Metagenome Family F066309

Overview

Basic Information

• Family ID: F066309
• Family Type: Metagenome
• Number of Sequences: 126
• Average Sequence Length: 39 residues
• Representative Sequence: DRIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL
• Number of Associated Samples: 55
• Number of Associated Scaffolds: 125

Quality Assessment

• Transcriptomic Evidence: No
• Most common taxonomic group: Unclassified
• % of genes with valid RBS motifs: 30.70 %
• % of genes near scaffold ends (potentially truncated): 76.98 %
• % of genes from short scaffolds (< 2000 bps): 85.71 %
• Associated GOLD sequencing projects: 55
• AlphaFold2 3D model prediction: Yes
• 3D model pTM-score: 0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Most Common Taxonomy

• Group: Unclassified (83.333 % of family members)
• NCBI Taxonomy ID: N/A
• Taxonomy: N/A

Most Common Ecosystem

• GOLD Ecosystem: Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (93.651 % of family members)
• Environment Ontology (ENVO): Unclassified (99.206 % of family members)
• Earth Microbiome Project Ontology (EMPO): Host-associated → Plant → Plant surface (93.651 % of family members)

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure

• Classification: Globular
• Signal Peptide: No
• Secondary Structure distribution:
  α-helix: 36.36%
  β-sheet: 0.00%
  Coil/Unstructured: 63.64%

Predicted 3D Structure

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 125 Family Scaffolds
PF04827	Plant_tran	0.80
PF05970	PIF1	0.80
PF00067	p450	0.80
PF16486	ArgoN	0.80

Neighboring Clusters of Orthologous Genes (COGs)

COG ID	Name	Functional Category	% Frequency in 125 Family Scaffolds
COG0507	ATPase/5’-3’ helicase helicase subunit RecD of the DNA repair enzyme RecBCD (exonuclease V)	Replication, recombination and repair [L]	0.80
COG2124	Cytochrome P450	Defense mechanisms [V]	0.80

Phylogeny

NCBI Taxonomy

Level 1

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
All Organisms	root	All Organisms	16.67 %

Level 2

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
cellular organisms	root	All Organisms → cellular organisms	16.67 %

Level 3

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	16.67 %

Level 4

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	16.67 %

Level 5

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	16.67 %

Level 6

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	16.67 %

Level 7

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	16.67 %

Level 8

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	13.49 %

Level 9

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	13.49 %

Level 10

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	13.49 %

Level 11

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	13.49 %

Level 12

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	13.49 %

Level 13

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	13.49 %

Level 14

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	13.49 %

Level 15

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	13.49 %

Level 16

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	12.70 %
Zingiberales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales	0.79 %

Level 17

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	12.70 %
Musaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae	0.79 %

Level 18

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	7.14 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	1.59 %
Ensete	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete	0.79 %

Level 19

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	7.14 %
Pooideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae	0.79 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.79 %
Ensete ventricosum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	0.79 %

Level 20

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	5.56 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	1.59 %
Triticodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae	0.79 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.79 %
Ensete ventricosum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	0.79 %

Level 21

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	5.56 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	1.59 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.79 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.79 %
Ensete ventricosum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	0.79 %

Level 22

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Sorghinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae	3.97 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	1.59 %
Saccharinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae	0.79 %
Triticinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae	0.79 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.79 %
Ensete ventricosum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	0.79 %

Level 23

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Sorghum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum	3.97 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	1.59 %
Miscanthus	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus	0.79 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.79 %
Aegilops	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops	0.79 %
Ensete ventricosum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	0.79 %

Level 24

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	3.97 %
Setaria italica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	1.59 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.79 %
Aegilops tauschii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii	0.79 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.79 %
Ensete ventricosum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	0.79 %

Level 25

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	83.33 %
Sorghum bicolor	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	3.97 %
Setaria italica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	1.59 %
Aegilops tauschii subsp. strangulata	subspecies	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata	0.79 %
Miscanthus lutarioriparius	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	0.79 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.79 %
Ensete ventricosum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	0.79 %

Associated Scaffolds

Scaffold	Taxonomy	Length
3300014486|Ga0182004_10006967	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	9217
3300014486|Ga0182004_10007685	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Aegilops → Aegilops tauschii → Aegilops tauschii subsp. strangulata	8771
3300014486|Ga0182004_10021826	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	4768
3300014486|Ga0182004_10025409	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	4268
3300015265|Ga0182005_1226973	Not Available	570
3300015267|Ga0182122_1016049	Not Available	757
3300015268|Ga0182154_1030270	Not Available	645
3300015268|Ga0182154_1040977	Not Available	595
3300015268|Ga0182154_1052552	Not Available	554
3300015269|Ga0182113_1001469	Not Available	1676
3300015275|Ga0182172_1033660	Not Available	638
3300015277|Ga0182128_1051498	Not Available	572
3300015277|Ga0182128_1069240	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	524
3300015281|Ga0182160_1041292	Not Available	618
3300015283|Ga0182156_1040687	Not Available	631
3300015285|Ga0182186_1008197	Not Available	972
3300015285|Ga0182186_1028378	Not Available	686
3300015285|Ga0182186_1074687	Not Available	520
3300015287|Ga0182171_1066685	Not Available	548
3300015287|Ga0182171_1076382	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	526
3300015287|Ga0182171_1080661	Not Available	517
3300015288|Ga0182173_1013004	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	850
3300015291|Ga0182125_1063234	Not Available	568
3300015291|Ga0182125_1080273	Not Available	529
3300015294|Ga0182126_1036326	Not Available	670
3300015294|Ga0182126_1044467	Not Available	632
3300015294|Ga0182126_1087351	Not Available	518
3300015295|Ga0182175_1009770	Not Available	973
3300015299|Ga0182107_1042358	Not Available	661
3300015302|Ga0182143_1037300	Not Available	684
3300015303|Ga0182123_1005538	Not Available	1110
3300015303|Ga0182123_1045923	Not Available	628
3300015303|Ga0182123_1056484	Not Available	593
3300015303|Ga0182123_1064536	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Zingiberales → Musaceae → Ensete → Ensete ventricosum	571
3300015304|Ga0182112_1021069	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	805
3300015304|Ga0182112_1055332	Not Available	612
3300015305|Ga0182158_1014130	Not Available	893
3300015307|Ga0182144_1012617	Not Available	939
3300015307|Ga0182144_1110020	Not Available	500
3300015323|Ga0182129_1001827	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Miscanthus → Miscanthus lutarioriparius	1617
3300015323|Ga0182129_1094819	Not Available	535
3300015323|Ga0182129_1106007	Not Available	517
3300015341|Ga0182187_1149969	Not Available	559
3300015342|Ga0182109_1047695	Not Available	884
3300015343|Ga0182155_1018934	Not Available	1165
3300015343|Ga0182155_1019907	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	1148
3300015343|Ga0182155_1116741	Not Available	641
3300015343|Ga0182155_1130677	Not Available	615
3300015344|Ga0182189_1027422	Not Available	1065
3300015344|Ga0182189_1146406	Not Available	597
3300015345|Ga0182111_1058026	Not Available	862
3300015345|Ga0182111_1128629	Not Available	645
3300015346|Ga0182139_1028629	Not Available	1099
3300015346|Ga0182139_1047797	Not Available	924
3300015346|Ga0182139_1049929	Not Available	911
3300015347|Ga0182177_1118892	Not Available	667
3300015347|Ga0182177_1232238	Not Available	516
3300015351|Ga0182161_1000290	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	3943
3300015351|Ga0182161_1028464	Not Available	1168
3300015351|Ga0182161_1056741	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	917
3300015351|Ga0182161_1069285	Not Available	851
3300015351|Ga0182161_1081691	Not Available	800
3300015351|Ga0182161_1085747	Not Available	785
3300015351|Ga0182161_1175373	Not Available	596
3300015351|Ga0182161_1230061	Not Available	534
3300015351|Ga0182161_1255820	Not Available	511
3300015355|Ga0182159_1003055	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	2706
3300015355|Ga0182159_1147551	Not Available	731
3300015355|Ga0182159_1187995	Not Available	660
3300015355|Ga0182159_1347225	Not Available	505
3300015361|Ga0182145_1038400	Not Available	857
3300015361|Ga0182145_1140732	Not Available	561
3300015361|Ga0182145_1182121	Not Available	514
3300017404|Ga0182203_1005017	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	1420
3300017404|Ga0182203_1043884	Not Available	766
3300017404|Ga0182203_1069117	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	666
3300017407|Ga0182220_1005242	Not Available	1134
3300017407|Ga0182220_1077561	Not Available	554
3300017410|Ga0182207_1003944	Not Available	1592
3300017410|Ga0182207_1070524	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Sorghinae → Sorghum → Sorghum bicolor	684
3300017410|Ga0182207_1070919	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	682
3300017410|Ga0182207_1121289	Not Available	572
3300017410|Ga0182207_1140168	Not Available	544
3300017410|Ga0182207_1150462	Not Available	531
3300017411|Ga0182208_1013636	Not Available	984
3300017411|Ga0182208_1065751	Not Available	622
3300017413|Ga0182222_1029359	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	705
3300017420|Ga0182228_1104734	Not Available	543
3300017424|Ga0182219_1099493	Not Available	561
3300017425|Ga0182224_1058327	Not Available	700
3300017427|Ga0182190_1003050	Not Available	1798
3300017427|Ga0182190_1091373	Not Available	617
3300017427|Ga0182190_1105225	Not Available	587
3300017427|Ga0182190_1134474	Not Available	540
3300017430|Ga0182192_1070246	Not Available	687
3300017436|Ga0182209_1048037	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	757
3300017436|Ga0182209_1119388	Not Available	569
3300017436|Ga0182209_1119388	Not Available	569
3300017438|Ga0182191_1038394	Not Available	841
3300017442|Ga0182221_1010219	Not Available	1172
3300017442|Ga0182221_1060421	Not Available	693
3300017442|Ga0182221_1168083	Not Available	504
3300017443|Ga0182193_1081307	Not Available	681
3300017443|Ga0182193_1140022	Not Available	567
3300017443|Ga0182193_1165814	Not Available	534
3300017683|Ga0182218_1018396	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	946
3300017683|Ga0182218_1110034	Not Available	558
3300017684|Ga0182225_1044652	Not Available	723
3300017684|Ga0182225_1126368	Not Available	524
3300017685|Ga0182227_1048411	Not Available	753
3300017685|Ga0182227_1055654	Not Available	710
3300017686|Ga0182205_1108718	Not Available	587
3300017690|Ga0182223_1013115	Not Available	924
3300026118|Ga0207675_100887343	Not Available	908

Environmental Properties

Associated Habitat Types

Ecosystem

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Class

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Category

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	93.65%
Roots	Host-Associated → Plants → Roots	4.76%
Rhizoplane	Host-Associated → Plants → Rhizoplane	0.79%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.79%

Type

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	93.65%
Unclassified	Host-Associated → Plants → Roots → Unclassified	4.76%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	0.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.79%

Subtype

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	93.65%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	4.76%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	0.79%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.79%

Habitat

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	93.65%
Root	Host-Associated → Plants → Roots → Unclassified → Unclassified → Root	4.76%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.79%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.79%

Associated Samples

Taxon OID	Sample Name	Habitat Type
3300014486	Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG	Host-Associated
3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Host-Associated
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated
3300015281	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12JUL2016_LD1 MG	Host-Associated
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated
3300015303	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_31MAY2016_LD1 MG	Host-Associated
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0182004_100069673	3300014486	Root	MLDNIRLDVDIINIQFKYSDVNTVSDVGYSDSDTDRSKPL*
Ga0182004_100076856	3300014486	Root	MPNRTRLDIDIINMLFEYSNMDTVSDVVYLNLDMDGSKPL*
Ga0182004_100187011	3300014486	Root	MSTILDMIQLDIDIINIRFEYINTNTTSDVEYPDSDMIGFEHF*
Ga0182004_100218262	3300014486	Root	MSDKIELNINIINIRFKYSDTDTVSYVEYSDSDTDIYKSL*
Ga0182004_100254096	3300014486	Root	RLDVDIINIRFKYSDTDTVSDVGYSDSDTDRFEPL*
Ga0182004_100534891	3300014486	Root	MAINIRDENGSHRIRLDVDIIYIRFKNLDMDTVSDVGYSDLDTDRSEPL*
Ga0182005_12269731	3300015265	Rhizosphere	*LDVDITNI*FKYSNMNTVSDVEYSDSDTDRSKPF*
Ga0182122_10160491	3300015267	Miscanthus Phyllosphere	MGLAMPDRIRLDVDIINM*FEYSDTDTVSDVEYPDSDTD
Ga0182154_10302701	3300015268	Miscanthus Phyllosphere	DRVRLNIDIINIRLKYLDMDTVSDIEYLDSDTDRSEPF*
Ga0182154_10409771	3300015268	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQLL*
Ga0182154_10525521	3300015268	Miscanthus Phyllosphere	MTDRIGLDIDIINMRFDYSDTDTVSDVEYPDSDTDRFELL*
Ga0182113_10014691	3300015269	Miscanthus Phyllosphere	MGLAMPDRIRLDVDIINMRFEYLDTDTVSDVEYPDS
Ga0182172_10336601	3300015275	Miscanthus Phyllosphere	DMIRLDIDIINMRFEFSNTDMVPDVEYPDSDMDRSQPL*
Ga0182128_10514981	3300015277	Miscanthus Phyllosphere	IRLDIDVINMRFEYSDTDTVSDVGYPDSDTDRSQPL*
Ga0182128_10692401	3300015277	Miscanthus Phyllosphere	RLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPF*
Ga0182160_10412921	3300015281	Miscanthus Phyllosphere	MSDRIRLDIDIINMRFEYSHMDTVSDVGYPDSDTDRSQP
Ga0182156_10406871	3300015283	Miscanthus Phyllosphere	MLDRI*LDIDIINMQFEYSDMDTVSDVGYPDSDTDRSQPL
Ga0182186_10081971	3300015285	Miscanthus Phyllosphere	MPDMIRLDIDIINMRFEYSDTDSISDVGYPDSDTDRSQP
Ga0182186_10283782	3300015285	Miscanthus Phyllosphere	LDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL*
Ga0182186_10746871	3300015285	Miscanthus Phyllosphere	VSAMSDRIRLDIDIINMRFEDSDMNTVLDVEYVNSDADGSEPL*
Ga0182171_10666851	3300015287	Miscanthus Phyllosphere	RLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL*
Ga0182171_10763821	3300015287	Miscanthus Phyllosphere	TMSDMIRLDIDIINMRFEYLDTDTVSDVGYPNLNMDRSQPF*
Ga0182171_10806611	3300015287	Miscanthus Phyllosphere	MPDRIRLDIDIINMRFEYTDMDIVSDVEYPDSDMSR
Ga0182173_10130041	3300015288	Miscanthus Phyllosphere	MSDMIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQP
Ga0182125_10632341	3300015291	Miscanthus Phyllosphere	DRIRLDVDIINVIIGYGFEYSDMDTVSDVGYLDSDTDRSQPL*
Ga0182125_10802731	3300015291	Miscanthus Phyllosphere	MSAIPDRIRFDVDIINMRFEFLDTDTVSNVEYPDSDTVRSQPQ*
Ga0182126_10363262	3300015294	Miscanthus Phyllosphere	MSDMIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDISQPL*
Ga0182126_10444672	3300015294	Miscanthus Phyllosphere	VSTMPYMIRLDIDIVNIRFDYSDTDTVSDVEYLDSGTDKSELL*
Ga0182126_10873511	3300015294	Miscanthus Phyllosphere	MSDRIRLYIDIINIRFEYSDTDTVSDVGYPDSDTDRSQ
Ga0182175_10097702	3300015295	Miscanthus Phyllosphere	LDVDIINMRFEYSDTDTVSDVEYADSDTDRSEPL*
Ga0182157_10255712	3300015296	Miscanthus Phyllosphere	I*LDIDIINMRFDYSDTVSDVEYPDSDTDIFELL*
Ga0182106_11013641	3300015298	Miscanthus Phyllosphere	MLDRIRLDIDIINMLFEYSDTDKVSDVEYPDSDTDISKPL*
Ga0182107_10423581	3300015299	Miscanthus Phyllosphere	MGLAMPDRIRLDVDIINMRFDYLDTDTVSDVEYLDSDTDRSEHL*
Ga0182143_10373001	3300015302	Miscanthus Phyllosphere	THRIQLDINIINMRFEYSDTDTVSDVEYPDSNMNRSEPL*
Ga0182123_10055383	3300015303	Miscanthus Phyllosphere	VSTMSDRIRFGIDIINMRFEYSDTDTVLDIEYLDSDMDIS*
Ga0182123_10459231	3300015303	Miscanthus Phyllosphere	AMPDRIRLGIDIINMRFEYSDTDTVSDVEYPDSDTDRFEPL*
Ga0182123_10564841	3300015303	Miscanthus Phyllosphere	TMPDRIRLDIDIINMLFEYSDTDKVSDVEYPDSDMDRSEPL*
Ga0182123_10645362	3300015303	Miscanthus Phyllosphere	RIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQLL*
Ga0182112_10210691	3300015304	Miscanthus Phyllosphere	MSDRIRLDIDIINMRFEYSDTDTDTVSDVGYPDSD
Ga0182112_10553321	3300015304	Miscanthus Phyllosphere	MPDRIRLDIDIINM*FKYLDTDTMSDVEYPDSDMDRSEPL
Ga0182158_10141301	3300015305	Miscanthus Phyllosphere	SDRIRLDINIINMRFEYSDTDTVLDVGYPDSDTDISQPL*
Ga0182144_10126171	3300015307	Miscanthus Phyllosphere	MSDMIRLDINIINIRFEYSDTDTVSDVGYPDSDTN
Ga0182144_11100201	3300015307	Miscanthus Phyllosphere	MGLAMPDRIRLDVDIINMRFDYLDTDTVSDVEYLDSDTD
Ga0182140_11115761	3300015314	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTVSDIEYPDSDTDGSKHL*
Ga0182129_10018273	3300015323	Miscanthus Phyllosphere	MPDRIRLDFNIINMRFEYSDMDTVLDVEYPDSDTDRSEPL
Ga0182129_10948191	3300015323	Miscanthus Phyllosphere	DRIRLGIDIINIRFEYLDTDTVSDVEYLDSDTDRFEPL*
Ga0182129_11060071	3300015323	Miscanthus Phyllosphere	MSDMIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDR
Ga0182187_11499691	3300015341	Miscanthus Phyllosphere	MSDRIRLDIDIINMRFEYSDMDTVLDIGYPDSNTNRSQLL*
Ga0182109_10476951	3300015342	Miscanthus Phyllosphere	MPDRIRLDVDIINMRFEYLDTDTVSDVEYPDSDTDRSEPL*
Ga0182155_10189342	3300015343	Miscanthus Phyllosphere	RIVSTMSDRIRLNIDIINMRFEYLDTDTVSDVRYSDSDTDRSQLL*
Ga0182155_10199071	3300015343	Miscanthus Phyllosphere	MSAMSDRIRLGIDIISIQFEYSDMDTVSDVEYSDSDTDIF
Ga0182155_11167413	3300015343	Miscanthus Phyllosphere	VDIVNMRFEYSDTDTDTDIVSNVEYPNSDTNRSKPL*
Ga0182155_11306771	3300015343	Miscanthus Phyllosphere	MPDRIRLDIDIINM*FEYSDTDTVLDVEYLDSDTD
Ga0182189_10274221	3300015344	Miscanthus Phyllosphere	DRIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDIFQPL*
Ga0182189_11464061	3300015344	Miscanthus Phyllosphere	MWLVSTMPDMIRFDIDIINMRLEYSDTDTDTVSDIEYPDSDMDRYQPL*
Ga0182111_10580262	3300015345	Miscanthus Phyllosphere	RIRFDVDIINMRFEFSDTDTVSNVEYPDSDTDRSKPL*
Ga0182111_11286292	3300015345	Miscanthus Phyllosphere	LDVDIINMRFKYSDTDTVSAIEYPDSDMDRSELL*
Ga0182111_11493151	3300015345	Miscanthus Phyllosphere	ILLGIDITNMRFEYSNTDTISDVKYPDSDTNRSEPL*
Ga0182139_10286292	3300015346	Miscanthus Phyllosphere	SDRIRLDIDIINMRFEYSDTDTVSDVGYPDLDTDRSQPL*
Ga0182139_10477971	3300015346	Miscanthus Phyllosphere	DRIRLDIDIINIQFEYSDTDTVSDIGYPDSDTDRSQPL*
Ga0182139_10499292	3300015346	Miscanthus Phyllosphere	MPDRIRLGIDIINIRFEYSDMDTVLDVEYLDSDTDRFEPL
Ga0182177_10796521	3300015347	Miscanthus Phyllosphere	LNIDIINIQFKYSNTNMVSDIEYPDSDTDISKPL*
Ga0182177_11188922	3300015347	Miscanthus Phyllosphere	LDIDIINMRFEYSDTDTVSDVRYPDSDMDRSQPL*
Ga0182177_12322381	3300015347	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTVSDVGYLDSNTNRSQPL*
Ga0182161_10002901	3300015351	Miscanthus Phyllosphere	IRVDINIINTRFKYSDMDTISDVEYPDSNTNRFESL*
Ga0182161_10284642	3300015351	Miscanthus Phyllosphere	DMIRLDIGIINIRFEYLDTDTVSDVGYPDSDTDRSQSL*
Ga0182161_10567412	3300015351	Miscanthus Phyllosphere	DRIQLDIDIINMRFEYSDMDTVSDVEYPDSNTDGSKPL*
Ga0182161_10692851	3300015351	Miscanthus Phyllosphere	LDIDIINMRFEYSDTDTVSDVGYLDLDTDRSQLL*
Ga0182161_10816911	3300015351	Miscanthus Phyllosphere	TMSDRIRLDIDIINMRLEYSDTDMVSNIGYPDSDMDRSQPL*
Ga0182161_10857471	3300015351	Miscanthus Phyllosphere	MSDMIRLDIDIINMRFEYSDTDTDTVSDVEYPDSDTDIFKPL*
Ga0182161_11753731	3300015351	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSKPL*
Ga0182161_12300611	3300015351	Miscanthus Phyllosphere	AIPDMIRLDIDIINMQFEYSDTDMILDVGYPDSDTGRS*
Ga0182161_12558201	3300015351	Miscanthus Phyllosphere	STMSDMIRLDIDIISMQFEYSDTDTVSDVGYPDLDTDRSQPL*
Ga0182159_10030551	3300015355	Miscanthus Phyllosphere	MTDTIRLDIDIVNMRFDYSDTDTVSDVEYPDSDTDIFELL*
Ga0182159_10305371	3300015355	Miscanthus Phyllosphere	MSNRIRLDIYISIMRFKYSDTDTVSDIKYLDSDTDKSE
Ga0182159_10573911	3300015355	Miscanthus Phyllosphere	RLDIDIINMRFEYSDTDTVSDVEYPDSDTDISELL*
Ga0182159_11475511	3300015355	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDMDTVSDVEYPDSDTDRSQPL*
Ga0182159_11879951	3300015355	Miscanthus Phyllosphere	MSDRIRLDIDIINMRFEYSDTDTVSDVGYPDLDTDR
Ga0182159_13472251	3300015355	Miscanthus Phyllosphere	GIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL*
Ga0182145_10384001	3300015361	Miscanthus Phyllosphere	DRIRLDINIINM*FEYSDTDTVSDIEYSDSDTDRSEPL*
Ga0182145_11407323	3300015361	Miscanthus Phyllosphere	SDMIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSKPL*
Ga0182145_11505201	3300015361	Miscanthus Phyllosphere	I*LDIDILNMQFEYSDTDMASDVEYPDSDTDIFGPF*
Ga0182145_11821211	3300015361	Miscanthus Phyllosphere	LDIDIINI*FEYSNTDTVSDVEYPDLDTDRSEPL*
Ga0182203_10050172	3300017404	Miscanthus Phyllosphere	MSDRIRLDINVMNMRFEYSDMDTVSDVEYPDSDTD
Ga0182203_10438841	3300017404	Miscanthus Phyllosphere	STMSDRIRLDIDIINMRFEYSDMDTVSNVGYPDSDTDRSQSL
Ga0182203_10691172	3300017404	Miscanthus Phyllosphere	IRLDIDIINMRFEYLDTDTVSDVGYPDSDTDRSQLL
Ga0182220_10052421	3300017407	Miscanthus Phyllosphere	MLTVLDRILLDINIINMRFEYSDTDTVSDVEYPDSDTDKFKPL
Ga0182220_10775611	3300017407	Miscanthus Phyllosphere	RIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL
Ga0182207_10039441	3300017410	Miscanthus Phyllosphere	RLNIDIMNMRFEYSDTDMVSNVEYPDSDTDRSKPLRIRSQIRS
Ga0182207_10705241	3300017410	Miscanthus Phyllosphere	MSDRIRLDIDIMNMRFEYSDMDTVSDVEYPDSDTDRS
Ga0182207_10709192	3300017410	Miscanthus Phyllosphere	VSTMSDMIRLDIDIINMRFEYLDTDTVSDVGYPDSD
Ga0182207_11212891	3300017410	Miscanthus Phyllosphere	MGLAMPDRIRLDVDIINMRFEYLDTDTVSDVEYPDSDMNRSEHL
Ga0182207_11401681	3300017410	Miscanthus Phyllosphere	IRLDIDIINMRFEYSNTDTVSDVGYPDSDTDRSQPL
Ga0182207_11504621	3300017410	Miscanthus Phyllosphere	DRIRFDVDIINMRFQYSDTDTVLYVEYPDSDTDRSEPL
Ga0182208_10136362	3300017411	Miscanthus Phyllosphere	MSDRIRLDIDIISMRFEYSDMDMVSDVGYLDLDIDRSQPL
Ga0182208_10657511	3300017411	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL
Ga0182222_10293592	3300017413	Miscanthus Phyllosphere	MGLAMPDRIRLDVDFINMXFEYLDTDTVSDVEYPDSDTDRSEHL
Ga0182228_11047342	3300017420	Miscanthus Phyllosphere	SDMIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL
Ga0182219_10994931	3300017424	Miscanthus Phyllosphere	TMSNMIRLDIDIINMRFEYSDTDTVSDVRYPELDMDRSQQL
Ga0182224_10583271	3300017425	Miscanthus Phyllosphere	SDRIRLDIDIINMRFEYSDTDTVSDVGYLDSDTDRSQPL
Ga0182190_10030501	3300017427	Miscanthus Phyllosphere	RIRLDIDIINMRFEYSDTDTVSDVGYSDSDTDRSQLL
Ga0182190_10913731	3300017427	Miscanthus Phyllosphere	IVSTMSDRIRLDIDIINMRFEYSDMDTVSNVGYPDSDTDRSQSL
Ga0182190_11052251	3300017427	Miscanthus Phyllosphere	MPDRIRLDVDIINMRFDYLDTDTVSDVEYLDSDTDRSEHL
Ga0182190_11344741	3300017427	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTVSDVRYPDSDTDRSQPL
Ga0182192_10702461	3300017430	Miscanthus Phyllosphere	TDRIRLDIDIINMRFDYSHTDTVSDVEYPDSDMDISEL
Ga0182209_10480371	3300017436	Miscanthus Phyllosphere	MSDMIRLDIDIINMQFEYSDTDTVSDVGYPDSDTDRSRPL
Ga0182209_11193881	3300017436	Miscanthus Phyllosphere	RMGLAMPDRIRLDVDIINMRFKYLDTDTVSDVEYPDSDMNRSEHL
Ga0182209_11193882	3300017436	Miscanthus Phyllosphere	MPDRIRLDVDIINMRFEYLDTDTVSDVEYPDSDMN
Ga0182191_10383942	3300017438	Miscanthus Phyllosphere	MSDRICVNINIINMRFEYSVIDTVSDVEYPDSDMDRSEPL
Ga0182191_10859141	3300017438	Miscanthus Phyllosphere	IRLDIDIINMRFDYSDTDTVSDIEYPDSDTDISELH
Ga0182221_10102191	3300017442	Miscanthus Phyllosphere	LDRIXLGIDIINMQFEYSDTVTVSDVEYPDSNTDGFEPL
Ga0182221_10604211	3300017442	Miscanthus Phyllosphere	STMPDMIRLDIDIINMRFEYSDTDAVLDVGYPDSDTDRSQPL
Ga0182221_11680831	3300017442	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTVSDVEYPDSDTNRSKPL
Ga0182193_10813072	3300017443	Miscanthus Phyllosphere	STMPDRIRLDISIINMRFEYSDTVSDVEYPDSDTGRSKPL
Ga0182193_11075551	3300017443	Miscanthus Phyllosphere	IRLDIDIINMRFEYSDTDTDTVSDVGYPDSDTDISQPL
Ga0182193_11400222	3300017443	Miscanthus Phyllosphere	DRIRLDIDIINMRFEYLDTDTVSDVGYPDSDTDRSQPL
Ga0182193_11658142	3300017443	Miscanthus Phyllosphere	MIRLDIDIINMRFEYSDTDTVPDVGYPDSDMDRSLPL
Ga0182218_10183961	3300017683	Miscanthus Phyllosphere	VSTMSDRIRLDIDSINMRFEYSDMDTISDVGYPNSDTDRSQPL
Ga0182218_11100341	3300017683	Miscanthus Phyllosphere	TMSDRIRLDIDIINMRFEYSDMDTVSDVGYPDSDTDRSQPL
Ga0182225_10446521	3300017684	Miscanthus Phyllosphere	MPDMIRLDIDIINMRFEYSDTDTVSDVEYLDSDKDESKPL
Ga0182225_11263681	3300017684	Miscanthus Phyllosphere	STMSERLRFDINILNIRLEYSDTDTVSDVEYPDSDTDRFEPL
Ga0182227_10484111	3300017685	Miscanthus Phyllosphere	DRIRLDIDIINMRFEYSDTDTVSDVGYPDSDTDRSQPL
Ga0182227_10556542	3300017685	Miscanthus Phyllosphere	DRIRLDVDIINMRFEYSDTDTVSDVEYPDSDTDRSEPL
Ga0182205_11087181	3300017686	Miscanthus Phyllosphere	RLDIDIINIRFEYLDMDTVSNVEYPDSDTNRSKPI
Ga0182223_10131151	3300017690	Miscanthus Phyllosphere	MIRLDVDIINIRFNYLDMDTISDVENPDSDTNRSE
Ga0207675_1008873431	3300026118	Switchgrass Rhizosphere	AMPDRIRLDVDIINMRFEYVDTDTVSDVEYPDSDTDRSEHL