NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F066552

Metagenome / Metatranscriptome Family F066552

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066552
Family Type Metagenome / Metatranscriptome
Number of Sequences 126
Average Sequence Length 47 residues
Representative Sequence DIYNLLNSDAVTAYNNGYSPTGAWLTPTAILPARYVRLNLQLDF
Number of Associated Samples 98
Number of Associated Scaffolds 126

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.83 %
% of genes from short scaffolds (< 2000 bps) 95.24 %
Associated GOLD sequencing projects 91
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.778 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(12.698 % of family members)
Environment Ontology (ENVO) Unclassified
(39.683 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(65.873 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 19.44%    β-sheet: 5.56%    Coil/Unstructured: 75.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 126 Family Scaffolds
PF07883Cupin_2 15.87
PF13620CarboxypepD_reg 12.70
PF01177Asp_Glu_race 5.56
PF07399Na_H_antiport_3 5.56
PF12867DinB_2 3.17
PF01555N6_N4_Mtase 1.59
PF11412DsbC 1.59
PF00753Lactamase_B 0.79
PF00069Pkinase 0.79
PF01569PAP2 0.79
PF00775Dioxygenase_C 0.79
PF03737RraA-like 0.79
PF02720DUF222 0.79
PF00135COesterase 0.79
PF07637PSD5 0.79
PF02311AraC_binding 0.79
PF01186Lysyl_oxidase 0.79
PF01699Na_Ca_ex 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 126 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.17
COG0863DNA modification methylaseReplication, recombination and repair [L] 1.59
COG1041tRNA G10 N-methylase Trm11Translation, ribosomal structure and biogenesis [J] 1.59
COG2189Adenine specific DNA methylase ModReplication, recombination and repair [L] 1.59
COG0387Cation (Ca2+/Na+/K+)/H+ antiporter ChaAInorganic ion transport and metabolism [P] 0.79
COG0530Ca2+/Na+ antiporterInorganic ion transport and metabolism [P] 0.79
COG0684RNA degradosome component RraA (regulator of RNase E activity)Translation, ribosomal structure and biogenesis [J] 0.79
COG2272Carboxylesterase type BLipid transport and metabolism [I] 0.79
COG3485Protocatechuate 3,4-dioxygenase beta subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.78 %
UnclassifiedrootN/A22.22 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000559|F14TC_100695139All Organisms → cellular organisms → Bacteria1138Open in IMG/M
3300000891|JGI10214J12806_10754833Not Available1423Open in IMG/M
3300004463|Ga0063356_101799075All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300004463|Ga0063356_101908510All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300004463|Ga0063356_106468354Not Available502Open in IMG/M
3300005328|Ga0070676_10750869All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300005330|Ga0070690_100754323All Organisms → cellular organisms → Bacteria751Open in IMG/M
3300005334|Ga0068869_100180554All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1654Open in IMG/M
3300005339|Ga0070660_101031756All Organisms → cellular organisms → Bacteria695Open in IMG/M
3300005354|Ga0070675_101152100All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300005355|Ga0070671_101552638All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300005364|Ga0070673_101183368All Organisms → cellular organisms → Bacteria716Open in IMG/M
3300005438|Ga0070701_11234057All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300005459|Ga0068867_101704412All Organisms → cellular organisms → Bacteria591Open in IMG/M
3300005466|Ga0070685_10557154All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium819Open in IMG/M
3300005471|Ga0070698_100958298Not Available802Open in IMG/M
3300005544|Ga0070686_100241718All Organisms → cellular organisms → Bacteria → Acidobacteria1315Open in IMG/M
3300005546|Ga0070696_101844754All Organisms → cellular organisms → Bacteria → Proteobacteria523Open in IMG/M
3300005549|Ga0070704_101423591Not Available636Open in IMG/M
3300005615|Ga0070702_100469562All Organisms → cellular organisms → Bacteria → Acidobacteria917Open in IMG/M
3300005719|Ga0068861_101690743All Organisms → cellular organisms → Bacteria → Acidobacteria626Open in IMG/M
3300005840|Ga0068870_11386359Not Available515Open in IMG/M
3300005841|Ga0068863_101731725Not Available635Open in IMG/M
3300005841|Ga0068863_102146198All Organisms → cellular organisms → Bacteria → Acidobacteria569Open in IMG/M
3300005844|Ga0068862_100546184All Organisms → cellular organisms → Bacteria1106Open in IMG/M
3300005844|Ga0068862_102648820Not Available513Open in IMG/M
3300006844|Ga0075428_100430048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Pelagibacterium → Pelagibacterium halotolerans1414Open in IMG/M
3300006844|Ga0075428_100527904All Organisms → cellular organisms → Bacteria1262Open in IMG/M
3300006845|Ga0075421_102519145Not Available536Open in IMG/M
3300006876|Ga0079217_10904219Not Available630Open in IMG/M
3300006880|Ga0075429_101537992All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300006894|Ga0079215_10051658All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1598Open in IMG/M
3300006894|Ga0079215_10537840All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium741Open in IMG/M
3300006894|Ga0079215_11072641All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300006904|Ga0075424_101543431All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300009094|Ga0111539_11563811All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300009098|Ga0105245_11837757All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300009100|Ga0075418_11763074All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300009147|Ga0114129_10013273All Organisms → cellular organisms → Bacteria11736Open in IMG/M
3300009147|Ga0114129_11675444All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300009148|Ga0105243_11180870All Organisms → cellular organisms → Bacteria → Acidobacteria777Open in IMG/M
3300009156|Ga0111538_10041090All Organisms → cellular organisms → Bacteria5956Open in IMG/M
3300009156|Ga0111538_10569856All Organisms → cellular organisms → Bacteria1436Open in IMG/M
3300009156|Ga0111538_13381135Not Available554Open in IMG/M
3300009162|Ga0075423_10058550All Organisms → cellular organisms → Bacteria3983Open in IMG/M
3300009176|Ga0105242_12664940All Organisms → cellular organisms → Bacteria → Acidobacteria549Open in IMG/M
3300010040|Ga0126308_11235232All Organisms → cellular organisms → Bacteria → Acidobacteria530Open in IMG/M
3300010047|Ga0126382_11534481All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300010397|Ga0134124_10162067All Organisms → cellular organisms → Bacteria2004Open in IMG/M
3300010397|Ga0134124_12555491All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300010400|Ga0134122_10548577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Devosiaceae → Pelagibacterium → Pelagibacterium halotolerans1057Open in IMG/M
3300010401|Ga0134121_10711512Not Available954Open in IMG/M
3300010403|Ga0134123_11709525All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300011119|Ga0105246_10499228All Organisms → cellular organisms → Bacteria → Acidobacteria1033Open in IMG/M
3300011119|Ga0105246_12052827All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300011119|Ga0105246_12148356All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300011398|Ga0137348_1050312All Organisms → cellular organisms → Bacteria → Acidobacteria707Open in IMG/M
3300011415|Ga0137325_1030674All Organisms → cellular organisms → Bacteria → Acidobacteria1095Open in IMG/M
3300011441|Ga0137452_1246940All Organisms → cellular organisms → Bacteria → Acidobacteria602Open in IMG/M
3300011443|Ga0137457_1112470All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300011443|Ga0137457_1205987All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium670Open in IMG/M
3300012510|Ga0157316_1040782All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300012511|Ga0157332_1049129Not Available600Open in IMG/M
3300012907|Ga0157283_10085273All Organisms → cellular organisms → Bacteria → Acidobacteria814Open in IMG/M
3300012908|Ga0157286_10130121All Organisms → cellular organisms → Bacteria → Acidobacteria779Open in IMG/M
3300013307|Ga0157372_11770745Not Available710Open in IMG/M
3300014969|Ga0157376_11190280All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium790Open in IMG/M
3300014969|Ga0157376_12478467All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300015200|Ga0173480_10564262All Organisms → cellular organisms → Bacteria → Acidobacteria693Open in IMG/M
3300015372|Ga0132256_103496263All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300015373|Ga0132257_101785727All Organisms → cellular organisms → Bacteria790Open in IMG/M
3300015373|Ga0132257_101810471All Organisms → cellular organisms → Bacteria784Open in IMG/M
3300015373|Ga0132257_103407616Not Available579Open in IMG/M
3300015374|Ga0132255_101499356Not Available1020Open in IMG/M
3300018469|Ga0190270_12112391All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300018476|Ga0190274_10125181All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2110Open in IMG/M
3300018476|Ga0190274_10246032All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Sorangiineae → Polyangiaceae → unclassified Polyangiaceae → Polyangiaceae bacterium1617Open in IMG/M
3300018476|Ga0190274_10615545All Organisms → cellular organisms → Bacteria1115Open in IMG/M
3300018476|Ga0190274_12717167All Organisms → cellular organisms → Bacteria → Acidobacteria592Open in IMG/M
3300018476|Ga0190274_13766423Not Available513Open in IMG/M
3300018481|Ga0190271_13146494Not Available553Open in IMG/M
3300019356|Ga0173481_10047090Not Available1467Open in IMG/M
3300020034|Ga0193753_10067415All Organisms → cellular organisms → Bacteria → Acidobacteria1863Open in IMG/M
3300022911|Ga0247783_1094435All Organisms → cellular organisms → Bacteria → Acidobacteria813Open in IMG/M
3300025907|Ga0207645_10802856All Organisms → cellular organisms → Bacteria → Acidobacteria640Open in IMG/M
3300025907|Ga0207645_10911388All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300025920|Ga0207649_10400064All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300025923|Ga0207681_10798921All Organisms → cellular organisms → Bacteria → Acidobacteria788Open in IMG/M
3300025923|Ga0207681_10986316All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium707Open in IMG/M
3300025926|Ga0207659_10224802All Organisms → cellular organisms → Bacteria → Acidobacteria1511Open in IMG/M
3300025930|Ga0207701_11269924All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300025931|Ga0207644_11269248All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300025933|Ga0207706_10442476All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1125Open in IMG/M
3300025935|Ga0207709_10819823All Organisms → cellular organisms → Bacteria → Acidobacteria752Open in IMG/M
3300025940|Ga0207691_10997255Not Available699Open in IMG/M
3300025945|Ga0207679_11173952All Organisms → cellular organisms → Bacteria → Acidobacteria704Open in IMG/M
3300025949|Ga0207667_11904476All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300025972|Ga0207668_11042244All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium732Open in IMG/M
3300026089|Ga0207648_10333233All Organisms → cellular organisms → Bacteria1365Open in IMG/M
3300026089|Ga0207648_10462509All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1156Open in IMG/M
3300026089|Ga0207648_11040417All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300026116|Ga0207674_11129972Not Available753Open in IMG/M
3300026118|Ga0207675_100151568All Organisms → cellular organisms → Bacteria2207Open in IMG/M
3300027665|Ga0209983_1122370All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium594Open in IMG/M
3300027840|Ga0209683_10084675All Organisms → cellular organisms → Bacteria1422Open in IMG/M
3300027873|Ga0209814_10061364All Organisms → cellular organisms → Bacteria1574Open in IMG/M
3300027880|Ga0209481_10646320Not Available549Open in IMG/M
3300027886|Ga0209486_10354146All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium879Open in IMG/M
3300027909|Ga0209382_11972685Not Available561Open in IMG/M
3300031184|Ga0307499_10132318All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium715Open in IMG/M
3300031538|Ga0310888_10069364All Organisms → cellular organisms → Bacteria1711Open in IMG/M
3300031538|Ga0310888_10592307Not Available672Open in IMG/M
3300031538|Ga0310888_10672695All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300031562|Ga0310886_10379006Not Available829Open in IMG/M
3300031720|Ga0307469_12334752All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300031908|Ga0310900_11120115All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae652Open in IMG/M
3300031913|Ga0310891_10363672Not Available521Open in IMG/M
3300031943|Ga0310885_10087224All Organisms → cellular organisms → Bacteria1389Open in IMG/M
3300031943|Ga0310885_10329572All Organisms → cellular organisms → Bacteria796Open in IMG/M
3300032003|Ga0310897_10597980All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300032013|Ga0310906_10114477Not Available1508Open in IMG/M
3300032075|Ga0310890_10135765All Organisms → cellular organisms → Bacteria1605Open in IMG/M
3300032144|Ga0315910_11441131Not Available537Open in IMG/M
3300032157|Ga0315912_10737386All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis784Open in IMG/M
3300033551|Ga0247830_11525225Not Available535Open in IMG/M
3300034672|Ga0314797_106567All Organisms → cellular organisms → Bacteria581Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.70%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.70%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil10.32%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere5.56%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere4.76%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere4.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere4.76%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.97%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil3.97%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.17%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere3.17%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.17%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.38%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.59%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.59%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.79%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.79%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.79%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.79%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.79%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.79%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.79%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.79%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005354Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011398Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT600_2EnvironmentalOpen in IMG/M
3300011415Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300012510Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610Host-AssociatedOpen in IMG/M
3300012511Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_10EnvironmentalOpen in IMG/M
3300012907Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300020034Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2EnvironmentalOpen in IMG/M
3300022911Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027665Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031538Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031913Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4EnvironmentalOpen in IMG/M
3300031943Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2EnvironmentalOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300032157Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soilEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034672Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F14TC_10069513923300000559SoilYNLLNNDAVTSYNNGYTAPTATRPSIWLTPTAILPARYVRLNMQLDF*
JGI10214J12806_1075483313300000891SoilLLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF*
Ga0063356_10179907513300004463Arabidopsis Thaliana RhizosphereAQFGVDVYNLTNTDVVTAYNTGYTAPTATAGSNWLTPTGILPARYVRLNMQLDF*
Ga0063356_10190851023300004463Arabidopsis Thaliana RhizosphereAKILRIRGTRAQFGVDVYNLLNTDVVTTYNEGYTAPTATTGSIWLTPNSILPARYVRLNMQLDF*
Ga0063356_10646835413300004463Arabidopsis Thaliana RhizosphereAQFGVDVYNLTNTDVVTAYNAGYIAPTATAGSNWLTPTGILPARYVRLNMQIDF*
Ga0070676_1075086913300005328Miscanthus RhizosphereRTQVGIDLYNILNNDAVTTYNNGYSPTGAWLTPTAILPARYVRFNLQLDF*
Ga0070690_10075432313300005330Switchgrass RhizosphereTQFGVDLYNLLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF*
Ga0068869_10018055413300005334Miscanthus RhizosphereDLYNLLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF*
Ga0070660_10103175623300005339Corn RhizosphereTRAQIGVDIYNLLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF*
Ga0070675_10115210013300005354Miscanthus RhizosphereGVDLYNLLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF*
Ga0070671_10155263813300005355Switchgrass RhizosphereGMDVYNLLNTDVVTAYNQGYSAPTATRGSIWLTPTAILPARYVRLNVQIDF*
Ga0070673_10118336823300005364Switchgrass RhizosphereVDVYNLLNTDVVTGYNNGYSPTGAWLTPTTIQPARYARLNLELNF*
Ga0070701_1123405723300005438Corn, Switchgrass And Miscanthus RhizosphereVGVDIYNVLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF*
Ga0068867_10170441223300005459Miscanthus RhizosphereVDVYNLLNTDVVTGYNNGYSATGAWLTPTAIQPARYARLNLEVNF*
Ga0070685_1055715423300005466Switchgrass RhizosphereDLYNLLNTDVVTAYNNGYTAPTATQGSIWLTPTAILPARYVRLNVQIDF*
Ga0070698_10095829823300005471Corn, Switchgrass And Miscanthus RhizosphereTQVGMDVYNVVNNDAVTMYNNGYTAPVAGRSSVWLTPTTILPARYIRLNMQFDF*
Ga0070686_10024171833300005544Switchgrass RhizosphereVDVYNLLNSDVVTGYNNGYSATGAWLTPTAITPARYARLNLELNF*
Ga0070696_10184475423300005546Corn, Switchgrass And Miscanthus RhizosphereILHFGQTRAQFGVDIYNLTNTDVVTQYNNGYIAPSATQGSVWLTPNAILPARYVRLNMQIDF*
Ga0070704_10142359113300005549Corn, Switchgrass And Miscanthus RhizosphereYNLLNTDVVTAYNNGYTAPTATQGSIWLTPTAILPARYVRLNMQLDF*
Ga0070702_10046956213300005615Corn, Switchgrass And Miscanthus RhizosphereTRAQFGVDVYNLLNSDVVTGYNNGYSATGAWLTPTAITPARYARLNLELNF*
Ga0068861_10169074323300005719Switchgrass RhizosphereILRFGKTRAQFGVDVYNLLNTDVVTGYNNGYSATGAWLTPTTIQPARYARLNLEVNF*
Ga0068870_1138635913300005840Miscanthus RhizosphereVTAYNNGYTAPTATQGSIWLTPTAILPARYVRLNMQLDF*
Ga0068863_10173172513300005841Switchgrass RhizosphereRAQLGVDIYNVLNTDVVTLYNNGYSPTGTWLTPTAILPARYARFNMQFDF*
Ga0068863_10214619823300005841Switchgrass RhizosphereQFGVDVYNLLNSDVVTGYNNGYSATGAWLTPTAITPARYARLNLELSF*
Ga0068862_10054618413300005844Switchgrass RhizosphereGVDVYNLLNTDVVTTYNEGYTAPTATSGSIWLTPNSILPARYVRLNLQLDF*
Ga0068862_10264882023300005844Switchgrass RhizosphereYNNGYTAPAAGRSSVWLTPTTILPARYIRLNMQVDF*
Ga0075428_10043004833300006844Populus RhizosphereAVTMYNNGYSPTGAWLTPTAILPARYVRLNMQLDF*
Ga0075428_10052790413300006844Populus RhizosphereDVVTLYNNGYSAPTATRGSIWLTPTAILPARYVRLNMQMDF*
Ga0075421_10251914513300006845Populus RhizosphereNLLNTDVVTSYNNGYSAPTATGGSIWLTPTAILPARYVRLNMQFDF*
Ga0079217_1090421923300006876Agricultural SoilFRFRGARAQIGVDIYNVLNNDVVTAYNNGYSPTGAWLTPTAILPARYARFNLQFDF*
Ga0075429_10153799223300006880Populus RhizosphereLLNTDVVTLYNNGYSAPTATRGSIWLTPTAILPARYVRLNMQMDF*
Ga0079215_1005165813300006894Agricultural SoilNLLNNDVVTTYNNGYTAPVAGRGSIWLTPTAILPARYARINLQVDF*
Ga0079215_1053784013300006894Agricultural SoilKVLRIAGTRTQVGVDVYNLMNTDAVTGFNAGYSPTGAWLTPTAIVPARYARFNMQVDF*
Ga0079215_1107264123300006894Agricultural SoilNIGVRVARVLRCGGTRAQVGVDVYNVMNTDAVTSFNNGYSPTGAWLTPTGIAPARYARINVQLDF*
Ga0075424_10154343113300006904Populus RhizosphereTQYNNGYIAPNAQTGAPSTWLTPNAILPARYVRLNMQIDF*
Ga0111539_1156381113300009094Populus RhizosphereTTYNEGYTAPTATSGSIWLTPNSILPARYVRLNLQLDF*
Ga0105245_1183775713300009098Miscanthus RhizosphereKTRAQFGVDVYNLLNTDVVTGYNNGYSATGAWLTPTTIQPARYARLNLEVNF*
Ga0075418_1176307423300009100Populus RhizosphereYNNGYIAPTATSGSVWLTPTTILPARYVRLNMQIDF*
Ga0114129_1001327313300009147Populus RhizosphereRFRGYRTQIGVDIYNVVNTDVVTAYNNGYSPTGAWLTPTAILPARYARFNLQFDF*
Ga0114129_1167544423300009147Populus RhizosphereFGVDIYNLTNNDVVTGYNNGYIAPTATSGSVWLTPTSILPARYVRLNMQIDF*
Ga0105243_1118087013300009148Miscanthus RhizosphereLLNSDVVTGYNNGYSATGAWLTPTAITPARYARLNLELSF*
Ga0111538_1004109013300009156Populus RhizosphereYNEGYTAPTATSGSIWLTPNSILPARYVRLNMQLDF*
Ga0111538_1056985623300009156Populus RhizosphereRGTRAQFGVDVYNLLNTDVVTMYNEGYTAPTATSGSIWLTPNSILPARYVRLNLQLDF*
Ga0111538_1338113513300009156Populus RhizosphereTDVVTTYNEGYTAPTATSGSIWLTPNSILPARYVRLNMQLDF*
Ga0075423_1005855033300009162Populus RhizosphereLTNTDVVTQYNNGYIAPNAQTGAPSTWLTPNAILPARYVRLNMQIDF*
Ga0105242_1266494013300009176Miscanthus RhizosphereRAQFGVDVYNLLNTDVVTGYNNGYSATGAWLTPTAIQPARYARLNLEVNF*
Ga0126308_1123523213300010040Serpentine SoilDVVTGYNNGYSATGAWLTPTSIQPARYARLNLEVNF*
Ga0126382_1153448123300010047Tropical Forest SoilFGGTRAQFGADVYNLLNTDVTTLYNNGYTAPTATSPSIWLTPNAILPARYVRLNMQLDF*
Ga0134124_1016206713300010397Terrestrial SoilGHTRAQFGVDVYNLLNSDVVTGYNNGYSATGAWLTPTSITPARYARLNLEMNF*
Ga0134124_1255549123300010397Terrestrial SoilLNSDVVTGYNNGYSATGAWLTPTSITPARYARLNLEVSF*
Ga0134122_1054857733300010400Terrestrial SoilGIDLYNILNNDAVTTYNNGYSPTGAWLTPTAILPARYVRFNLQLDF*
Ga0134121_1071151213300010401Terrestrial SoilKIFRFSGTRAQIGVDIYNLLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF*
Ga0134123_1170952523300010403Terrestrial SoilRAQFGVDIYNVTNTDVVTLYNNGYIAPTGTNPSVWLTPNAILTARYARLNMQIDF*
Ga0105246_1049922813300011119Miscanthus RhizosphereRAQFGVDVYNLLNSDVVTGYNNGYSATGAWLTPTAITPARYARLNLELNF*
Ga0105246_1205282713300011119Miscanthus RhizosphereVYNLLNSDVVTGYNNGYSATGAWLTPTAITPARYARLNLELSF*
Ga0105246_1214835613300011119Miscanthus RhizosphereGTRINNLLNSDAVTSYDNGDSHNNGYTRPTVNRRLGSTWLTPTAILPARCVRLNLQLDF*
Ga0137348_105031223300011398SoilQFGVDVYNMLNTDVVTGYNNGYSPTGAWLTPTSIQPARYARLNLELNF*
Ga0137325_103067443300011415SoilGLDLYNLLNNDVVTAYNNGYNPTGAWLIPNTILPARYVRLNLQLDF*
Ga0137452_124694023300011441SoilKILRFRGYRTQIGVDIYNVVNTDVVTAYNTGYSPTGAWLTPTAILPARYARFNLQFDF*
Ga0137457_111247023300011443SoilAQFGVDVYNLLNTDVVTTYNEGYTAPTATSGSIWLTPNSILPARYVRLNMQLDF*
Ga0137457_120598713300011443SoilMDVYNLLNTDVVTAYNQGYSAPTATRGSIWLTPTAILPARYVRLNVQIDF*
Ga0157316_104078223300012510Arabidopsis RhizosphereLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF*
Ga0157332_104912923300012511SoilQFGVDLYNLLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF*
Ga0157283_1008527333300012907SoilGVDVYNLLNTDVVTGYNNGYSPTGAWLTPTTIQPARYARLNMELNF*
Ga0157286_1013012123300012908SoilVDVYNLLNTDVVTGYNNGYSPTGAWLTPTTIQPARYARLNMELNF*
Ga0157372_1177074523300013307Corn RhizosphereVTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF*
Ga0157376_1119028023300014969Miscanthus RhizosphereVDVYNLLNTDVVTTYNEGYTAPTATSGSIWLTPNSILPARYVRLNMQLDF*
Ga0157376_1247846723300014969Miscanthus RhizosphereVTGYNNGYSPTGAWLTPTAIQPARYVRLNLEVNF*
Ga0173480_1056426223300015200SoilYNILNNDAVTTYNNGYSPTGAWLTPTAILPARYVRFNLQLDF*
Ga0132256_10349626313300015372Arabidopsis RhizosphereTQFGVDVHNLLNSDVVTGYKNGYSATGAWLTPTAITPARYARLSLELSF*
Ga0132257_10178572713300015373Arabidopsis RhizosphereDIYNLLNSDAVTAYNNGYSPTGAWLTPTAILPARYVRLNLQLDF*
Ga0132257_10181047113300015373Arabidopsis RhizosphereTNTDVVTAYNNGYTPPTATQPSNWLTPTAILPARYVRLNMQIDF*
Ga0132257_10340761623300015373Arabidopsis RhizosphereFGGTRAQFGADVYNLLNTDVVTTYNTGYTAPTATNPSIWLTPNAILPARYVRLNLQVDF*
Ga0132255_10149935613300015374Arabidopsis RhizosphereGMDVYNVMNNDAVTAYNNGYTAPTAGRPSVWLTPTTILPARYIRLNMQIDF*
Ga0190270_1211239113300018469SoilVVTAYNTGYSPTGAWLTPTAILPARYARFNLQLDF
Ga0190274_1012518113300018476SoilRFRGTRAQVGMDVYNLLNTDVVTAYNQGYSAPTATQGSIWLTPTAILPARYVRLNVQIDF
Ga0190274_1024603213300018476SoilAQFGVDVYNLLNTDVVTGYNNGYSPTGAWLTPTAIQPARYARLNLELNF
Ga0190274_1061554513300018476SoilTTYNNGYSAPTVTQGSIWLTPNAILPARYVRLNMQLDF
Ga0190274_1271716723300018476SoilVDVYNLLNTDVVTGYNNGYSPTGAWLTPTAIQPARYARLNLELDF
Ga0190274_1376642313300018476SoilNLLNTDVVTMYNNGYSAPTATGGSLWLTPTAILPARYVRLNMQIDF
Ga0190271_1314649423300018481SoilAYNQGYSAPTATQGSIWLTPNAILPARYVRLNMQIDF
Ga0173481_1004709023300019356SoilYNLLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF
Ga0193753_1006741513300020034SoilLLNTDVVTGYNNGYSPTGAWLTPTAIQPARYARLNLEINF
Ga0247783_109443513300022911Plant LitterQFGVDVYNLLNTDVVTGYNNGYSPTGAWLTPTTIQPARYARLNMELNF
Ga0207645_1080285623300025907Miscanthus RhizosphereQFGVDVYNLLNTDVVTGYNNGYSPTGAWLTPTAIQPARYARLNLEVNF
Ga0207645_1091138813300025907Miscanthus RhizosphereFRGTRAQVGMDVYNLLNTDVVTAYNQGYSAPTATQGSIWLTPTAILPARYVRLNVQVDF
Ga0207649_1040006423300025920Corn RhizosphereLLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF
Ga0207681_1079892123300025923Switchgrass RhizosphereNILNNDAVTTYNNGYSPTGAWLTPTAILPARYVRFNLQLDF
Ga0207681_1098631623300025923Switchgrass RhizosphereLLNTDVVTGYNNGYSPTGSWLTPTSIQPARYARLNLELNF
Ga0207659_1022480213300025926Miscanthus RhizosphereLLNTDVVTGYNNGYSATGAWLTPTAIQPARYARLNLELNF
Ga0207701_1126992423300025930Corn, Switchgrass And Miscanthus RhizosphereRAQVGMDVYNLLNTDVVTAYNQGYSAPTATQGSIWLTPTAILPARYVRLNVQIDF
Ga0207644_1126924823300025931Switchgrass RhizosphereQVGMDVYNLLNTDVVTAYNQGYSAPTATRGSIWLTPTAILPARYVRLNVQIDF
Ga0207706_1044247633300025933Corn RhizosphereQVGIDLYNILNNDAVTTYNNGYSPTGAWLTPTAILPARYVRFNLQLDF
Ga0207709_1081982313300025935Miscanthus RhizosphereLLNSDVVTGYNNGYSATGAWLTPTAITPARYARLNLELSF
Ga0207691_1099725523300025940Miscanthus RhizosphereMDVYNLTNTDVVTGYNQNYTAPTGGRGSVWLTPTTIQPARYIRLNLQIDF
Ga0207679_1117395223300025945Corn RhizosphereNVLNTDVVTLYNNGYSPTGTWLTPTAILPARYARFNMQFDF
Ga0207667_1190447623300025949Corn RhizosphereRAQIGVDIYNLLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF
Ga0207668_1104224413300025972Switchgrass RhizosphereILRFRGTRAQFGVDVYNLLNTDVVTTYNEGYTAPTATSGSIWLTPNAILPARYVRLNLQVDF
Ga0207648_1033323333300026089Miscanthus RhizosphereGTRAQLGVDIYNVLNTDVVTLYNNGYSPTGTWLTPTAILPARYARFNMQFDF
Ga0207648_1046250913300026089Miscanthus RhizosphereVDVYNLLNTDVVTGYNNGYSATGAWLTPTAIQPARYARLNLEVNF
Ga0207648_1104041723300026089Miscanthus RhizosphereLNTDVVTTYNEGYTAPTATSGSIWLTPNSILPARYVRLNLQLDF
Ga0207674_1112997213300026116Corn RhizosphereNVLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF
Ga0207675_10015156833300026118Switchgrass RhizosphereTRAQIGVDIYNLLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF
Ga0209983_112237013300027665Arabidopsis Thaliana RhizosphereYNLINTDVVTAYNNGYSPTGAWLTPTAILPARYARFNVQFDF
Ga0209683_1008467513300027840Wetland SedimentDIYNLMNSDVVTTYNNGYTPPNPVTGAGSTWLTPTAITPARYARLNLQFDF
Ga0209814_1006136423300027873Populus RhizosphereNTGYSAPQADRGSIWLTPNAILPARYVRLNMQIDF
Ga0209481_1064632013300027880Populus RhizosphereVTTYNEGYSAPTATSGSIWLTPNAILPARYVRLNMQLDF
Ga0209486_1035414633300027886Agricultural SoilTDAVTGFNNGYSPTGAWLTPTSIVPARYARFNMQVDF
Ga0209382_1197268513300027909Populus RhizosphereVVTAYNNGYSPTGAWLTPTAILPARYARFNLQFDF
Ga0307499_1013231823300031184SoilGTRAQVGMDVYNLLNTDVVTAYNQGYSAPTATRGSIWLTPTAILPARYVRLNVQIDF
Ga0310888_1006936433300031538SoilLRFRGVRTQVGVDIYNVLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNLQLDF
Ga0310888_1059230723300031538SoilVYNLLNTDVVTTYNQGYTAPTATTGSIWLTPNAIQPARYVPLNMQLDF
Ga0310888_1067269513300031538SoilGVDLYNLLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNMQLDF
Ga0310886_1037900623300031562SoilYNQGYTAPTATTGSIWLTPNAIQPARYVPLNMQLDF
Ga0307469_1233475213300031720Hardwood Forest SoilVTAYNNGYSAPTATQGSIWLTPTAILPARYVRLNMQIDF
Ga0310900_1112011523300031908SoilLRFRGTRAQVGVDIYNVLNTDVVTLYNNGYSPTGAWLTPTAILPARYARFNMQFDF
Ga0310891_1036367213300031913SoilVDVYNLLNTDVVTTYNQGYTAPTATTGSIWLTPNAIQPARYVPLNMQLDF
Ga0310885_1008722413300031943SoilIGVDIYNVVNTDVVTAYNNGYSPTGAWLTPTAILPARYARFNLQFDF
Ga0310885_1032957223300031943SoilVTTYNEGYTAPTATTGSIWLTPNSILPARYVRLNMQLDF
Ga0310897_1059798023300032003SoilTQFGVDVYNLLNTDVVTGYNNGYSATGAWLTPTSITPARYARLNLELNF
Ga0310906_1011447713300032013SoilLNSDAVTMYNNGYSPTGAWLTPTAILPARYVRLNLQLDF
Ga0310890_1013576523300032075SoilRAQFGVDVYNLLNTDVVTTYNEGYTAPTATSGSIWLTPNSILPARYVRLNLQLDF
Ga0315910_1144113113300032144SoilRMQFGADVYNLLNTDVVTMYNNGYSAPTATRGSIWLTPTAILPARYVRLNMQLDF
Ga0315912_1073738613300032157SoilYNLLNNDAVTLYNNGYSPTGAWLTPTAILPARYVRLNLQLDF
Ga0247830_1152522523300033551SoilYNQGYSAPTATQGSIWLTPNAILPARYVRLNMQIDF
Ga0314797_106567_420_5813300034672SoilGQTRTQFGVDLYNLLNSDAVTMYNNGYSATGAWLTPTAILPARYVRLNLQLDF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.