga0114351_1161953 | All Organisms → Viruses → Predicted Viral | 1217 | Open in IMG/M |
| 3300008262|Ga0114337_1230855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 726 | Open in IMG/M |
| 3300008266|Ga0114363_1214103 | Not Available | 578 | Open in IMG/M |
| 3300008266|Ga0114363_1220133 | Not Available | 563 | Open in IMG/M |
| 3300008339|Ga0114878_1073674 | All Organisms → Viruses → Predicted Viral | 1380 | Open in IMG/M |
| 3300008448|Ga0114876_1009035 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5850 | Open in IMG/M |
| 3300008448|Ga0114876_1043251 | All Organisms → Viruses → Predicted Viral | 2094 | Open in IMG/M |
| 3300008448|Ga0114876_1123650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 988 | Open in IMG/M |
| 3300008448|Ga0114876_1142200 | Not Available | 888 | Open in IMG/M |
| 3300008448|Ga0114876_1148518 | Not Available | 858 | Open in IMG/M |
| 3300008450|Ga0114880_1082061 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
| 3300008450|Ga0114880_1240070 | Not Available | 574 | Open in IMG/M |
| 3300009009|Ga0105105_10167724 | All Organisms → Viruses → Predicted Viral | 1118 | Open in IMG/M |
| 3300009068|Ga0114973_10162772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1235 | Open in IMG/M |
| 3300009085|Ga0105103_10306284 | Not Available | 866 | Open in IMG/M |
| 3300009155|Ga0114968_10312347 | Not Available | 876 | Open in IMG/M |
| 3300009155|Ga0114968_10656454 | Not Available | 552 | Open in IMG/M |
| 3300009164|Ga0114975_10175445 | All Organisms → Viruses → Predicted Viral | 1218 | Open in IMG/M |
| 3300009164|Ga0114975_10212296 | All Organisms → Viruses → Predicted Viral | 1091 | Open in IMG/M |
| 3300009181|Ga0114969_10793114 | Not Available | 503 | Open in IMG/M |
| 3300009183|Ga0114974_10022920 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4385 | Open in IMG/M |
| 3300009183|Ga0114974_10792137 | Not Available | 509 | Open in IMG/M |
| 3300009184|Ga0114976_10189816 | Not Available | 1136 | Open in IMG/M |
| 3300009419|Ga0114982_1026553 | All Organisms → Viruses → Predicted Viral | 1897 | Open in IMG/M |
| 3300009419|Ga0114982_1200066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 619 | Open in IMG/M |
| 3300010160|Ga0114967_10130066 | All Organisms → Viruses → Predicted Viral | 1422 | Open in IMG/M |
| 3300010334|Ga0136644_10549205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 640 | Open in IMG/M |
| 3300010388|Ga0136551_1046577 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 793 | Open in IMG/M |
| 3300012006|Ga0119955_1147067 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 623 | Open in IMG/M |
| 3300012733|Ga0157606_1271467 | Not Available | 986 | Open in IMG/M |
| 3300013005|Ga0164292_10642158 | Not Available | 682 | Open in IMG/M |
| 3300013006|Ga0164294_10192711 | All Organisms → Viruses → Predicted Viral | 1449 | Open in IMG/M |
| 3300013372|Ga0177922_10289288 | All Organisms → Viruses → Predicted Viral | 2070 | Open in IMG/M |
| 3300017701|Ga0181364_1014759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1303 | Open in IMG/M |
| 3300017716|Ga0181350_1161737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300017722|Ga0181347_1211929 | Not Available | 506 | Open in IMG/M |
| 3300017723|Ga0181362_1032516 | Not Available | 1110 | Open in IMG/M |
| 3300017736|Ga0181365_1005279 | All Organisms → Viruses → Predicted Viral | 3182 | Open in IMG/M |
| 3300017761|Ga0181356_1108989 | Not Available | 894 | Open in IMG/M |
| 3300017761|Ga0181356_1195104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
| 3300017766|Ga0181343_1067994 | All Organisms → Viruses → Predicted Viral | 1031 | Open in IMG/M |
| 3300017774|Ga0181358_1268933 | Not Available | 530 | Open in IMG/M |
| 3300017777|Ga0181357_1224992 | Not Available | 660 | Open in IMG/M |
| 3300017777|Ga0181357_1277254 | Not Available | 576 | Open in IMG/M |
| 3300017778|Ga0181349_1135088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
| 3300017778|Ga0181349_1160755 | Not Available | 801 | Open in IMG/M |
| 3300017780|Ga0181346_1104438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1097 | Open in IMG/M |
| 3300017784|Ga0181348_1208017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
| 3300022190|Ga0181354_1029269 | All Organisms → Viruses → Predicted Viral | 1794 | Open in IMG/M |
| 3300022190|Ga0181354_1126287 | Not Available | 818 | Open in IMG/M |
| 3300022407|Ga0181351_1012381 | All Organisms → Viruses → Predicted Viral | 3496 | Open in IMG/M |
| 3300022407|Ga0181351_1039566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1993 | Open in IMG/M |
| 3300022407|Ga0181351_1129096 | Not Available | 937 | Open in IMG/M |
| 3300022752|Ga0214917_10382630 | Not Available | 588 | Open in IMG/M |
| 3300023174|Ga0214921_10176225 | Not Available | 1388 | Open in IMG/M |
| 3300023174|Ga0214921_10477840 | Not Available | 602 | Open in IMG/M |
| 3300025655|Ga0208795_1133366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
| 3300026931|Ga0209850_1014900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
| 3300027547|Ga0209864_1008081 | All Organisms → cellular organisms → Bacteria | 1166 | Open in IMG/M |
| 3300027689|Ga0209551_1099703 | Not Available | 938 | Open in IMG/M |
| 3300027710|Ga0209599_10221316 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 514 | Open in IMG/M |
| 3300027721|Ga0209492_1253970 | Not Available | 594 | Open in IMG/M |
| 3300027721|Ga0209492_1324495 | Not Available | 509 | Open in IMG/M |
| 3300027734|Ga0209087_1076770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1459 | Open in IMG/M |
| 3300027754|Ga0209596_1363671 | Not Available | 554 | Open in IMG/M |
| 3300027759|Ga0209296_1110454 | All Organisms → Viruses → Predicted Viral | 1297 | Open in IMG/M |
| 3300027764|Ga0209134_10241918 | Not Available | 619 | Open in IMG/M |
| 3300027772|Ga0209768_10401730 | Not Available | 544 | Open in IMG/M |
| 3300027792|Ga0209287_10123598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 975 | Open in IMG/M |
| 3300027808|Ga0209354_10079226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1336 | Open in IMG/M |
| 3300027808|Ga0209354_10165727 | Not Available | 900 | Open in IMG/M |
| 3300027816|Ga0209990_10457961 | Not Available | 545 | Open in IMG/M |
| 3300027892|Ga0209550_10242861 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1195 | Open in IMG/M |
| 3300027963|Ga0209400_1321595 | Not Available | 584 | Open in IMG/M |
| 3300028025|Ga0247723_1115638 | Not Available | 660 | Open in IMG/M |
| 3300028025|Ga0247723_1154679 | Not Available | 534 | Open in IMG/M |
| (restricted) 3300028569|Ga0247843_1144618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 986 | Open in IMG/M |
| 3300031787|Ga0315900_10315452 | Not Available | 1285 | Open in IMG/M |
| 3300031857|Ga0315909_10186054 | All Organisms → Viruses → Predicted Viral | 1663 | Open in IMG/M |
| 3300031857|Ga0315909_10490543 | Not Available | 851 | Open in IMG/M |
| 3300031857|Ga0315909_10615143 | Not Available | 723 | Open in IMG/M |
| 3300031963|Ga0315901_10873441 | Not Available | 643 | Open in IMG/M |
| 3300032050|Ga0315906_10776910 | Not Available | 755 | Open in IMG/M |
| 3300032050|Ga0315906_10949037 | Not Available | 654 | Open in IMG/M |
| 3300032092|Ga0315905_10995659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
| 3300032093|Ga0315902_10308814 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300032116|Ga0315903_10566549 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
| 3300032116|Ga0315903_10633749 | Not Available | 813 | Open in IMG/M |
| 3300032156|Ga0315295_10040603 | All Organisms → Viruses → Predicted Viral | 4311 | Open in IMG/M |
| 3300033981|Ga0334982_0201482 | Not Available | 983 | Open in IMG/M |
| 3300034012|Ga0334986_0085793 | All Organisms → Viruses → Predicted Viral | 1913 | Open in IMG/M |
| 3300034012|Ga0334986_0339165 | Not Available | 783 | Open in IMG/M |
| 3300034061|Ga0334987_0439198 | Not Available | 814 | Open in IMG/M |
| 3300034062|Ga0334995_0206970 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
| 3300034104|Ga0335031_0836368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
| 3300034106|Ga0335036_0762515 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300034120|Ga0335056_0318135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 858 | Open in IMG/M |
| 3300034122|Ga0335060_0017481 | All Organisms → Viruses → Predicted Viral | 4749 | Open in IMG/M |
| 3300034280|Ga0334997_0342791 | Not Available | 958 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 28.57% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 14.29% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 11.90% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 9.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.73% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.35% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 3.97% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.38% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.38% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.59% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.59% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.59% |
| Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.59% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.59% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.79% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.79% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.79% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.79% |
| Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002294 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003404 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD | Environmental | Open in IMG/M |
| 3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004124 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (version 2) | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008262 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-C-NA | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010334 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
| 3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
| 3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017701 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026931 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027547 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028569 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2017_8m | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
| 3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
| 3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
| 3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| 3300034280 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME10Aug2009-rr0048 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| B570J29584_10080063 | 3300002294 | Freshwater | LMDVPEPEWLNHWMPATTEFSRSNKVSKLVGYLPVEEAVQL* |
| B570J29032_1094685561 | 3300002408 | Freshwater | DVPEPEWFNHWMPATTEFSRSNKVSKLVGYLPIEEAVQL* |
| B570J40625_1006895683 | 3300002835 | Freshwater | NSTPLGVFSFDLMDVPEPQWLAHWMPATTEFSRSNKVSKVVGYLPIEEAVQL* |
| JGI25920J50251_101222741 | 3300003404 | Freshwater Lake | TPLGIYSFDLMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL* |
| Ga0063233_102593823 | 3300003986 | Freshwater Lake | NSTPLGIFSFDLMDLPEPVWFNHQMPASTEFDRVEKIEKLVGYLPIEEAVQL* |
| Ga0066177_105388963 | 3300004096 | Freshwater Lake | IFSFDLMDLPEPVWFNHQMPATTEFDRVEKVEKLVGYLPIDEAVQL* |
| Ga0066178_102593593 | 3300004124 | Freshwater Lake | GVFSFDLMDVAEPEWFTHRMPATTEFARNNKVDKLVGYLPIEEAIQL* |
| Ga0069718_157134841 | 3300004481 | Sediment | TPKGVFSFDLMDVPEPEWVSHWMPATTEFARSQKVSKLVGYLAIEEAVQL* |
| Ga0070374_100937784 | 3300005517 | Freshwater Lake | INSTPLGIYSFDLMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL* |
| Ga0070374_101231421 | 3300005517 | Freshwater Lake | STPLGIYSFDLMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL* |
| Ga0070374_105594693 | 3300005517 | Freshwater Lake | FDLMDVPEPEWLSHWMPATTEFARSNKVSKLVGYLPVEEAVQL* |
| Ga0068876_102618484 | 3300005527 | Freshwater Lake | PEWVSHWMPATTEFARSNKVSKLVGYLPIEEGIQL* |
| Ga0068872_101415331 | 3300005528 | Freshwater Lake | LMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL* |
| Ga0049085_102005281 | 3300005583 | Freshwater Lentic | MDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL* |
| Ga0075467_106583871 | 3300006803 | Aqueous | YSFDLMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL* |
| Ga0075464_111023482 | 3300006805 | Aqueous | VFSFDLMDVAEPEWVSHWMPATTEFSRSNKVSKLVGYLPIEEAVRL* |
| Ga0105748_104827263 | 3300007992 | Estuary Water | SFDLMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL* |
| Ga0105748_104854743 | 3300007992 | Estuary Water | IYSFDLMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL* |
| Ga0114340_10827653 | 3300008107 | Freshwater, Plankton | TPQGVFSFDLMDVPEPEWFNHWMPATTEFSRSNKVSKLVGYLPIEEAVQL* |
| Ga0114341_100176131 | 3300008108 | Freshwater, Plankton | VWFNHQMPASTEFDRVDKVEKLVGYLPIEEAVQL* |
| Ga0114341_101960741 | 3300008108 | Freshwater, Plankton | MDVPEPEWLSHWMPATTEFSRSNKVSKLVGYLPIE |
| Ga0114343_10395011 | 3300008110 | Freshwater, Plankton | NSTPQGVYSFDLMDLPEPEWVNHWMPATTEFSRSQKITKLVGYLDINEAVKI* |
| Ga0114343_11853091 | 3300008110 | Freshwater, Plankton | PVWFNHQMPASTEFDRVDKVDKLVGYLPIEEAVQL* |
| Ga0114346_11823941 | 3300008113 | Freshwater, Plankton | FSFDLMDVPEPEWVSHWMPATTEFARSNKVSKLVGYLPIEEAVQL* |
| Ga0114350_10378231 | 3300008116 | Freshwater, Plankton | GVFSFDLMDLPEPVWFNHQMPASTEFDRVDKVEKLVGYLPIEEAVQL* |
| Ga0114350_10877875 | 3300008116 | Freshwater, Plankton | GVFSFDLMDLPEPVWFNHQMPASTEFDRVDKVEKLVGYLPIDEAVQL* |
| Ga0114351_11619531 | 3300008117 | Freshwater, Plankton | MDLPEPVWFNHQMPASTEFDRVDKVEKLVGYLPIDEAVQL* |
| Ga0114337_12308551 | 3300008262 | Freshwater, Plankton | VPEPEWFNHWMPATTEFARSNKVSKLVGYLPIEEAVQL* |
| Ga0114363_12141032 | 3300008266 | Freshwater, Plankton | NSTPQGVFSFDLMDLPEPVWFNHQMPASTEFDRVDKVDKLVGYLPIEEAVQL* |
| Ga0114363_12201331 | 3300008266 | Freshwater, Plankton | SFDLMDLPEPVWFNHQMPASTEFDRVDKVEKLVGYLPIEEAVQL* |
| Ga0114878_10736741 | 3300008339 | Freshwater Lake | VYSFDLMDLPEPEWVNHWMPATTEFSRSQKITKLVGYLDINEAVKI* |
| Ga0114876_10090351 | 3300008448 | Freshwater Lake | GVYSFDLMDLPEPEWVNHWMPATTEFSRSQKITKLVGYLDINEAVKI* |
| Ga0114876_10432516 | 3300008448 | Freshwater Lake | NSTPQGVFSFDLMDLPEPVWFNHQMPASTEFDRVDKVEKLVGYLPIEEAVQL* |
| Ga0114876_11236502 | 3300008448 | Freshwater Lake | STPEGVFSFDLMDVPEPEWFNHWMPATTEFARSNKVSKLVGYLPIEEAVQL* |
| Ga0114876_11422003 | 3300008448 | Freshwater Lake | FSFDLMDVPEPEWFNHWMPATTEFARSNKVSKLVGYLPIEEAVQL* |
| Ga0114876_11485183 | 3300008448 | Freshwater Lake | FSFDLMDVPEPEWFNHWMPATTEFARSNKVSKLVGYLPVEEAVQL* |
| Ga0114880_10820613 | 3300008450 | Freshwater Lake | INSTPQGVFSFDLMDLPEPVWFNHQMPASTEIDRVDKVEKLVGYLPIEEAVQL* |
| Ga0114880_12400703 | 3300008450 | Freshwater Lake | PKGVFSFDLMDVPEPEWKVGWMPATTEFARNHKMEKLVGYLPIDEAIQL* |
| Ga0105105_101677241 | 3300009009 | Freshwater Sediment | DLMDVPEPEWVSHWMPATTEFSRSQKISKLVGYLAIEEAVQL* |
| Ga0114973_101627725 | 3300009068 | Freshwater Lake | EWVSHWMPATTEFARSKKVSKLVGYLPVEEAVQL* |
| Ga0105103_103062844 | 3300009085 | Freshwater Sediment | AGIFSFDLLDLPEPVWFNHQMPATTEFDRVEKVEKLVGYLPIEEGVQL* |
| Ga0114968_103123473 | 3300009155 | Freshwater Lake | NSTPLGIYSFDLMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL* |
| Ga0114968_106564543 | 3300009155 | Freshwater Lake | PLGIYSFDLMDLAEPVWYVHYLPATTEFDKIGKVDKLVGYLPIEEGVQL* |
| Ga0114975_101754454 | 3300009164 | Freshwater Lake | LGVFSFDLMDVPEPEWVTHWMPATTEFARSNKVSKLVGYLPIEEAVQL* |
| Ga0114975_102122961 | 3300009164 | Freshwater Lake | LGVFSFDLMDVPEPEWVTHWMPATTEFARSNKVSKLVGYLPVDEAVQL* |
| Ga0114969_107931143 | 3300009181 | Freshwater Lake | PVWYVHYLPATTEFEKVGKVDKLVGYLPIEEAVQL* |
| Ga0114974_100229201 | 3300009183 | Freshwater Lake | EWFTHRMPATTEFARNKKIDKLVGYLPIEEAVQL* |
| Ga0114974_107921372 | 3300009183 | Freshwater Lake | VPEPEWLSHWMPATTEFSRSNKVSKLVGYLPVDEAVQL* |
| Ga0114976_101898164 | 3300009184 | Freshwater Lake | GVFSFDLMDVPEPEWFTHRMPATTEFARNKKIDKLVGYLPIEEAVQL* |
| Ga0114982_10265531 | 3300009419 | Deep Subsurface | GVFSFDLMDVPEPEWLNHWMPATTEFTRSNKVSKLVGYLPIEEAVQL* |
| Ga0114982_12000661 | 3300009419 | Deep Subsurface | LMDLPEPEWVNHWMPATTEFSRNQKVTKLVGYLDIEEAVKL* |
| Ga0114967_101300661 | 3300010160 | Freshwater Lake | DLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL* |
| Ga0136644_105492051 | 3300010334 | Freshwater Lake | NSTPLGVFSFDLMDVPEPEWVSHWMPATTEFARSNKVSKLVGYLPIEEAVRL* |
| Ga0136551_10465771 | 3300010388 | Pond Fresh Water | EWFTHRMPATTEFARNNKVNKLVGYLPIEEAVQL* |
| Ga0119955_11470673 | 3300012006 | Freshwater | AEPVWYVHEMPATTEFDNNDKKYKLVGYLPIEEAVQL* |
| Ga0157606_12714671 | 3300012733 | Freshwater | FDLMDVPEPEWFNHWMPATTEFARSNKVSKLVGYLPIEEAVQL* |
| Ga0164292_106421581 | 3300013005 | Freshwater | PEWFNHWMPATTEFARSNKVSKLVGYLPIEEAVQL* |
| Ga0164294_101927111 | 3300013006 | Freshwater | MDVPEPEWVTHWMPATTEFARSNKISKLVGYLPIEEAVQL* |
| Ga0177922_102892881 | 3300013372 | Freshwater | STPLGVFSFDLMDVPEPEWVTHWMPATTEFARSNKISKLVGYLPIEEAVQL* |
| Ga0181364_10147593 | 3300017701 | Freshwater Lake | GIFSFDLMDLPEPVWFNHQMPATTEFDRVEKVEKLVGYLPVEEAVQL |
| Ga0181350_11617373 | 3300017716 | Freshwater Lake | STPLGIYSFDLMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL |
| Ga0181347_12119291 | 3300017722 | Freshwater Lake | INSTPQGVFSFDLMDVPEPEWVSHWMPATTEFARSNKVSKLVGYLPIEEAVQL |
| Ga0181362_10325165 | 3300017723 | Freshwater Lake | FDLMEVAEPQWLTHRMPATTEFARNNKVDKLVGYLPIEEAVKL |
| Ga0181365_100527914 | 3300017736 | Freshwater Lake | LMDVAEPEWFTHRMPATTEFARNNKVDKLVGYLPIEEAVKL |
| Ga0181356_11089892 | 3300017761 | Freshwater Lake | GIYSFDLMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL |
| Ga0181356_11951041 | 3300017761 | Freshwater Lake | PLGIFSFDLMDLPEPVWFNHQMPASTEFDRVEKIEKLVGYLPIEEAVQL |
| Ga0181343_10679944 | 3300017766 | Freshwater Lake | FDLMDVPEPEWVTHWMPATTEFARSNKVSKLVGYLPIEEAVQL |
| Ga0181358_12689331 | 3300017774 | Freshwater Lake | VFSFDLMDVPEPEWLSHWMPATTEFARSNKISKLVGYLPIEEAVQL |
| Ga0181357_12249921 | 3300017777 | Freshwater Lake | STPQGVFSFDLMDVPEPEWVSHWMPATTEFARSNKVSKLVGYLPIEEAVQL |
| Ga0181357_12772541 | 3300017777 | Freshwater Lake | NSTPLGIYSFDLMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL |
| Ga0181349_11350883 | 3300017778 | Freshwater Lake | DLPEPVWFNHQMPASTEFDRVEKVEKLVGYLPIEEAVQL |
| Ga0181349_11607551 | 3300017778 | Freshwater Lake | PLGIYSFDLMDLAEPIWYVQHLPATTEFEKIGKVSKLVGYLPIEEAVQL |
| Ga0181346_11044381 | 3300017780 | Freshwater Lake | LMDLPEPVWFNHQMPASTEFDRVEKVEKLVGYLPVEEAVQL |
| Ga0181348_12080172 | 3300017784 | Freshwater Lake | SFDLMDLPEPVWFNHQMPASTEFDRVEKVEKLVGYLPIDEAVQL |
| Ga0181354_10292694 | 3300022190 | Freshwater Lake | IYSFDLMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL |
| Ga0181354_11262871 | 3300022190 | Freshwater Lake | EPQWHTHQMPATTEFDNVDKVEKVVGYLPIEEAIKL |
| Ga0181351_10123811 | 3300022407 | Freshwater Lake | PEGVFSFDLMEVAEPEWFTHRMPATTEFARNNKVDKLVGYLPIEEAVKL |
| Ga0181351_10395665 | 3300022407 | Freshwater Lake | VAEPEWFTHRMPATTEFARNNKVDKLVGYLPIEEAIQL |
| Ga0181351_11290963 | 3300022407 | Freshwater Lake | KEWLSHWMPATTEFARSNKVSKLVGYLPIEEAVQL |
| Ga0214917_103826303 | 3300022752 | Freshwater | MDVPEPEWVTHWMPATTEFARSNKVSKLVGYLPVDEAVQL |
| Ga0214921_101762254 | 3300023174 | Freshwater | PLGVFSFDLMDVPEPEWFNHWMPATTEFSRSNKVSKLVGYLPIEEAVQL |
| Ga0214921_104778402 | 3300023174 | Freshwater | PLGVFSFDLMDVPEPEWFNHWMPATTEFSRSNKVSKLVGYLPVDEAVQL |
| Ga0208795_11333661 | 3300025655 | Aqueous | SFDLLDLAEPVWFNHQMPATTEFDRIEKVDKLVGYLPIEEGVQL |
| Ga0209850_10149001 | 3300026931 | Sand | DLMDLPEPVWFNHQMPASTEFDRVEKIEKLVGYLPIDEAVQL |
| Ga0209864_10080811 | 3300027547 | Sand | PVWFNHQMPASTEFDRVEKIEKLVGYLPIDEAVQL |
| Ga0209551_10997031 | 3300027689 | Freshwater Lake | TPLGIYSFDLMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL |
| Ga0209599_102213163 | 3300027710 | Deep Subsurface | LMDLPEPEWVNHWMPATTEFSRNQKVTKLVGYLDIEEAVKL |
| Ga0209492_12539702 | 3300027721 | Freshwater Sediment | IFSFDLLDLPEPVWFNHQMPATTEFDRVEKVEKLVGYLPIEEAVQL |
| Ga0209492_13244953 | 3300027721 | Freshwater Sediment | STPQGIYSFDLMDVPEPEWVTHRMPATSEFSNRMKVNKLVGYLSISEAVKL |
| Ga0209087_10767701 | 3300027734 | Freshwater Lake | PLGIYSFDLMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL |
| Ga0209596_13636711 | 3300027754 | Freshwater Lake | INSTPLGIYSFDLMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEGVQL |
| Ga0209296_11104543 | 3300027759 | Freshwater Lake | INSTPLGVFSFDLMDVPEPEWVTHWMPATTEFARSNKVSKLVGYLPIEEAVQL |
| Ga0209134_102419181 | 3300027764 | Freshwater Lake | INSTPLGVFSFDLMDVPEPEWVSHWMPATTEFARSNKVSKLVGYLPIEEAVQL |
| Ga0209768_104017302 | 3300027772 | Freshwater Lake | AEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL |
| Ga0209287_101235983 | 3300027792 | Freshwater Sediment | GVFSFDLMDVPEPEWVSHWMPATTEFSRSQKISKLVGYLAIEEAVQL |
| Ga0209354_100792265 | 3300027808 | Freshwater Lake | NSTPLGIFSFDLMDLPEPVWFNHQMPATTEFDRVEKVEKLVGYLPIDEAVQL |
| Ga0209354_101657274 | 3300027808 | Freshwater Lake | LMDLAEPIWYVQHLPATTEFEKIGKVSKLVGYLPIEEAVQL |
| Ga0209990_104579611 | 3300027816 | Freshwater Lake | MDLPEPEWVSHWMPATTEFARSNKVSKLVGYLPIEEGIQL |
| Ga0209550_102428613 | 3300027892 | Freshwater Lake | MDVPEPEWLSHWMPATTEFARSNKVSKLVGYLPVEEAVQL |
| Ga0209400_13215953 | 3300027963 | Freshwater Lake | PVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL |
| Ga0247723_11156382 | 3300028025 | Deep Subsurface Sediment | TPKGVFSFDLMDVPEPEWFTHRMPATTEFARNKKIDKLVGYLPLEEAVQL |
| Ga0247723_11546792 | 3300028025 | Deep Subsurface Sediment | GVFSFDLMDVPEPEWFNHWMPATTEFSRSNKVSKLVGYLPVDEAVQL |
| (restricted) Ga0247843_11446181 | 3300028569 | Freshwater | INSTPQGVFSFDLMDVPEPVWFNHQMPATTEFDRVDKVEKMVGYLPIEEAVQL |
| Ga0315900_103154521 | 3300031787 | Freshwater | GVFSFDLMDLPEPVWFNHQMPASTEFDRVDKVEKLVGYLPIEEAVQL |
| Ga0315909_101860541 | 3300031857 | Freshwater | STPKGVFSFDLMDVPEPEWEVGWMPATTEFSRNHKMEKLVGYLPIEEAIQL |
| Ga0315909_104905433 | 3300031857 | Freshwater | INSTPQGVFSFDLMDLPEPVWFNHQMPASTEFDRVDKVEKLVGYLPIDEAVQL |
| Ga0315909_106151433 | 3300031857 | Freshwater | PEPVWFNHQMPATTEFDRVEKVEKLVGYLPIEEAVQL |
| Ga0315901_108734412 | 3300031963 | Freshwater | TPEGVFSFDLMDVPEPEWFNHWMPATTEFARSNKVSKLVGYLPIEEAVQL |
| Ga0315906_107769103 | 3300032050 | Freshwater | MDLPEPVWFNHQMPASTEFDRVDKVEKLVGYLPIDEAVQL |
| Ga0315906_109490374 | 3300032050 | Freshwater | PVWFSHQMPATTEFDRAEKVEKLVGYLPIEEAVQL |
| Ga0315905_109956591 | 3300032092 | Freshwater | LMDLAEPVWYVHYLPATTEFEKIGKVDKLVGYLPIEEAVQL |
| Ga0315902_103088146 | 3300032093 | Freshwater | SFDLMDLPEPVWFNHQMPASTEFDRVDKVDKLVGYLPIEEAVQL |
| Ga0315903_105665492 | 3300032116 | Freshwater | VFSFDLMDVPEPEWFNHWMPATTEFARSNKVSKLVGYLPIEEAVQL |
| Ga0315903_106337491 | 3300032116 | Freshwater | DLMDLPEPVWFNHQMPASTEFDRVDKVEKLVGYLPIDEAVQL |
| Ga0315295_100406031 | 3300032156 | Sediment | FDLMDVPEPVWEVGWMPATTEFARNHKMEKLVGYLPLDEAVQL |
| Ga0334982_0201482_3_125 | 3300033981 | Freshwater | MDVPEPEWLNHWMPATTEFSRSNKVSKLVGYLPIEEAVQL |
| Ga0334986_0085793_3_122 | 3300034012 | Freshwater | DLPEPVWYVQYLPATTEFDRIEKVDKLVGYLPIEEAVQL |
| Ga0334986_0339165_651_782 | 3300034012 | Freshwater | FDLLDLPEPVWFNHQMPATTEFDRVEKIEKLVGYLPIEEAVQL |
| Ga0334987_0439198_676_813 | 3300034061 | Freshwater | FSFDLLDLPEPVWFNHQMPATTEFDRVEKVEKLVGYLPIEEGVQL |
| Ga0334995_0206970_17_139 | 3300034062 | Freshwater | MDVPEPEWFNHWMPATTEFSRSNKVSKLVGYLPVEEAVQL |
| Ga0335031_0836368_180_302 | 3300034104 | Freshwater | MDLPEPEWVNGWMPATTEFSRNQKITKLVGYLDIEEAVKL |
| Ga0335036_0762515_1_120 | 3300034106 | Freshwater | DLPEPVWFNHQMPATTEFDRVEKVEKLVGYLPIEEGVQL |
| Ga0335056_0318135_733_858 | 3300034120 | Freshwater | LMDVPEPEWVSHWMPATTEFSRSQKISKLVGYLAIEEAVQL |
| Ga0335060_0017481_3_128 | 3300034122 | Freshwater | LMDVPEPEWFNHWMPATTEFSRSNKVSKLVGYLPIEEGVQL |
| Ga0335065_0499192_16_132 | 3300034200 | Freshwater | MPEPEWFTHPMPATTEFDRTEKVDKIVGYLDIEEAVKL |
| Ga0334997_0342791_1_159 | 3300034280 | Freshwater | NSTPAGIFSFDLLDLPEPVWFNHQMPATTEFDRVEKVEKLVGYLPIEEGVQL |
| ⦗Top⦘ |