| Basic Information | |
|---|---|
| Family ID | F066309 |
| Family Type | Metagenome |
| Number of Sequences | 126 |
| Average Sequence Length | 39 residues |
| Representative Sequence | DRIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL |
| Number of Associated Samples | 55 |
| Number of Associated Scaffolds | 125 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 30.70 % |
| % of genes near scaffold ends (potentially truncated) | 76.98 % |
| % of genes from short scaffolds (< 2000 bps) | 85.71 % |
| Associated GOLD sequencing projects | 55 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.32 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (83.333 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (93.651 % of family members) |
| Environment Ontology (ENVO) | Unclassified (99.206 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (93.651 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.36% β-sheet: 0.00% Coil/Unstructured: 63.64% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 125 Family Scaffolds |
|---|---|---|
| PF04827 | Plant_tran | 0.80 |
| PF05970 | PIF1 | 0.80 |
| PF00067 | p450 | 0.80 |
| PF16486 | ArgoN | 0.80 |
| COG ID | Name | Functional Category | % Frequency in 125 Family Scaffolds |
|---|---|---|---|
| COG0507 | ATPase/5’-3’ helicase helicase subunit RecD of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.80 |
| COG2124 | Cytochrome P450 | Defense mechanisms [V] | 0.80 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 83.33 % |
| All Organisms | root | All Organisms | 16.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300014486|Ga0182004_10006967 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 9217 | Open in IMG/M |
| 3300014486|Ga0182004_10007685 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata | 8771 | Open in IMG/M |
| 3300014486|Ga0182004_10021826 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 4768 | Open in IMG/M |
| 3300014486|Ga0182004_10025409 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 4268 | Open in IMG/M |
| 3300015265|Ga0182005_1226973 | Not Available | 570 | Open in IMG/M |
| 3300015267|Ga0182122_1016049 | Not Available | 757 | Open in IMG/M |
| 3300015268|Ga0182154_1030270 | Not Available | 645 | Open in IMG/M |
| 3300015268|Ga0182154_1040977 | Not Available | 595 | Open in IMG/M |
| 3300015268|Ga0182154_1052552 | Not Available | 554 | Open in IMG/M |
| 3300015269|Ga0182113_1001469 | Not Available | 1676 | Open in IMG/M |
| 3300015275|Ga0182172_1033660 | Not Available | 638 | Open in IMG/M |
| 3300015277|Ga0182128_1051498 | Not Available | 572 | Open in IMG/M |
| 3300015277|Ga0182128_1069240 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 524 | Open in IMG/M |
| 3300015281|Ga0182160_1041292 | Not Available | 618 | Open in IMG/M |
| 3300015283|Ga0182156_1040687 | Not Available | 631 | Open in IMG/M |
| 3300015285|Ga0182186_1008197 | Not Available | 972 | Open in IMG/M |
| 3300015285|Ga0182186_1028378 | Not Available | 686 | Open in IMG/M |
| 3300015285|Ga0182186_1074687 | Not Available | 520 | Open in IMG/M |
| 3300015287|Ga0182171_1066685 | Not Available | 548 | Open in IMG/M |
| 3300015287|Ga0182171_1076382 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 526 | Open in IMG/M |
| 3300015287|Ga0182171_1080661 | Not Available | 517 | Open in IMG/M |
| 3300015288|Ga0182173_1013004 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 850 | Open in IMG/M |
| 3300015291|Ga0182125_1063234 | Not Available | 568 | Open in IMG/M |
| 3300015291|Ga0182125_1080273 | Not Available | 529 | Open in IMG/M |
| 3300015294|Ga0182126_1036326 | Not Available | 670 | Open in IMG/M |
| 3300015294|Ga0182126_1044467 | Not Available | 632 | Open in IMG/M |
| 3300015294|Ga0182126_1087351 | Not Available | 518 | Open in IMG/M |
| 3300015295|Ga0182175_1009770 | Not Available | 973 | Open in IMG/M |
| 3300015299|Ga0182107_1042358 | Not Available | 661 | Open in IMG/M |
| 3300015302|Ga0182143_1037300 | Not Available | 684 | Open in IMG/M |
| 3300015303|Ga0182123_1005538 | Not Available | 1110 | Open in IMG/M |
| 3300015303|Ga0182123_1045923 | Not Available | 628 | Open in IMG/M |
| 3300015303|Ga0182123_1056484 | Not Available | 593 | Open in IMG/M |
| 3300015303|Ga0182123_1064536 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum | 571 | Open in IMG/M |
| 3300015304|Ga0182112_1021069 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 805 | Open in IMG/M |
| 3300015304|Ga0182112_1055332 | Not Available | 612 | Open in IMG/M |
| 3300015305|Ga0182158_1014130 | Not Available | 893 | Open in IMG/M |
| 3300015307|Ga0182144_1012617 | Not Available | 939 | Open in IMG/M |
| 3300015307|Ga0182144_1110020 | Not Available | 500 | Open in IMG/M |
| 3300015323|Ga0182129_1001827 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius | 1617 | Open in IMG/M |
| 3300015323|Ga0182129_1094819 | Not Available | 535 | Open in IMG/M |
| 3300015323|Ga0182129_1106007 | Not Available | 517 | Open in IMG/M |
| 3300015341|Ga0182187_1149969 | Not Available | 559 | Open in IMG/M |
| 3300015342|Ga0182109_1047695 | Not Available | 884 | Open in IMG/M |
| 3300015343|Ga0182155_1018934 | Not Available | 1165 | Open in IMG/M |
| 3300015343|Ga0182155_1019907 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 1148 | Open in IMG/M |
| 3300015343|Ga0182155_1116741 | Not Available | 641 | Open in IMG/M |
| 3300015343|Ga0182155_1130677 | Not Available | 615 | Open in IMG/M |
| 3300015344|Ga0182189_1027422 | Not Available | 1065 | Open in IMG/M |
| 3300015344|Ga0182189_1146406 | Not Available | 597 | Open in IMG/M |
| 3300015345|Ga0182111_1058026 | Not Available | 862 | Open in IMG/M |
| 3300015345|Ga0182111_1128629 | Not Available | 645 | Open in IMG/M |
| 3300015346|Ga0182139_1028629 | Not Available | 1099 | Open in IMG/M |
| 3300015346|Ga0182139_1047797 | Not Available | 924 | Open in IMG/M |
| 3300015346|Ga0182139_1049929 | Not Available | 911 | Open in IMG/M |
| 3300015347|Ga0182177_1118892 | Not Available | 667 | Open in IMG/M |
| 3300015347|Ga0182177_1232238 | Not Available | 516 | Open in IMG/M |
| 3300015351|Ga0182161_1000290 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 3943 | Open in IMG/M |
| 3300015351|Ga0182161_1028464 | Not Available | 1168 | Open in IMG/M |
| 3300015351|Ga0182161_1056741 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 917 | Open in IMG/M |
| 3300015351|Ga0182161_1069285 | Not Available | 851 | Open in IMG/M |
| 3300015351|Ga0182161_1081691 | Not Available | 800 | Open in IMG/M |
| 3300015351|Ga0182161_1085747 | Not Available | 785 | Open in IMG/M |
| 3300015351|Ga0182161_1175373 | Not Available | 596 | Open in IMG/M |
| 3300015351|Ga0182161_1230061 | Not Available | 534 | Open in IMG/M |
| 3300015351|Ga0182161_1255820 | Not Available | 511 | Open in IMG/M |
| 3300015355|Ga0182159_1003055 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 2706 | Open in IMG/M |
| 3300015355|Ga0182159_1147551 | Not Available | 731 | Open in IMG/M |
| 3300015355|Ga0182159_1187995 | Not Available | 660 | Open in IMG/M |
| 3300015355|Ga0182159_1347225 | Not Available | 505 | Open in IMG/M |
| 3300015361|Ga0182145_1038400 | Not Available | 857 | Open in IMG/M |
| 3300015361|Ga0182145_1140732 | Not Available | 561 | Open in IMG/M |
| 3300015361|Ga0182145_1182121 | Not Available | 514 | Open in IMG/M |
| 3300017404|Ga0182203_1005017 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 1420 | Open in IMG/M |
| 3300017404|Ga0182203_1043884 | Not Available | 766 | Open in IMG/M |
| 3300017404|Ga0182203_1069117 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 666 | Open in IMG/M |
| 3300017407|Ga0182220_1005242 | Not Available | 1134 | Open in IMG/M |
| 3300017407|Ga0182220_1077561 | Not Available | 554 | Open in IMG/M |
| 3300017410|Ga0182207_1003944 | Not Available | 1592 | Open in IMG/M |
| 3300017410|Ga0182207_1070524 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor | 684 | Open in IMG/M |
| 3300017410|Ga0182207_1070919 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 682 | Open in IMG/M |
| 3300017410|Ga0182207_1121289 | Not Available | 572 | Open in IMG/M |
| 3300017410|Ga0182207_1140168 | Not Available | 544 | Open in IMG/M |
| 3300017410|Ga0182207_1150462 | Not Available | 531 | Open in IMG/M |
| 3300017411|Ga0182208_1013636 | Not Available | 984 | Open in IMG/M |
| 3300017411|Ga0182208_1065751 | Not Available | 622 | Open in IMG/M |
| 3300017413|Ga0182222_1029359 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 705 | Open in IMG/M |
| 3300017420|Ga0182228_1104734 | Not Available | 543 | Open in IMG/M |
| 3300017424|Ga0182219_1099493 | Not Available | 561 | Open in IMG/M |
| 3300017425|Ga0182224_1058327 | Not Available | 700 | Open in IMG/M |
| 3300017427|Ga0182190_1003050 | Not Available | 1798 | Open in IMG/M |
| 3300017427|Ga0182190_1091373 | Not Available | 617 | Open in IMG/M |
| 3300017427|Ga0182190_1105225 | Not Available | 587 | Open in IMG/M |
| 3300017427|Ga0182190_1134474 | Not Available | 540 | Open in IMG/M |
| 3300017430|Ga0182192_1070246 | Not Available | 687 | Open in IMG/M |
| 3300017436|Ga0182209_1048037 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa | 757 | Open in IMG/M |
| 3300017436|Ga0182209_1119388 | Not Available | 569 | Open in IMG/M |
| 3300017436|Ga0182209_1119388 | Not Available | 569 | Open in IMG/M |
| 3300017438|Ga0182191_1038394 | Not Available | 841 | Open in IMG/M |
| 3300017442|Ga0182221_1010219 | Not Available | 1172 | Open in IMG/M |
| 3300017442|Ga0182221_1060421 | Not Available | 693 | Open in IMG/M |
| 3300017442|Ga0182221_1168083 | Not Available | 504 | Open in IMG/M |
| 3300017443|Ga0182193_1081307 | Not Available | 681 | Open in IMG/M |
| 3300017443|Ga0182193_1140022 | Not Available | 567 | Open in IMG/M |
| 3300017443|Ga0182193_1165814 | Not Available | 534 | Open in IMG/M |
| 3300017683|Ga0182218_1018396 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 946 | Open in IMG/M |
| 3300017683|Ga0182218_1110034 | Not Available | 558 | Open in IMG/M |
| 3300017684|Ga0182225_1044652 | Not Available | 723 | Open in IMG/M |
| 3300017684|Ga0182225_1126368 | Not Available | 524 | Open in IMG/M |
| 3300017685|Ga0182227_1048411 | Not Available | 753 | Open in IMG/M |
| 3300017685|Ga0182227_1055654 | Not Available | 710 | Open in IMG/M |
| 3300017686|Ga0182205_1108718 | Not Available | 587 | Open in IMG/M |
| 3300017690|Ga0182223_1013115 | Not Available | 924 | Open in IMG/M |
| 3300026118|Ga0207675_100887343 | Not Available | 908 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 93.65% |
| Root | Host-Associated → Plants → Roots → Unclassified → Unclassified → Root | 4.76% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300014486 | Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015267 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015268 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015275 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015277 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015281 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015283 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015285 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015288 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015291 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015296 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015302 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015303 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015305 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015344 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017420 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017427 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017685 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017690 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0182004_100069673 | 3300014486 | Root | MLDNIRLDVDIINIQFKYSDVNTVSDVGYSDSDTDRSKPL* |
| Ga0182004_100076856 | 3300014486 | Root | MPNRTRLDIDIINMLFEYSNMDTVSDVVYLNLDMDGSKPL* |
| Ga0182004_100187011 | 3300014486 | Root | MSTILDMIQLDIDIINIRFEYINTNTTSDVEYPDSDMIGFEHF* |
| Ga0182004_100218262 | 3300014486 | Root | MSDKIELNINIINIRFKYSDTDTVSYVEYSDSDTDIYKSL* |
| Ga0182004_100254096 | 3300014486 | Root | RLDVDIINIRFKYSDTDTVSDVGYSDSDTDRFEPL* |
| Ga0182004_100534891 | 3300014486 | Root | MAINIRDENGSHRIRLDVDIIYIRFKNLDMDTVSDVGYSDLDTDRSEPL* |
| Ga0182005_12269731 | 3300015265 | Rhizosphere | *LDVDITNI*FKYSNMNTVSDVEYSDSDTDRSKPF* |
| Ga0182122_10160491 | 3300015267 | Miscanthus Phyllosphere | MGLAMPDRIRLDVDIINM*FEYSDTDTVSDVEYPDSDTD |
| Ga0182154_10302701 | 3300015268 | Miscanthus Phyllosphere | DRVRLNIDIINIRLKYLDMDTVSDIEYLDSDTDRSEPF* |
| Ga0182154_10409771 | 3300015268 | Miscanthus Phyllosphere | IRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQLL* |
| Ga0182154_10525521 | 3300015268 | Miscanthus Phyllosphere | MTDRIGLDIDIINMRFDYSDTDTVSDVEYPDSDTDRFELL* |
| Ga0182113_10014691 | 3300015269 | Miscanthus Phyllosphere | MGLAMPDRIRLDVDIINMRFEYLDTDTVSDVEYPDS |
| Ga0182172_10336601 | 3300015275 | Miscanthus Phyllosphere | DMIRLDIDIINMRFEFSNTDMVPDVEYPDSDMDRSQPL* |
| Ga0182128_10514981 | 3300015277 | Miscanthus Phyllosphere | IRLDIDVINMRFEYSDTDTVSDVGYPDSDTDRSQPL* |
| Ga0182128_10692401 | 3300015277 | Miscanthus Phyllosphere | RLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPF* |
| Ga0182160_10412921 | 3300015281 | Miscanthus Phyllosphere | MSDRIRLDIDIINMRFEYSHMDTVSDVGYPDSDTDRSQP |
| Ga0182156_10406871 | 3300015283 | Miscanthus Phyllosphere | MLDRI*LDIDIINMQFEYSDMDTVSDVGYPDSDTDRSQPL |
| Ga0182186_10081971 | 3300015285 | Miscanthus Phyllosphere | MPDMIRLDIDIINMRFEYSDTDSISDVGYPDSDTDRSQP |
| Ga0182186_10283782 | 3300015285 | Miscanthus Phyllosphere | LDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL* |
| Ga0182186_10746871 | 3300015285 | Miscanthus Phyllosphere | VSAMSDRIRLDIDIINMRFEDSDMNTVLDVEYVNSDADGSEPL* |
| Ga0182171_10666851 | 3300015287 | Miscanthus Phyllosphere | RLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL* |
| Ga0182171_10763821 | 3300015287 | Miscanthus Phyllosphere | TMSDMIRLDIDIINMRFEYLDTDTVSDVGYPNLNMDRSQPF* |
| Ga0182171_10806611 | 3300015287 | Miscanthus Phyllosphere | MPDRIRLDIDIINMRFEYTDMDIVSDVEYPDSDMSR |
| Ga0182173_10130041 | 3300015288 | Miscanthus Phyllosphere | MSDMIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQP |
| Ga0182125_10632341 | 3300015291 | Miscanthus Phyllosphere | DRIRLDVDIINVIIGYGFEYSDMDTVSDVGYLDSDTDRSQPL* |
| Ga0182125_10802731 | 3300015291 | Miscanthus Phyllosphere | MSAIPDRIRFDVDIINMRFEFLDTDTVSNVEYPDSDTVRSQPQ* |
| Ga0182126_10363262 | 3300015294 | Miscanthus Phyllosphere | MSDMIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDISQPL* |
| Ga0182126_10444672 | 3300015294 | Miscanthus Phyllosphere | VSTMPYMIRLDIDIVNIRFDYSDTDTVSDVEYLDSGTDKSELL* |
| Ga0182126_10873511 | 3300015294 | Miscanthus Phyllosphere | MSDRIRLYIDIINIRFEYSDTDTVSDVGYPDSDTDRSQ |
| Ga0182175_10097702 | 3300015295 | Miscanthus Phyllosphere | LDVDIINMRFEYSDTDTVSDVEYADSDTDRSEPL* |
| Ga0182157_10255712 | 3300015296 | Miscanthus Phyllosphere | I*LDIDIINMRFDYSDTVSDVEYPDSDTDIFELL* |
| Ga0182106_11013641 | 3300015298 | Miscanthus Phyllosphere | MLDRIRLDIDIINMLFEYSDTDKVSDVEYPDSDTDISKPL* |
| Ga0182107_10423581 | 3300015299 | Miscanthus Phyllosphere | MGLAMPDRIRLDVDIINMRFDYLDTDTVSDVEYLDSDTDRSEHL* |
| Ga0182143_10373001 | 3300015302 | Miscanthus Phyllosphere | THRIQLDINIINMRFEYSDTDTVSDVEYPDSNMNRSEPL* |
| Ga0182123_10055383 | 3300015303 | Miscanthus Phyllosphere | VSTMSDRIRFGIDIINMRFEYSDTDTVLDIEYLDSDMDIS* |
| Ga0182123_10459231 | 3300015303 | Miscanthus Phyllosphere | AMPDRIRLGIDIINMRFEYSDTDTVSDVEYPDSDTDRFEPL* |
| Ga0182123_10564841 | 3300015303 | Miscanthus Phyllosphere | TMPDRIRLDIDIINMLFEYSDTDKVSDVEYPDSDMDRSEPL* |
| Ga0182123_10645362 | 3300015303 | Miscanthus Phyllosphere | RIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQLL* |
| Ga0182112_10210691 | 3300015304 | Miscanthus Phyllosphere | MSDRIRLDIDIINMRFEYSDTDTDTVSDVGYPDSD |
| Ga0182112_10553321 | 3300015304 | Miscanthus Phyllosphere | MPDRIRLDIDIINM*FKYLDTDTMSDVEYPDSDMDRSEPL |
| Ga0182158_10141301 | 3300015305 | Miscanthus Phyllosphere | SDRIRLDINIINMRFEYSDTDTVLDVGYPDSDTDISQPL* |
| Ga0182144_10126171 | 3300015307 | Miscanthus Phyllosphere | MSDMIRLDINIINIRFEYSDTDTVSDVGYPDSDTN |
| Ga0182144_11100201 | 3300015307 | Miscanthus Phyllosphere | MGLAMPDRIRLDVDIINMRFDYLDTDTVSDVEYLDSDTD |
| Ga0182140_11115761 | 3300015314 | Miscanthus Phyllosphere | IRLDIDIINMRFEYSDTDTVSDIEYPDSDTDGSKHL* |
| Ga0182129_10018273 | 3300015323 | Miscanthus Phyllosphere | MPDRIRLDFNIINMRFEYSDMDTVLDVEYPDSDTDRSEPL |
| Ga0182129_10948191 | 3300015323 | Miscanthus Phyllosphere | DRIRLGIDIINIRFEYLDTDTVSDVEYLDSDTDRFEPL* |
| Ga0182129_11060071 | 3300015323 | Miscanthus Phyllosphere | MSDMIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDR |
| Ga0182187_11499691 | 3300015341 | Miscanthus Phyllosphere | MSDRIRLDIDIINMRFEYSDMDTVLDIGYPDSNTNRSQLL* |
| Ga0182109_10476951 | 3300015342 | Miscanthus Phyllosphere | MPDRIRLDVDIINMRFEYLDTDTVSDVEYPDSDTDRSEPL* |
| Ga0182155_10189342 | 3300015343 | Miscanthus Phyllosphere | RIVSTMSDRIRLNIDIINMRFEYLDTDTVSDVRYSDSDTDRSQLL* |
| Ga0182155_10199071 | 3300015343 | Miscanthus Phyllosphere | MSAMSDRIRLGIDIISIQFEYSDMDTVSDVEYSDSDTDIF |
| Ga0182155_11167413 | 3300015343 | Miscanthus Phyllosphere | VDIVNMRFEYSDTDTDTDIVSNVEYPNSDTNRSKPL* |
| Ga0182155_11306771 | 3300015343 | Miscanthus Phyllosphere | MPDRIRLDIDIINM*FEYSDTDTVLDVEYLDSDTD |
| Ga0182189_10274221 | 3300015344 | Miscanthus Phyllosphere | DRIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDIFQPL* |
| Ga0182189_11464061 | 3300015344 | Miscanthus Phyllosphere | MWLVSTMPDMIRFDIDIINMRLEYSDTDTDTVSDIEYPDSDMDRYQPL* |
| Ga0182111_10580262 | 3300015345 | Miscanthus Phyllosphere | RIRFDVDIINMRFEFSDTDTVSNVEYPDSDTDRSKPL* |
| Ga0182111_11286292 | 3300015345 | Miscanthus Phyllosphere | LDVDIINMRFKYSDTDTVSAIEYPDSDMDRSELL* |
| Ga0182111_11493151 | 3300015345 | Miscanthus Phyllosphere | ILLGIDITNMRFEYSNTDTISDVKYPDSDTNRSEPL* |
| Ga0182139_10286292 | 3300015346 | Miscanthus Phyllosphere | SDRIRLDIDIINMRFEYSDTDTVSDVGYPDLDTDRSQPL* |
| Ga0182139_10477971 | 3300015346 | Miscanthus Phyllosphere | DRIRLDIDIINIQFEYSDTDTVSDIGYPDSDTDRSQPL* |
| Ga0182139_10499292 | 3300015346 | Miscanthus Phyllosphere | MPDRIRLGIDIINIRFEYSDMDTVLDVEYLDSDTDRFEPL |
| Ga0182177_10796521 | 3300015347 | Miscanthus Phyllosphere | LNIDIINIQFKYSNTNMVSDIEYPDSDTDISKPL* |
| Ga0182177_11188922 | 3300015347 | Miscanthus Phyllosphere | LDIDIINMRFEYSDTDTVSDVRYPDSDMDRSQPL* |
| Ga0182177_12322381 | 3300015347 | Miscanthus Phyllosphere | IRLDIDIINMRFEYSDTDTVSDVGYLDSNTNRSQPL* |
| Ga0182161_10002901 | 3300015351 | Miscanthus Phyllosphere | IRVDINIINTRFKYSDMDTISDVEYPDSNTNRFESL* |
| Ga0182161_10284642 | 3300015351 | Miscanthus Phyllosphere | DMIRLDIGIINIRFEYLDTDTVSDVGYPDSDTDRSQSL* |
| Ga0182161_10567412 | 3300015351 | Miscanthus Phyllosphere | DRIQLDIDIINMRFEYSDMDTVSDVEYPDSNTDGSKPL* |
| Ga0182161_10692851 | 3300015351 | Miscanthus Phyllosphere | LDIDIINMRFEYSDTDTVSDVGYLDLDTDRSQLL* |
| Ga0182161_10816911 | 3300015351 | Miscanthus Phyllosphere | TMSDRIRLDIDIINMRLEYSDTDMVSNIGYPDSDMDRSQPL* |
| Ga0182161_10857471 | 3300015351 | Miscanthus Phyllosphere | MSDMIRLDIDIINMRFEYSDTDTDTVSDVEYPDSDTDIFKPL* |
| Ga0182161_11753731 | 3300015351 | Miscanthus Phyllosphere | IRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSKPL* |
| Ga0182161_12300611 | 3300015351 | Miscanthus Phyllosphere | AIPDMIRLDIDIINMQFEYSDTDMILDVGYPDSDTGRS* |
| Ga0182161_12558201 | 3300015351 | Miscanthus Phyllosphere | STMSDMIRLDIDIISMQFEYSDTDTVSDVGYPDLDTDRSQPL* |
| Ga0182159_10030551 | 3300015355 | Miscanthus Phyllosphere | MTDTIRLDIDIVNMRFDYSDTDTVSDVEYPDSDTDIFELL* |
| Ga0182159_10305371 | 3300015355 | Miscanthus Phyllosphere | MSNRIRLDIYISIMRFKYSDTDTVSDIKYLDSDTDKSE |
| Ga0182159_10573911 | 3300015355 | Miscanthus Phyllosphere | RLDIDIINMRFEYSDTDTVSDVEYPDSDTDISELL* |
| Ga0182159_11475511 | 3300015355 | Miscanthus Phyllosphere | IRLDIDIINMRFEYSDMDTVSDVEYPDSDTDRSQPL* |
| Ga0182159_11879951 | 3300015355 | Miscanthus Phyllosphere | MSDRIRLDIDIINMRFEYSDTDTVSDVGYPDLDTDR |
| Ga0182159_13472251 | 3300015355 | Miscanthus Phyllosphere | GIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL* |
| Ga0182145_10384001 | 3300015361 | Miscanthus Phyllosphere | DRIRLDINIINM*FEYSDTDTVSDIEYSDSDTDRSEPL* |
| Ga0182145_11407323 | 3300015361 | Miscanthus Phyllosphere | SDMIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSKPL* |
| Ga0182145_11505201 | 3300015361 | Miscanthus Phyllosphere | I*LDIDILNMQFEYSDTDMASDVEYPDSDTDIFGPF* |
| Ga0182145_11821211 | 3300015361 | Miscanthus Phyllosphere | LDIDIINI*FEYSNTDTVSDVEYPDLDTDRSEPL* |
| Ga0182203_10050172 | 3300017404 | Miscanthus Phyllosphere | MSDRIRLDINVMNMRFEYSDMDTVSDVEYPDSDTD |
| Ga0182203_10438841 | 3300017404 | Miscanthus Phyllosphere | STMSDRIRLDIDIINMRFEYSDMDTVSNVGYPDSDTDRSQSL |
| Ga0182203_10691172 | 3300017404 | Miscanthus Phyllosphere | IRLDIDIINMRFEYLDTDTVSDVGYPDSDTDRSQLL |
| Ga0182220_10052421 | 3300017407 | Miscanthus Phyllosphere | MLTVLDRILLDINIINMRFEYSDTDTVSDVEYPDSDTDKFKPL |
| Ga0182220_10775611 | 3300017407 | Miscanthus Phyllosphere | RIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL |
| Ga0182207_10039441 | 3300017410 | Miscanthus Phyllosphere | RLNIDIMNMRFEYSDTDMVSNVEYPDSDTDRSKPLRIRSQIRS |
| Ga0182207_10705241 | 3300017410 | Miscanthus Phyllosphere | MSDRIRLDIDIMNMRFEYSDMDTVSDVEYPDSDTDRS |
| Ga0182207_10709192 | 3300017410 | Miscanthus Phyllosphere | VSTMSDMIRLDIDIINMRFEYLDTDTVSDVGYPDSD |
| Ga0182207_11212891 | 3300017410 | Miscanthus Phyllosphere | MGLAMPDRIRLDVDIINMRFEYLDTDTVSDVEYPDSDMNRSEHL |
| Ga0182207_11401681 | 3300017410 | Miscanthus Phyllosphere | IRLDIDIINMRFEYSNTDTVSDVGYPDSDTDRSQPL |
| Ga0182207_11504621 | 3300017410 | Miscanthus Phyllosphere | DRIRFDVDIINMRFQYSDTDTVLYVEYPDSDTDRSEPL |
| Ga0182208_10136362 | 3300017411 | Miscanthus Phyllosphere | MSDRIRLDIDIISMRFEYSDMDMVSDVGYLDLDIDRSQPL |
| Ga0182208_10657511 | 3300017411 | Miscanthus Phyllosphere | IRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL |
| Ga0182222_10293592 | 3300017413 | Miscanthus Phyllosphere | MGLAMPDRIRLDVDFINMXFEYLDTDTVSDVEYPDSDTDRSEHL |
| Ga0182228_11047342 | 3300017420 | Miscanthus Phyllosphere | SDMIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL |
| Ga0182219_10994931 | 3300017424 | Miscanthus Phyllosphere | TMSNMIRLDIDIINMRFEYSDTDTVSDVRYPELDMDRSQQL |
| Ga0182224_10583271 | 3300017425 | Miscanthus Phyllosphere | SDRIRLDIDIINMRFEYSDTDTVSDVGYLDSDTDRSQPL |
| Ga0182190_10030501 | 3300017427 | Miscanthus Phyllosphere | RIRLDIDIINMRFEYSDTDTVSDVGYSDSDTDRSQLL |
| Ga0182190_10913731 | 3300017427 | Miscanthus Phyllosphere | IVSTMSDRIRLDIDIINMRFEYSDMDTVSNVGYPDSDTDRSQSL |
| Ga0182190_11052251 | 3300017427 | Miscanthus Phyllosphere | MPDRIRLDVDIINMRFDYLDTDTVSDVEYLDSDTDRSEHL |
| Ga0182190_11344741 | 3300017427 | Miscanthus Phyllosphere | IRLDIDIINMRFEYSDTDTVSDVRYPDSDTDRSQPL |
| Ga0182192_10702461 | 3300017430 | Miscanthus Phyllosphere | TDRIRLDIDIINMRFDYSHTDTVSDVEYPDSDMDISEL |
| Ga0182209_10480371 | 3300017436 | Miscanthus Phyllosphere | MSDMIRLDIDIINMQFEYSDTDTVSDVGYPDSDTDRSRPL |
| Ga0182209_11193881 | 3300017436 | Miscanthus Phyllosphere | RMGLAMPDRIRLDVDIINMRFKYLDTDTVSDVEYPDSDMNRSEHL |
| Ga0182209_11193882 | 3300017436 | Miscanthus Phyllosphere | MPDRIRLDVDIINMRFEYLDTDTVSDVEYPDSDMN |
| Ga0182191_10383942 | 3300017438 | Miscanthus Phyllosphere | MSDRICVNINIINMRFEYSVIDTVSDVEYPDSDMDRSEPL |
| Ga0182191_10859141 | 3300017438 | Miscanthus Phyllosphere | IRLDIDIINMRFDYSDTDTVSDIEYPDSDTDISELH |
| Ga0182221_10102191 | 3300017442 | Miscanthus Phyllosphere | LDRIXLGIDIINMQFEYSDTVTVSDVEYPDSNTDGFEPL |
| Ga0182221_10604211 | 3300017442 | Miscanthus Phyllosphere | STMPDMIRLDIDIINMRFEYSDTDAVLDVGYPDSDTDRSQPL |
| Ga0182221_11680831 | 3300017442 | Miscanthus Phyllosphere | IRLDIDIINMRFEYSDTDTVSDVEYPDSDTNRSKPL |
| Ga0182193_10813072 | 3300017443 | Miscanthus Phyllosphere | STMPDRIRLDISIINMRFEYSDTVSDVEYPDSDTGRSKPL |
| Ga0182193_11075551 | 3300017443 | Miscanthus Phyllosphere | IRLDIDIINMRFEYSDTDTDTVSDVGYPDSDTDISQPL |
| Ga0182193_11400222 | 3300017443 | Miscanthus Phyllosphere | DRIRLDIDIINMRFEYLDTDTVSDVGYPDSDTDRSQPL |
| Ga0182193_11658142 | 3300017443 | Miscanthus Phyllosphere | MIRLDIDIINMRFEYSDTDTVPDVGYPDSDMDRSLPL |
| Ga0182218_10183961 | 3300017683 | Miscanthus Phyllosphere | VSTMSDRIRLDIDSINMRFEYSDMDTISDVGYPNSDTDRSQPL |
| Ga0182218_11100341 | 3300017683 | Miscanthus Phyllosphere | TMSDRIRLDIDIINMRFEYSDMDTVSDVGYPDSDTDRSQPL |
| Ga0182225_10446521 | 3300017684 | Miscanthus Phyllosphere | MPDMIRLDIDIINMRFEYSDTDTVSDVEYLDSDKDESKPL |
| Ga0182225_11263681 | 3300017684 | Miscanthus Phyllosphere | STMSERLRFDINILNIRLEYSDTDTVSDVEYPDSDTDRFEPL |
| Ga0182227_10484111 | 3300017685 | Miscanthus Phyllosphere | DRIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL |
| Ga0182227_10556542 | 3300017685 | Miscanthus Phyllosphere | DRIRLDVDIINMRFEYSDTDTVSDVEYPDSDTDRSEPL |
| Ga0182205_11087181 | 3300017686 | Miscanthus Phyllosphere | RLDIDIINIRFEYLDMDTVSNVEYPDSDTNRSKPI |
| Ga0182223_10131151 | 3300017690 | Miscanthus Phyllosphere | MIRLDVDIINIRFNYLDMDTISDVENPDSDTNRSE |
| Ga0207675_1008873431 | 3300026118 | Switchgrass Rhizosphere | AMPDRIRLDVDIINMRFEYVDTDTVSDVEYPDSDTDRSEHL |
| ⦗Top⦘ |