Metagenome / Metatranscriptome Family F066369

Overview

Basic Information

• Family ID: F066369
• Family Type: Metagenome / Metatranscriptome
• Number of Sequences: 126
• Average Sequence Length: 41 residues
• Representative Sequence: GQVQQRNGVKPPETRVLDVKYVVRNQTDVLEHRNGVQIPKM
• Number of Associated Samples: 81
• Number of Associated Scaffolds: 124

Quality Assessment

• Transcriptomic Evidence: Yes
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 1.60 %
• % of genes near scaffold ends (potentially truncated): 90.48 %
• % of genes from short scaffolds (< 2000 bps): 99.21 %
• Associated GOLD sequencing projects: 79
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (96.032 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (51.587 % of family members)
• Environment Ontology (ENVO): Unclassified (89.683 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (87.302 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 31.88%
  β-sheet: 0.00%
  Coil/Unstructured: 68.12%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
All Organisms	root	All Organisms	3.97 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
cellular organisms	root	All Organisms → cellular organisms	3.97 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	3.17 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	0.79 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	3.17 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.79 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	3.17 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.79 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	3.17 %
Pasteurellales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales	0.79 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	3.17 %
Pasteurellaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae	0.79 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	3.17 %
Pasteurella	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella	0.79 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	3.17 %
Pasteurella testudinis	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis	0.79 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	3.17 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	3.17 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	3.17 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	3.17 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	3.17 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	3.17 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	3.17 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	3.17 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	3.17 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	3.17 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	3.17 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	3.17 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	3.17 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	3.17 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	0.79 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	96.03 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	0.79 %
Pasteurella testudinis DSM 23072	strain	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	0.79 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300005331|Ga0070670_101612284	Not Available	597
3300005335|Ga0070666_10697224	Not Available	744
3300005544|Ga0070686_100373370	Not Available	1078
3300009553|Ga0105249_11035122	Not Available	890
3300009995|Ga0105139_1003119	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae → Pasteurella → Pasteurella testudinis → Pasteurella testudinis DSM 23072	1645
3300010276|Ga0134104_1050455	Not Available	832
3300010371|Ga0134125_11691950	Not Available	688
3300010400|Ga0134122_12996575	Not Available	526
3300010401|Ga0134121_11217176	Not Available	754
3300010401|Ga0134121_12290691	Not Available	579
3300015290|Ga0182105_1030014	Not Available	773
3300015297|Ga0182104_1084465	Not Available	573
3300015297|Ga0182104_1105701	Not Available	528
3300015301|Ga0182184_1064972	Not Available	587
3300015306|Ga0182180_1073665	Not Available	551
3300015311|Ga0182182_1102135	Not Available	538
3300015312|Ga0182168_1031596	Not Available	854
3300015312|Ga0182168_1080220	Not Available	620
3300015312|Ga0182168_1085790	Not Available	605
3300015313|Ga0182164_1099010	Not Available	572
3300015317|Ga0182136_1039456	Not Available	800
3300015317|Ga0182136_1073454	Not Available	646
3300015320|Ga0182165_1038094	Not Available	831
3300015320|Ga0182165_1049955	Not Available	758
3300015325|Ga0182148_1135932	Not Available	517
3300015326|Ga0182166_1054693	Not Available	720
3300015326|Ga0182166_1072370	Not Available	654
3300015327|Ga0182114_1149907	Not Available	520
3300015329|Ga0182135_1134857	Not Available	532
3300015330|Ga0182152_1036981	Not Available	857
3300015330|Ga0182152_1089440	Not Available	626
3300015330|Ga0182152_1115338	Not Available	567
3300015333|Ga0182147_1008303	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1401
3300015334|Ga0182132_1115638	Not Available	591
3300015335|Ga0182116_1065251	Not Available	766
3300015336|Ga0182150_1100943	Not Available	616
3300015336|Ga0182150_1142825	Not Available	536
3300015336|Ga0182150_1164617	Not Available	504
3300015337|Ga0182151_1017955	Not Available	1104
3300015337|Ga0182151_1094880	Not Available	631
3300015339|Ga0182149_1025695	Not Available	1029
3300015339|Ga0182149_1072849	Not Available	716
3300015339|Ga0182149_1131640	Not Available	566
3300015340|Ga0182133_1035213	Not Available	975
3300015340|Ga0182133_1128561	Not Available	599
3300015348|Ga0182115_1158960	Not Available	724
3300015348|Ga0182115_1277055	Not Available	531
3300015349|Ga0182185_1060879	Not Available	1018
3300015349|Ga0182185_1146687	Not Available	701
3300015349|Ga0182185_1195516	Not Available	611
3300015349|Ga0182185_1264134	Not Available	525
3300015350|Ga0182163_1063472	Not Available	1070
3300015350|Ga0182163_1063472	Not Available	1070
3300015350|Ga0182163_1240018	Not Available	568
3300015350|Ga0182163_1279037	Not Available	523
3300015352|Ga0182169_1253240	Not Available	572
3300015353|Ga0182179_1203612	Not Available	631
3300015353|Ga0182179_1240296	Not Available	583
3300015354|Ga0182167_1156943	Not Available	839
3300015354|Ga0182167_1352064	Not Available	514
3300017412|Ga0182199_1031936	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	991
3300017412|Ga0182199_1139278	Not Available	586
3300017414|Ga0182195_1104908	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	679
3300017422|Ga0182201_1045798	Not Available	743
3300017435|Ga0182194_1110577	Not Available	570
3300017440|Ga0182214_1105553	Not Available	603
3300017445|Ga0182198_1101063	Not Available	659
3300017693|Ga0182216_1109203	Not Available	670
3300017693|Ga0182216_1134996	Not Available	617
3300020023|Ga0182178_1009635	Not Available	676
3300020023|Ga0182178_1013345	Not Available	606
3300020023|Ga0182178_1017347	Not Available	554
3300025903|Ga0207680_10951799	Not Available	615
3300025925|Ga0207650_11329158	Not Available	612
3300025931|Ga0207644_10895440	Not Available	744
3300026035|Ga0207703_10625204	Not Available	1020
3300026035|Ga0207703_11022053	Not Available	793
3300028050|Ga0268328_1045522	Not Available	595
3300028051|Ga0268344_1001525	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	1180
3300028053|Ga0268346_1034827	Not Available	545
3300028054|Ga0268306_1016875	Not Available	638
3300028056|Ga0268330_1021010	Not Available	736
3300028056|Ga0268330_1021195	Not Available	734
3300028056|Ga0268330_1049436	Not Available	548
3300028056|Ga0268330_1054753	Not Available	528
3300028056|Ga0268330_1057311	Not Available	519
3300028057|Ga0268352_1029426	Not Available	600
3300028058|Ga0268332_1037419	Not Available	661
3300028058|Ga0268332_1079228	Not Available	502
3300028061|Ga0268314_1003226	Not Available	1284
3300028062|Ga0268342_1004191	Not Available	1075
3300028062|Ga0268342_1004191	Not Available	1075
3300028139|Ga0268355_1003869	Not Available	809
3300028142|Ga0268347_1002120	Not Available	1138
3300028143|Ga0268348_1003173	Not Available	956
3300028143|Ga0268348_1016098	Not Available	585
3300028143|Ga0268348_1020436	Not Available	544
3300028144|Ga0268345_1003107	Not Available	951
3300028144|Ga0268345_1009240	Not Available	709
3300028147|Ga0268303_104946	Not Available	572
3300028151|Ga0268308_1012741	Not Available	688
3300028151|Ga0268308_1017450	Not Available	623
3300028151|Ga0268308_1027510	Not Available	538
3300028151|Ga0268308_1031432	Not Available	515
3300028152|Ga0268336_1031527	Not Available	500
3300028153|Ga0268320_1003588	Not Available	922
3300028153|Ga0268320_1006292	Not Available	790
3300028153|Ga0268320_1028913	Not Available	510
3300028248|Ga0268312_1023582	Not Available	589
3300028253|Ga0268316_1002087	Not Available	1019
3300028256|Ga0268304_1006941	Not Available	647
3300028262|Ga0268310_1001040	Not Available	1691
3300028262|Ga0268310_1011100	Not Available	829
3300028468|Ga0268317_1006923	Not Available	607
3300028470|Ga0268307_1000643	Not Available	1405
3300028472|Ga0268315_1006964	Not Available	763
3300028473|Ga0268319_1017261	Not Available	561
3300028474|Ga0268331_1011549	Not Available	663
3300028476|Ga0268329_1015297	Not Available	615
3300028476|Ga0268329_1021277	Not Available	558
3300028477|Ga0268309_1005222	Not Available	751
3300028523|Ga0268313_1000518	Not Available	1438
3300028529|Ga0268311_1007445	Not Available	769
3300032590|Ga0214489_1065823	Not Available	535
3300033534|Ga0314757_1128699	Not Available	610

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	95.24%
Environmental	Environmental	3.97%
Engineered	Engineered	0.79%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	95.24%
Terrestrial	Environmental → Terrestrial	3.97%
Bioreactor	Engineered → Bioreactor	0.79%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	88.10%
Rhizosphere	Host-Associated → Plants → Rhizosphere	4.76%
Soil	Environmental → Terrestrial → Soil	3.97%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.59%
Unclassified	Host-Associated → Plants → Unclassified	0.79%
Unclassified	Engineered → Bioreactor → Unclassified	0.79%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	88.10%
Soil	Host-Associated → Plants → Rhizosphere → Soil	3.97%
Unclassified	Environmental → Terrestrial → Soil → Unclassified	3.17%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.59%
Loam	Environmental → Terrestrial → Soil → Loam	0.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.79%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	0.79%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified	0.79%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	88.10%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	3.97%
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	3.17%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.59%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	0.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.79%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	0.79%
Unclassified	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified	0.79%

Habitat

Habitat	Taxonomy	Distribution
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	51.59%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	36.51%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	3.97%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.17%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.59%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.79%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.79%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	0.79%
Switchgrass Degrading	Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading	0.79%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Host-Associated
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated
3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Environmental
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated
3300009995	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaG	Host-Associated
3300010276	Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 15_59_3.3_214_A2 metaG	Engineered
3300010371	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1	Environmental
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental
3300015290	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015297	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015301	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG	Host-Associated
3300015306	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015325	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015326	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG	Host-Associated
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015333	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015336	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017422	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017435	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated
3300017447	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG	Host-Associated
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated
3300020023	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MG	Host-Associated
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated
3300028050	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1	Host-Associated
3300028051	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_28AUG2017_LD1	Host-Associated
3300028053	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_28AUG2017_LD1	Host-Associated
3300028054	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_15MAY2017_LD1	Host-Associated
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated
3300028057	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1	Host-Associated
3300028058	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_07AUG2017_LD1	Host-Associated
3300028061	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_05JUN2017_LD1	Host-Associated
3300028062	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_28AUG2017_LD1	Host-Associated
3300028139	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_18SEP2017_LD1	Host-Associated
3300028142	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1	Host-Associated
3300028143	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1	Host-Associated
3300028144	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_28AUG2017_LD1	Host-Associated
3300028147	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_15MAY2017_LD1	Host-Associated
3300028151	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1	Host-Associated
3300028152	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_07AUG2017_LD1	Host-Associated
3300028153	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1	Host-Associated
3300028248	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_05JUN2017_LD1	Host-Associated
3300028253	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1	Host-Associated
3300028256	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_15MAY2017_LD1	Host-Associated
3300028262	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1	Host-Associated
3300028468	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1	Host-Associated
3300028470	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1	Host-Associated
3300028472	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1	Host-Associated
3300028473	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1	Host-Associated
3300028474	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_17JUL2017_LD1	Host-Associated
3300028476	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1	Host-Associated
3300028477	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_05JUN2017_LD1	Host-Associated
3300028523	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_05JUN2017_LD1	Host-Associated
3300028529	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1	Host-Associated
3300032590	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_31MAY2016_LR3 (Metagenome Metatranscriptome)	Host-Associated
3300033534	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0070670_1016122841	3300005331	Switchgrass Rhizosphere	MGQVRQRNAVKPPETRDLDVKYVVRNQTDVVEHRNGVKIP
Ga0070666_106972241	3300005335	Switchgrass Rhizosphere	MGQVRQRNAVKPPETRDLDVKYVVRNQTDVVEHRNGVKIPKI*
Ga0070686_1003733701	3300005544	Switchgrass Rhizosphere	MGQVRQRNGVKPPETQVLDVKYVVRNQTDIVEHRNGVKIPKI*
Ga0105249_110351221	3300009553	Switchgrass Rhizosphere	MGQVRQRNGVKPPETRVLDVKYVVRNHTDILEHQNGVQIAKM*V
Ga0105139_10031191	3300009995	Switchgrass Associated	MGQVRQQNGVKPPETGVLDVKYVVRNQTDVLEQQNGVQITKM*
Ga0134104_10504551	3300010276	Switchgrass Degrading	MGQVRQ*NGMKPPETRVLDVKYVVRNHTDVLEHRNGV
Ga0134125_116919501	3300010371	Terrestrial Soil	GQVRQRNGVKPPETRVLDIKYVVRNQPDVLEHRNCVQIPKI*
Ga0134122_129965751	3300010400	Terrestrial Soil	GQVRQRNGVKPPETRVLDVKYVVRNQTDVLEHRNGVQIPSMSRVLQF*
Ga0134121_112171761	3300010401	Terrestrial Soil	MVQVRQRNGVKLPETRVLYVKYVVRNQTDILEHRNGV
Ga0134121_122906911	3300010401	Terrestrial Soil	QVRQRNGVKPPKTRNFEVNFVVRNQTDIVEHRNGVKILKI*
Ga0182105_10300141	3300015290	Switchgrass Phyllosphere	QRNGMKLPETRVLDVKYVVRNQTDVLEHRNGVKIHKM*
Ga0182104_10844651	3300015297	Switchgrass Phyllosphere	MGQVWQRNGVKPPETQVLDAKYVVQNQTDIVEHRNGVKSFK*
Ga0182104_11057011	3300015297	Switchgrass Phyllosphere	NGMKPPETRVLDVKYVVRNQTDILEHRNDVQIPKM*
Ga0182184_10649722	3300015301	Switchgrass Phyllosphere	FTMGQVQQRNGVKPPETRVLDVKYVVRNQTDILEH*
Ga0182180_10736651	3300015306	Switchgrass Phyllosphere	MGQVQQQNGVKPPETRVLDVKYVVQNQMDVLEHQNGVQIPKM*
Ga0182182_11021351	3300015311	Switchgrass Phyllosphere	MGQVRQRNGVKQPETRILDVKYVVRNQADVVEHRNG
Ga0182168_10315961	3300015312	Switchgrass Phyllosphere	MGQVGQ*NGVRPPETRVLDVKYVVRNQTDILEHRNDV
Ga0182168_10802201	3300015312	Switchgrass Phyllosphere	MGQVWQRNGVKQPETRILDVKYVVRNQTDVVEHRNGVKIPKI*VLD
Ga0182168_10857901	3300015312	Switchgrass Phyllosphere	QQNGVKPPETRVLDVKYVVRNQTDVVEHRNGVKIPKI*
Ga0182164_10990101	3300015313	Switchgrass Phyllosphere	TMGQVWQRNGVKPPETRVLDVKYVVRNQTDVLEH*
Ga0182136_10394561	3300015317	Switchgrass Phyllosphere	TIGQVRIRNAVKPQETRVLDIKYVVRYQADVLEHRNGVKIPKI*
Ga0182136_10734541	3300015317	Switchgrass Phyllosphere	NGVKPHKTRVLNVKYVVRNQTDILEHRSDVQIPKM*
Ga0182165_10380941	3300015320	Switchgrass Phyllosphere	MGQVWQRNGVKPPETRDLDVKYVVRNQTDIVEHQNGVKIPKM*
Ga0182165_10499551	3300015320	Switchgrass Phyllosphere	MGQVRQRNGVKPPETQVLDVKYVVRNQTDILEHRNDVQI
Ga0182148_11359321	3300015325	Switchgrass Phyllosphere	MGQVQQRNGVKPPKTRVLDAKYLVQNQMDVLEHQNGVQIPKM*
Ga0182166_10546931	3300015326	Switchgrass Phyllosphere	MGQVRQRNGVKPPETRVLDVKYVVRNQTDILEHQNGV
Ga0182166_10723701	3300015326	Switchgrass Phyllosphere	MSQARQRNGVKPPET*VLDVKYVVRNKTDFLEHRNGVKIPKM*VLD
Ga0182114_11499071	3300015327	Switchgrass Phyllosphere	MGQVQQRNGVKPPETRVLDAKYVVQNQMDVLEHQNGVQIPKM*
Ga0182135_11348571	3300015329	Switchgrass Phyllosphere	QRNGVKPPETRVLDVKYVVRNQTDVLEHRNGVQIHKM*
Ga0182152_10369812	3300015330	Switchgrass Phyllosphere	MGQVQKRNGVKPPETQVLEIKYVVRNQPDVLEHRNGVQIPKM*
Ga0182152_10894401	3300015330	Switchgrass Phyllosphere	MGQVRQRNDVKPPKTQNLDVKYVVRNQTDVVEHRNGVKMPKI*V
Ga0182152_11153382	3300015330	Switchgrass Phyllosphere	MGQVRQ*NGVKPPETQVLDVKYVVRNQMNVVEHRNGVK
Ga0182147_10083031	3300015333	Switchgrass Phyllosphere	RNGMKLPETRVLDVKYVVRNQTDVLEHRNGVKIHKM*
Ga0182132_11156382	3300015334	Switchgrass Phyllosphere	MGQVRQRNGVKPPETKILDANYVVRNQTDVLEHQNGVKIP
Ga0182116_10652511	3300015335	Switchgrass Phyllosphere	QVRQRNGVKPPETRVLDVKYVVRNQTDVVEHQNGVKIQRI*
Ga0182150_11009431	3300015336	Switchgrass Phyllosphere	MGQVRQRNGMKPPETRVLDVKYVVRNQTDILEHRNDVQIPKM*VLDLKEC
Ga0182150_11428251	3300015336	Switchgrass Phyllosphere	MGQVRQRNDVKPPKTRNLDVKYVVRNQTDIVEHRNGVKILKI*VLDLKEC
Ga0182150_11646171	3300015336	Switchgrass Phyllosphere	MGQVQQRNGVKPPET*VLDVKYVVRNQTDFLEHRNSVK
Ga0182151_10179551	3300015337	Switchgrass Phyllosphere	MGQVRQ*NDMKPPKTRILDVKYVVRNQTDVVEHRNGVKMPKI*VL
Ga0182151_10948802	3300015337	Switchgrass Phyllosphere	MGQVRQRNGVKPPETQVLEVNYVVRNQRDVVERRNGVKIPKL*VLDLKE
Ga0182149_10256951	3300015339	Switchgrass Phyllosphere	MCQVRQRNGMKPPKT*VLDVKYVVRNQKDVLEHRNGVKIPKM*V
Ga0182149_10728491	3300015339	Switchgrass Phyllosphere	*NGVKPPETRVLDVKYVV*NQTDVLEHRNGVKIPKI*VLDLK*
Ga0182149_11316401	3300015339	Switchgrass Phyllosphere	GQVQQRNGVKPPETRVLDVKYVMRIQADILEYRNDVQIPKM*
Ga0182133_10352131	3300015340	Switchgrass Phyllosphere	MGQVWQRNGMKPPETRVLDVKYVVRNQTDILEHRNGVQIPK
Ga0182133_11285611	3300015340	Switchgrass Phyllosphere	MGQVQQRNGVKQPETRILDVKYVVQNQTDVVEHRNGVKIPKM*
Ga0182115_11589602	3300015348	Switchgrass Phyllosphere	MGQVRQRNDVKPPKTRILDVKYVVRNQTDVVEHRNGVKMPKI*VLDLKEC
Ga0182115_12770551	3300015348	Switchgrass Phyllosphere	MGQVQQRKGVKSPET*VLDVKYVVRNQTDVLEHRNGVKIPKI*
Ga0182185_10608791	3300015349	Switchgrass Phyllosphere	MGQVRQ*NDMKPPKTRILDVKYVVRNQTDVVEHRNGVKMPKI*VLDLKEC
Ga0182185_11466871	3300015349	Switchgrass Phyllosphere	MGQVQQQNGVKPPETRVLEIKYVVRNQTDIVEHQNGVKLPQI*
Ga0182185_11955161	3300015349	Switchgrass Phyllosphere	MGQVRQRNAVKPPETRDLDVKYVVRNQTDVVEHRNGVKIPKI*VLDLKECI
Ga0182185_12641341	3300015349	Switchgrass Phyllosphere	RQRNGMKPPETRVLDVKYVVRNQTDVLEHRNCVKIPIM*
Ga0182163_10634721	3300015350	Switchgrass Phyllosphere	GVKPPETRVLDVKYVVRNQTDILEHQNGVKIPKI*
Ga0182163_10634722	3300015350	Switchgrass Phyllosphere	MGQGRQRNGVKPPETQVLDVKYVVRNQADVLEHRNGVKIPKI*
Ga0182163_12400181	3300015350	Switchgrass Phyllosphere	RQRNGMKPPETRVLDIKYVVRNQTDILEHRNDVQIPKM*
Ga0182163_12790371	3300015350	Switchgrass Phyllosphere	MGPVRQ*NGMKPPETRVLDIKYVVRNQTDILEHRNDVQIPKM*V
Ga0182169_12532401	3300015352	Switchgrass Phyllosphere	GRQRNGVKPPETQVLDVKYVVRNQTDVVEHRNGVKIPKI*
Ga0182179_12036121	3300015353	Switchgrass Phyllosphere	MGQVRQRNDVKPPETRVLDVKYVVRNQTDFLEHRNGVKI
Ga0182179_12402961	3300015353	Switchgrass Phyllosphere	GVKPPETRVLDVKYVVRNQTGVLEHRNGVQIAKI*
Ga0182167_11569431	3300015354	Switchgrass Phyllosphere	QRNGVKPPETRVLNVKFVVRNQTDILEHRNDVQIPKM*
Ga0182167_13520641	3300015354	Switchgrass Phyllosphere	QRNGMKPPETQVLDVKYVVRNQTDILEHRNGVKIPKM*
Ga0182199_10319361	3300017412	Switchgrass Phyllosphere	AQVRQQNGMKLPETRVLDVKYVVRNQTDVLEHRNGVKIHKM
Ga0182199_11392782	3300017412	Switchgrass Phyllosphere	MGQVQQXNGVKPPETRVLDVKYVVRNQTDVLEHRN
Ga0182195_11049081	3300017414	Switchgrass Phyllosphere	NGMKLPETRVLDVKYVVRNQTDVLEHRNGLKIHKM
Ga0182201_10457981	3300017422	Switchgrass Phyllosphere	MGQVRQXNGVKPPETRVLDVKYVVRNQTDVLEHRNGVQIPKMXVLDLKECI
Ga0182194_11105771	3300017435	Switchgrass Phyllosphere	QVRQRNGVKPPETQVLDVKYVVRNQTDIVEHRNGVKIPKI
Ga0182214_11055531	3300017440	Switchgrass Phyllosphere	MAQVRQRNGMKLPETRVLDVKYVVXNQMDVLEHRNGVKIHKMXVLD
Ga0182198_11010631	3300017445	Switchgrass Phyllosphere	GHVRQRNGVKPPETRVLDIKYVVRNQPDVLEHQNCVQIPKI
Ga0182215_10919761	3300017447	Switchgrass Phyllosphere	NGVKPPETRVLDIKYVVRNQTDVVEHRSGVKLPQI
Ga0182216_11092031	3300017693	Switchgrass Phyllosphere	MHPILIFTMGKVRQRNGVKPPETRVLHIKYVERNQTDIVEHRN
Ga0182216_11349961	3300017693	Switchgrass Phyllosphere	MGQVRQXNAVKPHETRDLDVKYVVRNQTDVVEHRNGVKIPKIXVLDL
Ga0182178_10096351	3300020023	Switchgrass Phyllosphere	RQRNGMKPPKTRIFDLKYVVRNQTDIVEHRNGVKIPKM
Ga0182178_10133451	3300020023	Switchgrass Phyllosphere	MGQVRQRNGVKPPETRVLDVKYVVRNQTDVLEHQNGVQIAKMXVLDQKE
Ga0182178_10173471	3300020023	Switchgrass Phyllosphere	MGQVRQQNGVKPPETRVLDIKYVVRNQPDILEHRNCVQIPKM
Ga0207680_109517992	3300025903	Switchgrass Rhizosphere	QVQKRNGVKPPETQVLEIKYVVRNQPDVLEHRNGVQIPKM
Ga0207650_113291581	3300025925	Switchgrass Rhizosphere	MGQVRQRNAVKPPETRDLDVKYVVRNQTDVVEHRNGVKIPKIXVL
Ga0207644_108954402	3300025931	Switchgrass Rhizosphere	QRNGLKPPETQVLDVKYVVRNQTDVLEHQNGVKIPKM
Ga0207703_106252042	3300026035	Switchgrass Rhizosphere	MGQVRQRNGVKPPETQVLDVKYVVRNQMNIVEHRNGVKIP
Ga0207703_110220531	3300026035	Switchgrass Rhizosphere	RNGVRPPETRVLVVKYVVRNQTDILEHRNDVQIPKM
Ga0268328_10455221	3300028050	Phyllosphere	IFTMGQVRQRNGVKPPETRVLDIKYMVRNQTDFLEQRNGVKIPKM
Ga0268344_10015252	3300028051	Phyllosphere	MAQVRQRNGMKLPETRVLDVKYVVRNQTDILEHRNGLKIHKM
Ga0268346_10348271	3300028053	Phyllosphere	MGQVRQRNGVKPPETQVLDVKYVVRNQTDIVEHRNGVKIPKI
Ga0268306_10168751	3300028054	Phyllosphere	FTMGQVRQRNGVKPPKTLVLDIKYVVRNQTDVVELRNGVKLPQI
Ga0268330_10210101	3300028056	Phyllosphere	GQVRQRNGVKPPETRVLDIKYMVRNQTDFLEQRNGVKITKM
Ga0268330_10211951	3300028056	Phyllosphere	MGQVQQRNGVKRPKTRVLDVKYVVRNQTDILEHRNGVKIPKMXVLDL
Ga0268330_10494361	3300028056	Phyllosphere	MGQVRQRNGMKPPETRVLDIKYVVRNQPDILDHRNCVQIPKM
Ga0268330_10547531	3300028056	Phyllosphere	MGQVRQRNGVKPPETLVLDIKYVVRNQPDILEHRNGVQIPKMXALDL
Ga0268330_10573111	3300028056	Phyllosphere	MGQVRQRKGMKLPKTRVLDIKYVVRNQTDILEHRNGVKIPK
Ga0268352_10294261	3300028057	Phyllosphere	MGQVRQRNGVKPPETXVLDKKYVVRNQTDVVEHRNG
Ga0268332_10374191	3300028058	Phyllosphere	MKPPETRVLDVKYVVRNQTDVLEHRNCVKIPIMCVLDLTECIEIF
Ga0268332_10792281	3300028058	Phyllosphere	MGQVRQRNGVKPPETXVLDKKYVVRNQTDVVEHRNGVKLPQIXVL
Ga0268314_10032262	3300028061	Phyllosphere	GQVRQRSDVKPPKTQVLDVKYVVRNQTDVLEQQNGVQITKM
Ga0268342_10041911	3300028062	Phyllosphere	MGQVQQQNGVKPPKTRVLDLNFVVQNQTDVLEHRNLVK
Ga0268342_10041913	3300028062	Phyllosphere	LIFTMGQVQQQNGVKPPKTRVLDLNFVVQNQTDVLEHRNLVKIPKI
Ga0268355_10038692	3300028139	Phyllosphere	MGQVRQRNGVKPPETRVLDVKYGVRNQMDVLEHRNGVQIPKMXVLDLK
Ga0268347_10021202	3300028142	Phyllosphere	GQVRQRNGMKPPETRVLDVKYVVRNQTDVLEHXNGVQIPKMXVLDLK
Ga0268348_10031731	3300028143	Phyllosphere	MGQVRQRNGLKQPEIXILDIKYVVRNQTDVVEHRNG
Ga0268348_10160981	3300028143	Phyllosphere	MGQVRQRNGMKPPKTRIFDLKYVVRNQTDVVEHRNGVK
Ga0268348_10204361	3300028143	Phyllosphere	TMGQVRQRNGVKPPETRVLDVKYVVRNQTDILEHRNGV
Ga0268345_10031071	3300028144	Phyllosphere	MGQVRQRNAVKPPETRDLDVKYVVRNQTDVVEHRNGVKI
Ga0268345_10092401	3300028144	Phyllosphere	MGQVRQRNGVKPPKTRVLDIKYVVRNQPDILAHXNGVQIPKMXVLNLKEC
Ga0268303_1049461	3300028147	Phyllosphere	MGQVRQRNGVKPPETRVLDIKYVVRNQTNIVEHRNGVKLPQI
Ga0268308_10127411	3300028151	Phyllosphere	MGQVRQRNGLKPPETQVLGVKYVVRNQIDVLEHRNGVKIPKMXVL
Ga0268308_10174501	3300028151	Phyllosphere	GQVQQRNGVKPPETRVLDVKYVVRNQTDVLEHRNGVQIPKM
Ga0268308_10275101	3300028151	Phyllosphere	MGQVRQRNGVKPPETRVLDVKYVVRNQTDILEHXNG
Ga0268308_10314321	3300028151	Phyllosphere	MGQVRQRNDVKPPETRVLDVKYVVRNQTDFLEHRNG
Ga0268336_10315271	3300028152	Phyllosphere	IFTMGQVRQRNGVKPPETRVLDVKYVVRNQTDILEHRNDVQIPKM
Ga0268320_10035882	3300028153	Phyllosphere	MVQVRQRNGVKPPKTRVLDVKYVVXNQTDIVDNRNGVK
Ga0268320_10062921	3300028153	Phyllosphere	MGQVQQQNGVKPPKTRVLDLNFVVQNQTDVLEHQNL
Ga0268320_10289131	3300028153	Phyllosphere	MGLVWQXNGMKPPETRVLDVKYMVRNQTDVVEHRNGVK
Ga0268312_10235821	3300028248	Phyllosphere	QRNGVKPPETQILDVKYVVRNQTDVVEHRNCVKIPKI
Ga0268316_10020871	3300028253	Phyllosphere	MGQVRQXNGVKPPETRVLEVKYVVQNQRDVVEHRN
Ga0268304_10069411	3300028256	Phyllosphere	NGVKPTKTRVLDVKYMVRNQTDVLEHRNGVQIPKM
Ga0268310_10010401	3300028262	Phyllosphere	MGQVQQRKGVKSPETXVLDVKYVVRNQTDVLEHRNGVKIPKIXVLDLK
Ga0268310_10111001	3300028262	Phyllosphere	MGQVRQXNGMKPHKTRILDVKYVVRNQTNVVEHRNGVK
Ga0268317_10069231	3300028468	Phyllosphere	NGVKPPKTRTLDVKYVVRNQTDIVKHRNGVKILKI
Ga0268307_10006432	3300028470	Phyllosphere	MGQVWQRNGVKPPETRVLDVKYVVRNQTDVLEHRNGVQIPKMXVLD
Ga0268315_10069641	3300028472	Phyllosphere	MGQVWQRNGVKQPETRILDVKYVVRNQTDVVEHRNGVKIPKIXV
Ga0268319_10172611	3300028473	Phyllosphere	QRNGVKPPETQVLDVKYVVRNQMDVVEHRNGVKIPKI
Ga0268331_10115491	3300028474	Phyllosphere	MGQVRQXNGVKPPETXVLEVKYVVRNQTDILEHRNDVQI
Ga0268329_10152971	3300028476	Phyllosphere	MGQVRQRNGVKPPETRVLDIKYVVRNQPDVLEHRNCVQIPKI
Ga0268329_10212771	3300028476	Phyllosphere	MCQVRQRNGMKPPKTXVLDIKYVVRNQKDVLEHRNGVK
Ga0268309_10052221	3300028477	Phyllosphere	MVQVWQQNGVKPPETRVLDVKYVVRNQTDVVEHRNGVKIPKI
Ga0268313_10005183	3300028523	Phyllosphere	QVRQRNGVKPPKTRVLDIKYVVRNQPDVLEHRNGVQIPKM
Ga0268311_10074451	3300028529	Phyllosphere	MGQVRQXNGVKQPETRILDVKYVVRNQTDVVEHRN
Ga0214489_10658231	3300032590	Switchgrass Phyllosphere	MGQVRQRIGVKPPKTRVLDVKYVVRNQMDVVEHQNGVKFPKIXV
Ga0314757_11286991	3300033534	Switchgrass Phyllosphere	MGQVQQRNGVKPPEIRVLDVKYVVXNQTDILEHRNGVQI