| Basic Information | |
|---|---|
| Family ID | F066186 |
| Family Type | Metagenome |
| Number of Sequences | 127 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MFASENCSKVGCFLEAALPVIAPAVALVWMLSIVAFSSWAM |
| Number of Associated Samples | 101 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 55.91 % |
| % of genes near scaffold ends (potentially truncated) | 35.43 % |
| % of genes from short scaffolds (< 2000 bps) | 74.02 % |
| Associated GOLD sequencing projects | 95 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.803 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (39.370 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.583 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (40.945 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.72% β-sheet: 0.00% Coil/Unstructured: 49.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF04945 | YHS | 31.50 |
| PF13610 | DDE_Tnp_IS240 | 7.09 |
| PF13417 | GST_N_3 | 3.15 |
| PF00005 | ABC_tran | 3.15 |
| PF04234 | CopC | 2.36 |
| PF07992 | Pyr_redox_2 | 1.57 |
| PF02586 | SRAP | 1.57 |
| PF03466 | LysR_substrate | 1.57 |
| PF08545 | ACP_syn_III | 1.57 |
| PF02518 | HATPase_c | 0.79 |
| PF00536 | SAM_1 | 0.79 |
| PF01048 | PNP_UDP_1 | 0.79 |
| PF06764 | DUF1223 | 0.79 |
| PF03706 | LPG_synthase_TM | 0.79 |
| PF12679 | ABC2_membrane_2 | 0.79 |
| PF00496 | SBP_bac_5 | 0.79 |
| PF03328 | HpcH_HpaI | 0.79 |
| PF01061 | ABC2_membrane | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG2372 | Copper-binding protein CopC (methionine-rich) | Inorganic ion transport and metabolism [P] | 2.36 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 1.57 |
| COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.79 |
| COG0775 | Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB | Nucleotide transport and metabolism [F] | 0.79 |
| COG0813 | Purine-nucleoside phosphorylase | Nucleotide transport and metabolism [F] | 0.79 |
| COG2301 | Citrate lyase beta subunit | Carbohydrate transport and metabolism [G] | 0.79 |
| COG2820 | Uridine phosphorylase | Nucleotide transport and metabolism [F] | 0.79 |
| COG3836 | 2-keto-3-deoxy-L-rhamnonate aldolase RhmA | Carbohydrate transport and metabolism [G] | 0.79 |
| COG5429 | Uncharacterized conserved protein, DUF1223 domain | Function unknown [S] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.80 % |
| Unclassified | root | N/A | 25.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300003351|JGI26346J50198_1027787 | Not Available | 563 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10004336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 4166 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10005907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3730 | Open in IMG/M |
| 3300004092|Ga0062389_102263347 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 716 | Open in IMG/M |
| 3300005332|Ga0066388_101761069 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1099 | Open in IMG/M |
| 3300005434|Ga0070709_10188537 | Not Available | 1453 | Open in IMG/M |
| 3300005439|Ga0070711_100000862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 15948 | Open in IMG/M |
| 3300005451|Ga0066681_10136722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1432 | Open in IMG/M |
| 3300006028|Ga0070717_10469117 | Not Available | 1136 | Open in IMG/M |
| 3300006163|Ga0070715_10348602 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 808 | Open in IMG/M |
| 3300006172|Ga0075018_10828414 | Not Available | 509 | Open in IMG/M |
| 3300006175|Ga0070712_100002686 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 10974 | Open in IMG/M |
| 3300006175|Ga0070712_100044825 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3051 | Open in IMG/M |
| 3300006176|Ga0070765_101154099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300007255|Ga0099791_10069612 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1594 | Open in IMG/M |
| 3300007258|Ga0099793_10212630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 929 | Open in IMG/M |
| 3300007788|Ga0099795_10213409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 819 | Open in IMG/M |
| 3300007788|Ga0099795_10371017 | Not Available | 644 | Open in IMG/M |
| 3300009143|Ga0099792_10008353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 4280 | Open in IMG/M |
| 3300010343|Ga0074044_10100951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1941 | Open in IMG/M |
| 3300010359|Ga0126376_11321898 | Not Available | 742 | Open in IMG/M |
| 3300010376|Ga0126381_101664679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 922 | Open in IMG/M |
| 3300011269|Ga0137392_10498113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1012 | Open in IMG/M |
| 3300012202|Ga0137363_10491776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1030 | Open in IMG/M |
| 3300012203|Ga0137399_10605436 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 921 | Open in IMG/M |
| 3300012362|Ga0137361_10156547 | All Organisms → cellular organisms → Bacteria | 2041 | Open in IMG/M |
| 3300012582|Ga0137358_10199486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1365 | Open in IMG/M |
| 3300012922|Ga0137394_10349194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1263 | Open in IMG/M |
| 3300012922|Ga0137394_11229737 | Not Available | 612 | Open in IMG/M |
| 3300012923|Ga0137359_10085535 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidisphaera → unclassified Acidisphaera → Acidisphaera sp. S103 | 2773 | Open in IMG/M |
| 3300012924|Ga0137413_10457087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 931 | Open in IMG/M |
| 3300012927|Ga0137416_10107690 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2109 | Open in IMG/M |
| 3300016270|Ga0182036_10267342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1287 | Open in IMG/M |
| 3300016371|Ga0182034_10113848 | Not Available | 1967 | Open in IMG/M |
| 3300016445|Ga0182038_10518931 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1019 | Open in IMG/M |
| 3300018433|Ga0066667_10247668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1348 | Open in IMG/M |
| 3300018482|Ga0066669_11627807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
| 3300020579|Ga0210407_10035731 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3696 | Open in IMG/M |
| 3300020580|Ga0210403_10025953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 4670 | Open in IMG/M |
| 3300020580|Ga0210403_10078287 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2660 | Open in IMG/M |
| 3300020580|Ga0210403_10210421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1596 | Open in IMG/M |
| 3300020581|Ga0210399_10049590 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3372 | Open in IMG/M |
| 3300020582|Ga0210395_10934834 | Not Available | 644 | Open in IMG/M |
| 3300020583|Ga0210401_10402768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1231 | Open in IMG/M |
| 3300021168|Ga0210406_10722291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 765 | Open in IMG/M |
| 3300021170|Ga0210400_10894983 | Not Available | 725 | Open in IMG/M |
| 3300021180|Ga0210396_11329868 | Not Available | 597 | Open in IMG/M |
| 3300021405|Ga0210387_10318353 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1371 | Open in IMG/M |
| 3300021478|Ga0210402_11504671 | Not Available | 600 | Open in IMG/M |
| 3300021479|Ga0210410_10559967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1018 | Open in IMG/M |
| 3300024288|Ga0179589_10219479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 837 | Open in IMG/M |
| 3300025905|Ga0207685_10835881 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300026551|Ga0209648_10079679 | All Organisms → cellular organisms → Bacteria | 2737 | Open in IMG/M |
| 3300026551|Ga0209648_10409254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 881 | Open in IMG/M |
| 3300026557|Ga0179587_10321571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1000 | Open in IMG/M |
| 3300027071|Ga0209214_1025477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 771 | Open in IMG/M |
| 3300027071|Ga0209214_1033013 | Not Available | 686 | Open in IMG/M |
| 3300027576|Ga0209003_1074917 | Not Available | 624 | Open in IMG/M |
| 3300027635|Ga0209625_1065444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 813 | Open in IMG/M |
| 3300027698|Ga0209446_1002046 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 4907 | Open in IMG/M |
| 3300027729|Ga0209248_10120198 | Not Available | 789 | Open in IMG/M |
| 3300027737|Ga0209038_10007304 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3264 | Open in IMG/M |
| 3300027783|Ga0209448_10009284 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3127 | Open in IMG/M |
| 3300027783|Ga0209448_10143334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 798 | Open in IMG/M |
| 3300027783|Ga0209448_10279004 | Not Available | 549 | Open in IMG/M |
| 3300027812|Ga0209656_10000361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 30069 | Open in IMG/M |
| 3300027812|Ga0209656_10481641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300027903|Ga0209488_10025024 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4336 | Open in IMG/M |
| 3300027903|Ga0209488_10050196 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3068 | Open in IMG/M |
| 3300027903|Ga0209488_10364216 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1073 | Open in IMG/M |
| 3300028536|Ga0137415_10153686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2137 | Open in IMG/M |
| 3300028536|Ga0137415_11096419 | Not Available | 609 | Open in IMG/M |
| 3300031057|Ga0170834_106018899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2150 | Open in IMG/M |
| 3300031057|Ga0170834_111544719 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 662 | Open in IMG/M |
| 3300031231|Ga0170824_119345695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1022 | Open in IMG/M |
| 3300031543|Ga0318516_10450313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 740 | Open in IMG/M |
| 3300031545|Ga0318541_10225650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1039 | Open in IMG/M |
| 3300031546|Ga0318538_10054662 | All Organisms → cellular organisms → Bacteria | 1963 | Open in IMG/M |
| 3300031572|Ga0318515_10023362 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2945 | Open in IMG/M |
| 3300031572|Ga0318515_10076539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1728 | Open in IMG/M |
| 3300031573|Ga0310915_10020207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 4038 | Open in IMG/M |
| 3300031573|Ga0310915_10290397 | Not Available | 1154 | Open in IMG/M |
| 3300031640|Ga0318555_10336663 | Not Available | 817 | Open in IMG/M |
| 3300031668|Ga0318542_10044624 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1986 | Open in IMG/M |
| 3300031679|Ga0318561_10016942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3312 | Open in IMG/M |
| 3300031680|Ga0318574_10023876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3018 | Open in IMG/M |
| 3300031681|Ga0318572_10201442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1162 | Open in IMG/M |
| 3300031682|Ga0318560_10564811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 616 | Open in IMG/M |
| 3300031682|Ga0318560_10736930 | Not Available | 532 | Open in IMG/M |
| 3300031708|Ga0310686_106612249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2090 | Open in IMG/M |
| 3300031713|Ga0318496_10255932 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 965 | Open in IMG/M |
| 3300031718|Ga0307474_10414537 | Not Available | 1050 | Open in IMG/M |
| 3300031719|Ga0306917_10300141 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1240 | Open in IMG/M |
| 3300031736|Ga0318501_10002714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 5700 | Open in IMG/M |
| 3300031744|Ga0306918_10313695 | Not Available | 1210 | Open in IMG/M |
| 3300031751|Ga0318494_10514893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 698 | Open in IMG/M |
| 3300031753|Ga0307477_10010153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6479 | Open in IMG/M |
| 3300031753|Ga0307477_10085019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2195 | Open in IMG/M |
| 3300031753|Ga0307477_10412082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 925 | Open in IMG/M |
| 3300031764|Ga0318535_10376149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 634 | Open in IMG/M |
| 3300031770|Ga0318521_10373524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 847 | Open in IMG/M |
| 3300031798|Ga0318523_10158792 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1125 | Open in IMG/M |
| 3300031845|Ga0318511_10080710 | Not Available | 1358 | Open in IMG/M |
| 3300031879|Ga0306919_10262154 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1303 | Open in IMG/M |
| 3300031890|Ga0306925_11732224 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 602 | Open in IMG/M |
| 3300031893|Ga0318536_10481969 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 624 | Open in IMG/M |
| 3300031894|Ga0318522_10012721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2583 | Open in IMG/M |
| 3300031894|Ga0318522_10347764 | Not Available | 561 | Open in IMG/M |
| 3300031896|Ga0318551_10337484 | Not Available | 851 | Open in IMG/M |
| 3300031897|Ga0318520_10019891 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3175 | Open in IMG/M |
| 3300031897|Ga0318520_10253376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1051 | Open in IMG/M |
| 3300031910|Ga0306923_10585092 | Not Available | 1254 | Open in IMG/M |
| 3300031946|Ga0310910_10515740 | Not Available | 949 | Open in IMG/M |
| 3300031946|Ga0310910_11539720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 509 | Open in IMG/M |
| 3300031962|Ga0307479_10213964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1899 | Open in IMG/M |
| 3300032039|Ga0318559_10565674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 530 | Open in IMG/M |
| 3300032052|Ga0318506_10235221 | Not Available | 811 | Open in IMG/M |
| 3300032059|Ga0318533_10227531 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1342 | Open in IMG/M |
| 3300032064|Ga0318510_10134673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Rhizobiales bacterium GAS191 | 965 | Open in IMG/M |
| 3300032076|Ga0306924_10081653 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae | 3625 | Open in IMG/M |
| 3300032089|Ga0318525_10361335 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 745 | Open in IMG/M |
| 3300032090|Ga0318518_10443348 | Not Available | 665 | Open in IMG/M |
| 3300032261|Ga0306920_101607099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 924 | Open in IMG/M |
| 3300032261|Ga0306920_102889480 | Not Available | 652 | Open in IMG/M |
| 3300032261|Ga0306920_103864786 | Not Available | 546 | Open in IMG/M |
| 3300033290|Ga0318519_10302002 | Not Available | 937 | Open in IMG/M |
| 3300033290|Ga0318519_10770811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 591 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 39.37% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.32% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.45% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 7.87% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.72% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.15% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.94% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.36% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.57% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.79% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027071 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI26346J50198_10277872 | 3300003351 | Bog Forest Soil | MFASECCSKIGCLLEAALPIVAPAVALVSMLSILTYACC* |
| JGIcombinedJ51221_100043361 | 3300003505 | Forest Soil | MFASESCSKIGCFLEAAMPAIAPAFALIWMLSIAAFSCWAM* |
| JGIcombinedJ51221_100059077 | 3300003505 | Forest Soil | MFASESCSKVGCFLEAALPAIAPAVALVWMLSIAAFSCWEM* |
| Ga0062389_1022633472 | 3300004092 | Bog Forest Soil | MFASESCSKLGCLLEVTLPAIGPAVALFCMLSITAFCCSMM* |
| Ga0066388_1017610691 | 3300005332 | Tropical Forest Soil | MEGKMFATEHCSKVGCFLEAALPGIAPAVALICMLSIAAFASWVM* |
| Ga0070709_101885371 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MEGEMFASESCSKVGCFEAALPAIAPAVALVWMLSIAAFSCW |
| Ga0070711_10000086218 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MEGEMFASESCSKVGCFEAALPAIAPAVALVWMLSIAAFSCWEM* |
| Ga0066681_101367223 | 3300005451 | Soil | MFASESCSKLGCFFEAALPAIAPAVALFWMLSIAAFCCSTM* |
| Ga0070717_104691172 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MFATEHCSKVGCFLEAALPGIAPAVALICMLSIAA |
| Ga0070715_103486022 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MEGKMFATEHCSKVGCFLEAAMPGIAPAVALICMLSIAAFASCVM* |
| Ga0075018_108284142 | 3300006172 | Watersheds | MEGKMFATEHCSKVGCFLEAALPGIAPAVALICMLSIAASVSWVM* |
| Ga0070712_1000026862 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MFASESCSKVGCFEAALPAIAPAVALVWMLSIAAFSCWEM* |
| Ga0070712_1000448258 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MFATEHCSKVGCFLEAALPGIAPAVALICMLSIAAFASWVM* |
| Ga0070765_1011540991 | 3300006176 | Soil | MFASESCSKVGCFLEAAMPAIAPAVALIWMLSIVAFSCWAM* |
| Ga0099791_100696122 | 3300007255 | Vadose Zone Soil | MFARENCSKVGCYLEAALPLIGPAVALIGMLSLVAWS* |
| Ga0099793_102126302 | 3300007258 | Vadose Zone Soil | MKMFASENCSKVGCFLEAALPVIAPAVALVWMLSIVAFSSWAM* |
| Ga0099795_102134092 | 3300007788 | Vadose Zone Soil | MESEMFASESCSKVGCFLEAALPAIAPAVALFWMLSIAVFCCSTM* |
| Ga0099795_103710171 | 3300007788 | Vadose Zone Soil | MEGEMFASESCSKVGCFLEAALPVIAPAVALVWMLSIAAFSCWAM* |
| Ga0099792_100083531 | 3300009143 | Vadose Zone Soil | MESEMFASENCSKVGCFLEAAMPSIAPAVGSIWMLSIAAFLSWAM* |
| Ga0074044_101009513 | 3300010343 | Bog Forest Soil | VRVEESEMFASESCSKVGCFLEGALPVIAPAVALVSMLSILTYACC* |
| Ga0126376_113218981 | 3300010359 | Tropical Forest Soil | MEGKMFATEHCSKVGCFLEAALPDIAPVVALICMLSIAAFASWV |
| Ga0126381_1016646793 | 3300010376 | Tropical Forest Soil | CCVKVGCFLEAALSGIAPAVALICMLSIAAFASWVM* |
| Ga0137392_104981131 | 3300011269 | Vadose Zone Soil | MESEMFASENCSKVGCFLEAAMPSIAPAVGLIWMLSIAAFLSWAM* |
| Ga0137363_104917762 | 3300012202 | Vadose Zone Soil | MFASENCSKVGCFLEAALPVIAPAVALVWMLSIVAFSSWAM* |
| Ga0137399_106054362 | 3300012203 | Vadose Zone Soil | MKMFASENFSKVGCFLEAALPVIAPAVALVWMLSIVAFSSWAM* |
| Ga0137361_101565471 | 3300012362 | Vadose Zone Soil | MKMFASENFSKVGCFLEAALPVIAPAVALVWMLSIVAFSSSAM* |
| Ga0137358_101994861 | 3300012582 | Vadose Zone Soil | MFARENCSKVGCYLEAALPLIAPAVALIGMLSLVA |
| Ga0137394_103491943 | 3300012922 | Vadose Zone Soil | MFARENCSKVGCFLEAALPVIAPSVALVWMLSIAAFSFWAM* |
| Ga0137394_112297371 | 3300012922 | Vadose Zone Soil | MESEMFASENCSKVGCFLEAAMPAIAPAVGLIWMLSIAAFSSWGM* |
| Ga0137359_100855354 | 3300012923 | Vadose Zone Soil | MFARENCSKVDCYLEAALPLIAPAVALIGMLSLVAWS* |
| Ga0137413_104570873 | 3300012924 | Vadose Zone Soil | VRVEESEMFASESCSKVGCFLEGALPVIAPAVALVSMLSIFAFACC* |
| Ga0137416_101076902 | 3300012927 | Vadose Zone Soil | MKMFASENCSKVGCFLEAAMPAIAPAVGLIWMLSIAAFSSWAM* |
| Ga0182036_102673421 | 3300016270 | Soil | FASENCSKLGCFLEAALPGVAPAFALIWMLSFAFTSWVM |
| Ga0182034_101138481 | 3300016371 | Soil | MFASENCTKVGCFLAAALPGIAPAVALIWMLSIAAFSSW |
| Ga0182038_105189311 | 3300016445 | Soil | MFATEHCSKVCCFLEATLPGIAPAVALICKLSIAASVSWV |
| Ga0066667_102476683 | 3300018433 | Grasslands Soil | MESEMFASESCSKIGCFFEAALPAIAPAVALFWMLSIAAFCCSTM |
| Ga0066669_116278071 | 3300018482 | Grasslands Soil | MESEMFASESCSKVGCFFEAALPAIAPAVALFWMLSIAAFCCSTM |
| Ga0210407_100357312 | 3300020579 | Soil | MFATEHCSKVGCFLEAALPGIAPAVALICMLSIAAFASWVM |
| Ga0210403_100259531 | 3300020580 | Soil | MFASESCSKIGCFLEAAMPAIAPAFALIWMLSIAAFSCWAM |
| Ga0210403_100782871 | 3300020580 | Soil | MEGKMFATEHCSKVGCFLEAALPGIAPAVALICMLSIAASVSWVM |
| Ga0210403_102104211 | 3300020580 | Soil | MFARENCSKVGCFLEAALPVIAPSVALVWMLSIAAFSFWAM |
| Ga0210399_100495903 | 3300020581 | Soil | MFASESCSKVGCFLEATLPVIGPAVALVWMLSIVAFSSWAM |
| Ga0210395_109348341 | 3300020582 | Soil | MFATEHCSKVGCFLEAALPGIAPAVALICMLSSAASV |
| Ga0210401_104027683 | 3300020583 | Soil | MESEMFASEYCTKVGCFLEAALPAIAPAVALIWMLSIAALSSWAM |
| Ga0210406_107222912 | 3300021168 | Soil | MEGKMFATEHCSKVGCFLEAALPGIAPAVALICMLSIAAFASWVM |
| Ga0210400_108949832 | 3300021170 | Soil | MFASESCSKVGCFLEAAMPAIAPAVALIWMLSIVAFSCWAM |
| Ga0210396_113298682 | 3300021180 | Soil | MFASERCSKIGCFLEAALPIVAPAVALVSMLSILTYACC |
| Ga0210387_103183532 | 3300021405 | Soil | MMFTRENCSKVGCFLEAALPVIAPSVALVWMLSIAAFSFWAM |
| Ga0210402_115046711 | 3300021478 | Soil | MFASESCSKVGCFLEAAMPAIAPAVALVWMLSIVALSCWAM |
| Ga0210410_105599674 | 3300021479 | Soil | AGSSGQWRMKMFASEGCSKFGCFLEAALPVIAPAVALVWMLSIAAFSSWMM |
| Ga0179589_102194792 | 3300024288 | Vadose Zone Soil | MFASESCSKVGCFLEGALPVIAPAVALVSMLSIFAFACC |
| Ga0207685_108358812 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MEGKMFATEHCSKVGCFLEAAMPGIAPAVALICMLSIAAFASWVM |
| Ga0209648_100796794 | 3300026551 | Grasslands Soil | MFANERCSKIGCFLEGALPVIAPAVALVSMLSIFAFACC |
| Ga0209648_104092542 | 3300026551 | Grasslands Soil | MKMFASENCSKVGCFLEAALPVIAPAVGLVWMLSIAAFSSWAM |
| Ga0179587_103215712 | 3300026557 | Vadose Zone Soil | MFARENCSKVGCYLEAALPLIGPAVALIGMLSLVAWS |
| Ga0209214_10254772 | 3300027071 | Forest Soil | KMFATEHCSKVGCFLEAALPGIAPAVALICMLSIAAFASWVM |
| Ga0209214_10330132 | 3300027071 | Forest Soil | MESEMFASESCSKIGCFLEAAMPAIAPAVALISMLSIVAFSCWAM |
| Ga0209003_10749172 | 3300027576 | Forest Soil | MSTSENCSKVGCFLEGALPIIAPTVALVWMLSIAAFSYWAM |
| Ga0209625_10654441 | 3300027635 | Forest Soil | MESEMFASENCTKVGCFLEAALPALALIWMLSIATFSSWAM |
| Ga0209446_10020467 | 3300027698 | Bog Forest Soil | MSTSENCSKVGCFLEAALPVIAPAVALLWMLSLVAWS |
| Ga0209248_101201981 | 3300027729 | Bog Forest Soil | MSASENCSKVGCFLEGALPVIAPAVALIWMLSLVAWS |
| Ga0209038_100073042 | 3300027737 | Bog Forest Soil | MFASENCSKIGCFLEAALPVIAPAVALVSMLSIFTFSCC |
| Ga0209448_100092844 | 3300027783 | Bog Forest Soil | MFASENCAKIACFLEDALPVIAPAVGLVSMLSIFTFSCC |
| Ga0209448_101433342 | 3300027783 | Bog Forest Soil | MSSRENCSKVGCFLEAALPVIAPAVALIWMLSLVAWS |
| Ga0209448_102790041 | 3300027783 | Bog Forest Soil | MSTSENCAKVGCFLEAALPVIAPAVALIWMLSLVAWS |
| Ga0209656_1000036128 | 3300027812 | Bog Forest Soil | MSTGENCSKVGCFLEAALPVIAPAVALIWMLSLVAWS |
| Ga0209656_104816412 | 3300027812 | Bog Forest Soil | RENCSKVGCFLEAALPVIAPSVALVWMLSLAAFSFWAM |
| Ga0209488_100250246 | 3300027903 | Vadose Zone Soil | MFASESCSKVGCFLEAALPVIAPAVALVWMLSIAAFSCWAM |
| Ga0209488_100501964 | 3300027903 | Vadose Zone Soil | MFASESCSKVGCFLEAALPVIAPAVALVWMLSIAAFSCWEM |
| Ga0209488_103642161 | 3300027903 | Vadose Zone Soil | MFASENFSKVGCFLEAALPVIAPAVALVWMLSIVAFSSWAM |
| Ga0137415_101536864 | 3300028536 | Vadose Zone Soil | MKMFASENCSKVGCFLEAAMPAIAPAVGLIWMLSIAAFSSWAM |
| Ga0137415_110964192 | 3300028536 | Vadose Zone Soil | MEGEMFASESCSKVGCFLEAALPVIAPAVALVWMLSIAAFSCWAM |
| Ga0170834_1060188992 | 3300031057 | Forest Soil | MMFARENCSKVGCFLEAALPVIAPSVALVWMLSIAAFSFWAM |
| Ga0170834_1115447191 | 3300031057 | Forest Soil | MESEMFASENCTKVGCFLEAALPAIAPAVALIWMLSIATFSSWAM |
| Ga0170824_1193456952 | 3300031231 | Forest Soil | MEGKMFATEHCSKVGCFLEAALPGIAPAVVLICMLSIAASVSWVM |
| Ga0318516_104503132 | 3300031543 | Soil | MFASENCSKLGCFLEAALPGVAPAFALIWMLSIAFTSWAM |
| Ga0318541_102256501 | 3300031545 | Soil | MSTSENCSKVGCFLEAALPVIAPAVALIWMLSLVAWS |
| Ga0318538_100546623 | 3300031546 | Soil | MECTMFASENCSKLGCFLEAALPGVAPAFALIWMLSIAFTSWVM |
| Ga0318515_100233625 | 3300031572 | Soil | MECTMFASENCSKLGCFLEAALPGVAPAFALIWMLSIAFT |
| Ga0318515_100765393 | 3300031572 | Soil | MKMFAGENCSKIGCFFEAALPVIAPSVALVWMLSIAAFSGWAM |
| Ga0310915_100202071 | 3300031573 | Soil | MFAGENCSKIGCFLEAALPVIAPSVALVWMLSIAAFSGWAM |
| Ga0310915_102903971 | 3300031573 | Soil | TMFASENCSKLGCFLEAALPGVAPAFALIWMLSIAFTSWVM |
| Ga0318555_103366632 | 3300031640 | Soil | MFAGENCSKIGCFFEAALPVIAPSVALVWMLSIAA |
| Ga0318542_100446242 | 3300031668 | Soil | MFASENCSKLGCFLEAALPGVAPAFALIWMLSIAFTSWVM |
| Ga0318561_100169423 | 3300031679 | Soil | MFASENCSKLGCFLEAALPGVAPAFALIWMLIAFTSWVM |
| Ga0318574_100238762 | 3300031680 | Soil | MFAGENCSKIGCFFEAALPVIAPSVALVWMLSIAAFSGWAM |
| Ga0318572_102014422 | 3300031681 | Soil | MKMFAGENCSKIGCFFEAALTVIAPSVALVWMLSIAAFSGWAM |
| Ga0318560_105648112 | 3300031682 | Soil | RSFLPMECTMFASENCSKLGCFLEAALPGVAPAFALIWMLSFAFTSWVM |
| Ga0318560_107369301 | 3300031682 | Soil | MFASENCSKLGCFLEAALPGVAPAFALIWMLSIAFT |
| Ga0310686_1066122492 | 3300031708 | Soil | MFASESCSKFGCVLEAALPVIGPAVALVWMLSIAAFSSWAM |
| Ga0318496_102559323 | 3300031713 | Soil | AIARSFLPMECTMFASENCSKLGCFLEAALPGVAPAFALIWMLSIAFTSWVM |
| Ga0307474_104145371 | 3300031718 | Hardwood Forest Soil | MFARENCSKVGCFLEAALPLIAPSVALVWMLSIAAFSFW |
| Ga0306917_103001411 | 3300031719 | Soil | SENCSKLGCFLEAALPGVAPAFALIWMLSFAFTSWVM |
| Ga0318501_100027145 | 3300031736 | Soil | MFAGENCSKIGCFFEAALTVIAPSVALVWMLSIAAFSGWAM |
| Ga0306918_103136951 | 3300031744 | Soil | PMECTMFASENCSKLGCFLEAALPGVAPAFALIWMLIAFTSWVM |
| Ga0318494_105148931 | 3300031751 | Soil | ARSLLPMECTMFASENCSKLGCFLEAALPGVAPAFALIWMLSIAFTSWVM |
| Ga0307477_100101538 | 3300031753 | Hardwood Forest Soil | MFAGENCSKVGCFLEAALPLIAPAVALIGMLSLVAWS |
| Ga0307477_100850194 | 3300031753 | Hardwood Forest Soil | MEGKMFAAEHCSKVGCFLEAAMPGIAPAVALICMLSIAAFASWVM |
| Ga0307477_104120822 | 3300031753 | Hardwood Forest Soil | MEGKMFATEHCSKVGCFLEAALPGIAPAVALICMLSIAASVSWAM |
| Ga0318535_103761492 | 3300031764 | Soil | PMEGKMFATEHCSKVGCFLEAALPGIAPAVALICMLSIAASVSWVM |
| Ga0318521_103735241 | 3300031770 | Soil | DPGNALTMESEMFASENCTKVGCFLAAALPGIAPAVALIWMLSIAAFSSWAM |
| Ga0318523_101587921 | 3300031798 | Soil | MEGKMFATEHCSKVGCFLEAALPGIAPAVALICMLSIAASVSW |
| Ga0318511_100807102 | 3300031845 | Soil | VFASENCSKVGCFLEGALPIIAPAVALIWMLSIAAFSCWAM |
| Ga0306919_102621543 | 3300031879 | Soil | MFASENCTKVGCFLAAALPGIAPAVALIWMLSIAAFSSWAM |
| Ga0306925_117322242 | 3300031890 | Soil | MESEMFASENCTKVGCFLAAALPGIAPAVALIWMLSIAAFSSWAM |
| Ga0318536_104819691 | 3300031893 | Soil | VKMFARENCSKVGCFLEAALPVIAPSVALVWMLSIAAISFWAM |
| Ga0318522_100127216 | 3300031894 | Soil | MECTMFASENCSKLGCFLEAALPGVAPAFALIWMLIAFTS |
| Ga0318522_103477641 | 3300031894 | Soil | IARSFLPMECTMFASENCSKLGCFLEAALPGVAPAFALIWMLSIAFTSWVM |
| Ga0318551_103374841 | 3300031896 | Soil | MECTMFASENCSKLGCFLEAALPGVAPAFALIWMLSFAFTSWVM |
| Ga0318520_100198911 | 3300031897 | Soil | MECTMFASENCSKLGCFLEAALPGVAPAFALIWMLIAFTSWVM |
| Ga0318520_102533761 | 3300031897 | Soil | LPMECTMFASENCSKLGCFLEAALPGVAPAFALIWMLSFAFTSWVM |
| Ga0306923_105850924 | 3300031910 | Soil | LPMECTMFASENCSKLGCFLEAALPGVAPAFALIWMLSIAFTSWVM |
| Ga0310910_105157401 | 3300031946 | Soil | MFASENCSKVGCVLEGALPIIAPAVALIWMLSIAAFSCWAM |
| Ga0310910_115397202 | 3300031946 | Soil | ESEMFASENCTKVGCFLAAALPGIAPAVALIWMLSIAAFSSWAM |
| Ga0307479_102139643 | 3300031962 | Hardwood Forest Soil | MEGKMFAAEHCSKVGCFLEAAMPGIAPAVALICMLSIAAFASSVM |
| Ga0318559_105656741 | 3300032039 | Soil | ARSFLPMECTMFASENCSKLGCFLEAALPGVAPAFALIWMLSFAFTSWVM |
| Ga0318506_102352212 | 3300032052 | Soil | MFASENCSKLGCFLEAALPGVAPAFALIWMLSIAFTSWV |
| Ga0318533_102275311 | 3300032059 | Soil | PTECTMFASENCSKLGCFLEAALPGVAPAFALIWMLSFAFTSWVM |
| Ga0318510_101346733 | 3300032064 | Soil | ASENCSKLGCFLEAALPGVAPAFALIWMLSIAFTSWVM |
| Ga0306924_100816531 | 3300032076 | Soil | AGENCSKIGCFLEAALPVIAPSVALVWMLSIAAFSGWAM |
| Ga0318525_103613351 | 3300032089 | Soil | TEHCSKVGCFLEAALPGIAPAVALICMLSIAASVSWVM |
| Ga0318518_104433481 | 3300032090 | Soil | CTMFASENCSKLGCFLEAALPGVAPAFALIWMLSIAFTSWVM |
| Ga0306920_1016070993 | 3300032261 | Soil | SENCSKLGCFLEAALPGVAPAFALIWMLSIAFTSWAM |
| Ga0306920_1028894802 | 3300032261 | Soil | MFASENSSKVGCFLEAALPGVAPAVALICMLSIAAFTSLVM |
| Ga0306920_1038647862 | 3300032261 | Soil | GENCSKIGCFLEAALPVIAPSVALVWMLSIAAFSGWAM |
| Ga0318519_103020022 | 3300033290 | Soil | MFAGENCSKIGCFLEAALPVIAPSVALVWMLSIAAFSGWA |
| Ga0318519_107708112 | 3300033290 | Soil | VKMFAGENCSKIGCFLEAALPVIAPSVALVWMLSIAAFSGWAM |
| ⦗Top⦘ |