Basic Information | |
---|---|
Family ID | F066171 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 127 |
Average Sequence Length | 42 residues |
Representative Sequence | MSEFVTKSVAQEQQEQRIETRTAVKRIGGFTIVATAVAVLAVLGV |
Number of Associated Samples | 110 |
Number of Associated Scaffolds | 127 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 99.21 % |
% of genes from short scaffolds (< 2000 bps) | 94.49 % |
Associated GOLD sequencing projects | 108 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.079 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (14.173 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.709 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.669 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.53% β-sheet: 0.00% Coil/Unstructured: 42.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 127 Family Scaffolds |
---|---|---|
PF00378 | ECH_1 | 15.75 |
PF00903 | Glyoxalase | 6.30 |
PF02148 | zf-UBP | 3.15 |
PF13602 | ADH_zinc_N_2 | 2.36 |
PF12681 | Glyoxalase_2 | 1.57 |
PF00753 | Lactamase_B | 1.57 |
PF00027 | cNMP_binding | 0.79 |
PF08240 | ADH_N | 0.79 |
PF13281 | MAP3K_TRAF_bd | 0.79 |
PF03928 | HbpS-like | 0.79 |
PF14417 | MEDS | 0.79 |
PF12680 | SnoaL_2 | 0.79 |
PF00440 | TetR_N | 0.79 |
PF00578 | AhpC-TSA | 0.79 |
PF07681 | DoxX | 0.79 |
COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
---|---|---|---|
COG5207 | Uncharacterized Zn-finger protein, UBP-type | General function prediction only [R] | 3.15 |
COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.79 |
COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.79 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.08 % |
Unclassified | root | N/A | 29.92 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000567|JGI12270J11330_10040727 | All Organisms → cellular organisms → Bacteria | 2601 | Open in IMG/M |
3300001593|JGI12635J15846_10497825 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
3300003505|JGIcombinedJ51221_10224762 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
3300004080|Ga0062385_11232952 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 513 | Open in IMG/M |
3300004082|Ga0062384_101314857 | Not Available | 529 | Open in IMG/M |
3300004152|Ga0062386_101685116 | Not Available | 529 | Open in IMG/M |
3300004479|Ga0062595_102268400 | Not Available | 534 | Open in IMG/M |
3300005534|Ga0070735_10162046 | All Organisms → cellular organisms → Bacteria | 1382 | Open in IMG/M |
3300005538|Ga0070731_10272871 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300005554|Ga0066661_10140267 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
3300005574|Ga0066694_10132967 | All Organisms → cellular organisms → Bacteria | 1175 | Open in IMG/M |
3300005610|Ga0070763_10043734 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2106 | Open in IMG/M |
3300005610|Ga0070763_10946959 | Not Available | 514 | Open in IMG/M |
3300006052|Ga0075029_100875583 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300006086|Ga0075019_10569577 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300006102|Ga0075015_100068141 | All Organisms → cellular organisms → Bacteria | 1726 | Open in IMG/M |
3300006102|Ga0075015_100477088 | Not Available | 715 | Open in IMG/M |
3300006163|Ga0070715_10822305 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300006176|Ga0070765_100853180 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
3300006354|Ga0075021_10632315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas daechungensis | 685 | Open in IMG/M |
3300009552|Ga0116138_1184947 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300009631|Ga0116115_1103816 | All Organisms → cellular organisms → Bacteria | 728 | Open in IMG/M |
3300009665|Ga0116135_1395972 | Not Available | 559 | Open in IMG/M |
3300009672|Ga0116215_1492130 | Not Available | 530 | Open in IMG/M |
3300009698|Ga0116216_10924565 | Not Available | 522 | Open in IMG/M |
3300009839|Ga0116223_10166053 | All Organisms → cellular organisms → Bacteria | 1364 | Open in IMG/M |
3300010341|Ga0074045_10268328 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
3300010343|Ga0074044_10658487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 683 | Open in IMG/M |
3300012202|Ga0137363_10465493 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300012202|Ga0137363_10982056 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
3300012944|Ga0137410_11547076 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300014164|Ga0181532_10345773 | Not Available | 834 | Open in IMG/M |
3300014164|Ga0181532_10715394 | Not Available | 539 | Open in IMG/M |
3300014165|Ga0181523_10083748 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1929 | Open in IMG/M |
3300014200|Ga0181526_10749091 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300014200|Ga0181526_10952488 | Not Available | 540 | Open in IMG/M |
3300014201|Ga0181537_10465458 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
3300014501|Ga0182024_11390445 | All Organisms → cellular organisms → Bacteria | 808 | Open in IMG/M |
3300014501|Ga0182024_11449411 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
3300014501|Ga0182024_11615597 | Not Available | 734 | Open in IMG/M |
3300014638|Ga0181536_10414431 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 599 | Open in IMG/M |
3300014654|Ga0181525_10194966 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
3300014654|Ga0181525_10683800 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300015241|Ga0137418_10384271 | Not Available | 1149 | Open in IMG/M |
3300017822|Ga0187802_10100995 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
3300017823|Ga0187818_10056617 | All Organisms → cellular organisms → Bacteria | 1686 | Open in IMG/M |
3300017927|Ga0187824_10254938 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 610 | Open in IMG/M |
3300017929|Ga0187849_1208469 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
3300017930|Ga0187825_10195494 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300017932|Ga0187814_10209437 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300017933|Ga0187801_10468992 | Not Available | 530 | Open in IMG/M |
3300017933|Ga0187801_10493852 | Not Available | 516 | Open in IMG/M |
3300017940|Ga0187853_10114263 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
3300017943|Ga0187819_10578140 | Not Available | 637 | Open in IMG/M |
3300017948|Ga0187847_10210589 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300017993|Ga0187823_10115700 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
3300018008|Ga0187888_1284357 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300018012|Ga0187810_10179903 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
3300018017|Ga0187872_10267609 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300018020|Ga0187861_10135107 | All Organisms → cellular organisms → Bacteria | 1152 | Open in IMG/M |
3300018022|Ga0187864_10341655 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300018030|Ga0187869_10375991 | Not Available | 679 | Open in IMG/M |
3300018030|Ga0187869_10538551 | Not Available | 554 | Open in IMG/M |
3300018034|Ga0187863_10271313 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
3300018035|Ga0187875_10391297 | Not Available | 743 | Open in IMG/M |
3300018037|Ga0187883_10695462 | Not Available | 531 | Open in IMG/M |
3300018038|Ga0187855_10140424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1444 | Open in IMG/M |
3300018040|Ga0187862_10154093 | All Organisms → cellular organisms → Bacteria | 1546 | Open in IMG/M |
3300018040|Ga0187862_10457066 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300018046|Ga0187851_10646616 | Not Available | 597 | Open in IMG/M |
3300018046|Ga0187851_10846260 | Not Available | 514 | Open in IMG/M |
3300018047|Ga0187859_10592246 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300020580|Ga0210403_11506021 | Not Available | 506 | Open in IMG/M |
3300020581|Ga0210399_11383338 | Not Available | 551 | Open in IMG/M |
3300021178|Ga0210408_11457168 | Not Available | 514 | Open in IMG/M |
3300021181|Ga0210388_10793307 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
3300021401|Ga0210393_10799416 | All Organisms → cellular organisms → Bacteria | 767 | Open in IMG/M |
3300021401|Ga0210393_11604638 | Not Available | 516 | Open in IMG/M |
3300021402|Ga0210385_10682817 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
3300021402|Ga0210385_11503379 | Not Available | 514 | Open in IMG/M |
3300021404|Ga0210389_10318979 | All Organisms → cellular organisms → Bacteria | 1219 | Open in IMG/M |
3300021407|Ga0210383_11085423 | Not Available | 676 | Open in IMG/M |
3300021433|Ga0210391_11402153 | Not Available | 537 | Open in IMG/M |
3300021474|Ga0210390_11097830 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
3300021477|Ga0210398_11343041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium SbA2 | 560 | Open in IMG/M |
3300021478|Ga0210402_10040166 | All Organisms → cellular organisms → Bacteria | 4066 | Open in IMG/M |
3300024232|Ga0247664_1167333 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 519 | Open in IMG/M |
3300024271|Ga0224564_1034394 | All Organisms → cellular organisms → Bacteria | 960 | Open in IMG/M |
3300024271|Ga0224564_1072014 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300025406|Ga0208035_1038609 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300025506|Ga0208937_1126165 | Not Available | 552 | Open in IMG/M |
3300026309|Ga0209055_1037940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2151 | Open in IMG/M |
3300026515|Ga0257158_1093261 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300027432|Ga0209421_1043384 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300027497|Ga0208199_1049614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 898 | Open in IMG/M |
3300027590|Ga0209116_1028705 | All Organisms → cellular organisms → Bacteria | 1170 | Open in IMG/M |
3300027641|Ga0208827_1182120 | Not Available | 567 | Open in IMG/M |
3300027795|Ga0209139_10334963 | Not Available | 530 | Open in IMG/M |
3300027889|Ga0209380_10401214 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300027895|Ga0209624_10477782 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
3300027898|Ga0209067_10270471 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300028017|Ga0265356_1006776 | All Organisms → cellular organisms → Bacteria | 1333 | Open in IMG/M |
3300028746|Ga0302233_10035901 | All Organisms → cellular organisms → Bacteria | 2086 | Open in IMG/M |
3300028775|Ga0302231_10449231 | Not Available | 544 | Open in IMG/M |
3300028806|Ga0302221_10223769 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
3300028859|Ga0302265_1221562 | Not Available | 566 | Open in IMG/M |
3300029914|Ga0311359_10325285 | All Organisms → cellular organisms → Bacteria | 1256 | Open in IMG/M |
3300029943|Ga0311340_10617597 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300029999|Ga0311339_11396056 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300030503|Ga0311370_10980550 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300030506|Ga0302194_10258183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 700 | Open in IMG/M |
3300030580|Ga0311355_10552212 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300030617|Ga0311356_10027399 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6167 | Open in IMG/M |
3300030760|Ga0265762_1060495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 777 | Open in IMG/M |
3300031090|Ga0265760_10182174 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
3300031128|Ga0170823_16361632 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas oligoaromativorans | 567 | Open in IMG/M |
3300031234|Ga0302325_11821962 | Not Available | 761 | Open in IMG/M |
3300031234|Ga0302325_13204846 | Not Available | 522 | Open in IMG/M |
3300031524|Ga0302320_11161636 | Not Available | 796 | Open in IMG/M |
3300031708|Ga0310686_107790574 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300031708|Ga0310686_117831629 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300031788|Ga0302319_11549665 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300032174|Ga0307470_11834259 | Not Available | 514 | Open in IMG/M |
3300032828|Ga0335080_10390564 | All Organisms → cellular organisms → Bacteria | 1495 | Open in IMG/M |
3300032893|Ga0335069_10307932 | All Organisms → cellular organisms → Bacteria | 1883 | Open in IMG/M |
3300033134|Ga0335073_10047249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5777 | Open in IMG/M |
3300033829|Ga0334854_067254 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. L46 | 854 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 14.17% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.60% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 7.87% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.87% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 7.09% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.72% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.72% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.15% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.15% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.15% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.94% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.94% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.36% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.36% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 2.36% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.57% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.79% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.79% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.79% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.79% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.79% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.79% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000567 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
3300014200 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaG | Environmental | Open in IMG/M |
3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014654 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaG | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
3300025406 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 (SPAdes) | Environmental | Open in IMG/M |
3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027590 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
3300028806 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_1 | Environmental | Open in IMG/M |
3300028859 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_1 | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030506 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_1 | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033829 | Peat soil microbial communities from Stordalen Mire, Sweden - 715 P2 1-5 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12270J11330_100407271 | 3300000567 | Peatlands Soil | MSELVTKSVPPEQQQRRIETRTAVKRIGDFTIVVTAVAVLGVLGA |
JGI12635J15846_104978251 | 3300001593 | Forest Soil | MSKLVTKSAAQEQREQKMETRTAVKRIAGYTIVVTAVAALVILAATAV |
JGIcombinedJ51221_102247622 | 3300003505 | Forest Soil | MSELVTKSGAREQQEQKMETLTGVGRITRLTIVATAVAVLAVLAAIGL |
Ga0062385_112329522 | 3300004080 | Bog Forest Soil | MPEFVTKSVAQEQPAKKIETRTSAERFAAFIISAIAVAVL |
Ga0062384_1013148571 | 3300004082 | Bog Forest Soil | MSEFVTKSVAQEQQAPKVETRTAVARTAGLALIATAVAVLGVLGV |
Ga0062386_1016851162 | 3300004152 | Bog Forest Soil | MSEFVTKSVAQEQEEQRIETRTAVKRIGGFTIVATAVAVLAVLG |
Ga0062595_1022684001 | 3300004479 | Soil | MSELVTKSVAQEQQEQKIETRTAVERIAGFAIIATAVAVLSVLVA |
Ga0070735_101620463 | 3300005534 | Surface Soil | MSEPVTKSVRQELQEQKIETRTAVAGIAGFVLIATAMAALAVLG |
Ga0070731_102728712 | 3300005538 | Surface Soil | MSELVTKSVAQETREQRKIETRSAVACIAGFALIATAMVALAVLG |
Ga0066661_101402673 | 3300005554 | Soil | MSELVTKSVAQEQPGQKIETRTAAQRVAGFTVVVTAVAVL |
Ga0066694_101329671 | 3300005574 | Soil | MSELVTKSVAQEQREQRIETHAAVEHISGFTIVATAVAVLAVLVATAVY |
Ga0070763_100437341 | 3300005610 | Soil | MSGLVRKSAVQGRQEQKLETRTAVERSVGFTIVTAAVVVLA |
Ga0070763_109469591 | 3300005610 | Soil | MSEPVTNPVPQEQPEQRIETRTAVKRIAGFTTVAIAVAVLA |
Ga0075029_1008755831 | 3300006052 | Watersheds | MPELVTKSVAQEQQERKIETRTAVERLAGFTIVATAVAVLAVL |
Ga0075019_105695771 | 3300006086 | Watersheds | MSEPVTKSVPQEEQELRAKSRTAVKRIGGLIIVATAVAALAALGVM |
Ga0075015_1000681411 | 3300006102 | Watersheds | MSDLVTKSVPQEQQEQKIETQTAVERIARFTVVATA |
Ga0075015_1004770882 | 3300006102 | Watersheds | MFEFVTKSVAQEQPEAKIETRSAVERSAGFTIVAI |
Ga0070715_108223052 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSELVTKSVAQEQPGQKIETRTAAQRVAGFTVVVTAVAVLAVLV |
Ga0070765_1008531801 | 3300006176 | Soil | MSEFVTKSVAQEQQEQRIETRTAVKRIGGFTIVATAVAVLAVLGV |
Ga0075021_106323153 | 3300006354 | Watersheds | MSELVTKSVAQEQPEHKIETRTAAKRIAGFTIVATAVA |
Ga0116138_11849472 | 3300009552 | Peatland | MSELVTKSVPQEQQEQRIETHIAVKRIGGFTVVATAVAVLAVLGAAALF |
Ga0116115_11038162 | 3300009631 | Peatland | MSELVTKSVPQEQQEERIETRTAVKHIGGFTAVATAVAVLAVLG |
Ga0116135_13959721 | 3300009665 | Peatland | MSEFLTKSVAQEQQEQKIETRDAAKRIAGFTIAATAV |
Ga0116215_14921301 | 3300009672 | Peatlands Soil | MSELVTKSVPPEQQQRRIETRTAVKRIGDFTIVVTAVAVLGVLGAVVLY |
Ga0116216_109245651 | 3300009698 | Peatlands Soil | MSEFVTKAVAQEEQEQRIETRTAVKRIGGFIIVATAVAVLAVLGAVAL |
Ga0116223_101660531 | 3300009839 | Peatlands Soil | MSELVTKSVLQEQQEQRIETRTAVKRIAGFTIVATAVAVLAVLGAVVL |
Ga0074045_102683281 | 3300010341 | Bog Forest Soil | MSEPVPRSVPQEQRIETRTAVKRIGGFTIVATAVAVLAVLG |
Ga0074044_106584871 | 3300010343 | Bog Forest Soil | MSELATKSVAREQQELKIETPAVAERIAVFTIVATAVAVLAVLVAA |
Ga0137363_104654931 | 3300012202 | Vadose Zone Soil | MSELVTKSVAQEQPGQKIETRTAAQRVAGFTVVVTAVAV |
Ga0137363_109820563 | 3300012202 | Vadose Zone Soil | MSELVTKSVEQEQPEQKIETHTAVEHIPGFTIVATAVA |
Ga0137410_115470762 | 3300012944 | Vadose Zone Soil | MSELVTKSVAQEEPGQKIETRTAAQRVAGFTVVVTAVAVLAVLVA |
Ga0181532_103457731 | 3300014164 | Bog | MSELVTKSVAQGEQEQKMETRTAVERIAGFTIVATAVAVLAALGAVV |
Ga0181532_107153941 | 3300014164 | Bog | MSELVTKFVTQEQRGQKTETRFTTERIGGFTIVATAVAVLAVLVAAALF |
Ga0181523_100837483 | 3300014165 | Bog | MPELMTKYVAQEQQEQKVETRSAVGRIAGFTIVATSVSVLSV |
Ga0181526_107490911 | 3300014200 | Bog | MPELVTKSVTQEQQEQQEQKIETRTAVERIAPFTIVATAVAVLAVL |
Ga0181526_109524882 | 3300014200 | Bog | MSELVTKFVTQEQRGQKTETRSATERIVGFIIVATAVAVLAALV |
Ga0181537_104654581 | 3300014201 | Bog | MMPKLVTKSVAQEQQEQKIETRSAMERNAGFTIVA |
Ga0182024_113904452 | 3300014501 | Permafrost | MSKLVRKSVPQEQQEQSVKARTAAERTVGFTIVATAVAVLAVLIATAVYAQE |
Ga0182024_114494112 | 3300014501 | Permafrost | MSELVTKSVPQEQQEQRIETRTAVKRIGGFTIVAT |
Ga0182024_116155972 | 3300014501 | Permafrost | MPELVRKSVAQEQQIEARTAMKRIACFTIVATAVAALAVLVATAVY |
Ga0181536_104144312 | 3300014638 | Bog | MSELVTESVLQEQREQRMETRTAVARIAGFALIATAM |
Ga0181525_101949661 | 3300014654 | Bog | MSEFVTKSVAQEQQAHKIEKRTAVARIAGFALIATAMAA |
Ga0181525_106838002 | 3300014654 | Bog | MSEFVTKSVAQEQQAQKIETRTAVARIAGFALIATATA |
Ga0137418_103842712 | 3300015241 | Vadose Zone Soil | MPELVRKSSAQEQPIQKKPIAGFTIGATAVAALAVLL |
Ga0187802_101009951 | 3300017822 | Freshwater Sediment | MSEFVTKSVAQEQQEQRIEARTAVGRIGGFTIVATA |
Ga0187818_100566171 | 3300017823 | Freshwater Sediment | MSEFVTKSVAQEQQEQRIEARTAVGRIGGFTIVATAVAVLAVLGV |
Ga0187824_102549382 | 3300017927 | Freshwater Sediment | MSEPVTKSVPQEPQEQKIETRTAVAGIAGFALIATAMAALAVL |
Ga0187849_12084692 | 3300017929 | Peatland | MSELVTKSVPQEQQEQRIETRIAGLTVVATAVAVLAVLG |
Ga0187825_101954941 | 3300017930 | Freshwater Sediment | MSEPVTKSVPEEQQEQRIKTRTAVKRIGGFTIVATAVAVLAVLG |
Ga0187814_102094371 | 3300017932 | Freshwater Sediment | MSEFVTKSVAQEQQEQRIEARTAVGRIGGFTIVDSRGSA |
Ga0187801_104689921 | 3300017933 | Freshwater Sediment | MSEFVTKSVAQEQQEQRIEARTAVGRIGGFTIVATAVAVLAVLGVVVL |
Ga0187801_104938521 | 3300017933 | Freshwater Sediment | MSECLTKSVPQEEQEQRINARTAVKRIGGFTIVATAVAVLAVLGVVVLCA |
Ga0187853_101142631 | 3300017940 | Peatland | MSELVRKSVAQEQQERKIETRTAVERIAGFTIVATAVAVLAALVA |
Ga0187819_105781401 | 3300017943 | Freshwater Sediment | VSELVTKSVAQEQQEQKIETRTTVERIAGFTIVATAVAVLAVLA |
Ga0187847_102105892 | 3300017948 | Peatland | MSEFVTKSVPPEQQEQRMGTRIAVKRIGGFTIVATAVAVLAVLG |
Ga0187823_101157001 | 3300017993 | Freshwater Sediment | MSEPVTKSVPEEQQEQRIKTRTAVKRIGGFTIVATAVSVFAVVVIL |
Ga0187888_12843571 | 3300018008 | Peatland | MSELVTKSVPQEQQEQRIETHIAVKRIGGFTVVATAVAVLAV |
Ga0187810_101799033 | 3300018012 | Freshwater Sediment | MPELRPESVAQEQQEQKIKTRSAVERIAGFTIVATAVAVLAV |
Ga0187872_102676092 | 3300018017 | Peatland | MSELVTESVPQEQQEQRIETRTAVKRIGGFTIVATAVAVLAVLGVVVLYA |
Ga0187861_101351071 | 3300018020 | Peatland | MSELVTKSVPQEQQEQRIETRIAVKRIGGFAIAATAVAVLAVLGA |
Ga0187864_103416551 | 3300018022 | Peatland | MSELVTESVPQEQQEQRIETRTAVKRIGGFTIVATAVAVLAVLGVVV |
Ga0187869_103759911 | 3300018030 | Peatland | MSELVTKFVTQEQRGQKTETRSTTERIGGFTIVATAVAVLA |
Ga0187869_105385511 | 3300018030 | Peatland | MSGLMTKSVAQERKEQQMETRTTVGRIAGFTIVATAVAVLAVLV |
Ga0187863_102713131 | 3300018034 | Peatland | MSEFVTKSVAQEQQAQKIETRTAVARIAGFALIATAVAVLGVLGAAALF |
Ga0187875_103912972 | 3300018035 | Peatland | MPELMTKYVAQEQQEQKVETRTAVGRIAGFTIVATSVSVLSVLVA |
Ga0187883_106954621 | 3300018037 | Peatland | MSELVTKSVAQEQQEQKIGTRTAVERIVGFTIVATAVAVLAVQVAATL |
Ga0187855_101404243 | 3300018038 | Peatland | MSELETKLVAQEQEEQKTETGTPVKRIVGFIVIATAVAVL |
Ga0187862_101540931 | 3300018040 | Peatland | VSELLRKPVAQEPEHKVKASTAVKRIAGLTIVATAVAVLAVL |
Ga0187862_104570662 | 3300018040 | Peatland | MSEPVPRSVPQEQRIETRTAVKRIGGFTIVATAVAVLAVL |
Ga0187851_106466161 | 3300018046 | Peatland | VFEVVTKSVPPEQQEQRIGTRIAVKRIGGFTIVAIAA |
Ga0187851_108462601 | 3300018046 | Peatland | MPELVTKSVARKQQEQQEQKIETLTAVERIARFTIVATAVAVLSVLV |
Ga0187859_105922461 | 3300018047 | Peatland | MSGLVAKSVAREQQEQKIETRTAVDRARFTIVAIAVAV |
Ga0210403_115060212 | 3300020580 | Soil | MLEIVTKSVVQEQQEQKIETRTPAERIAGFVIVVTAVA |
Ga0210399_113833381 | 3300020581 | Soil | MSGFVTKSVAQGPQEQRIEKRTAVKRIAGLTVVATAV |
Ga0210408_114571681 | 3300021178 | Soil | MSEFVTKSVAQEQQEQRIETRTAVKRIGGFTIVATAVAVLAVLGVV |
Ga0210388_107933071 | 3300021181 | Soil | MTEPVTESRALEQKKQKTETRHAVKRIACFTIVPTAVAVLAVLGAVVLF |
Ga0210393_107994162 | 3300021401 | Soil | MSEFVTKSVAQEQQEQQRIKTRTAVKRIGGVTIVATAVAVLAVLGVVVL |
Ga0210393_116046381 | 3300021401 | Soil | MPYPMTESVAQKQRKRKIETRTAVERIAGFTIVATAVLAVLGAAAL |
Ga0210385_106828172 | 3300021402 | Soil | MSELLTKSVAKEQQEQKMETRTAVERIADHTIVTTAVTA |
Ga0210385_115033791 | 3300021402 | Soil | MSELVTKSVAQEQQEQKITTRTAVKPIARFTIVATAVAML |
Ga0210389_103189792 | 3300021404 | Soil | MSELVTKSVPQEQQEQRIETRIAAKRIGGLTVVATAM |
Ga0210383_110854231 | 3300021407 | Soil | MSELLTKSVAQERHEQKIEARTAVEHSVGFAIVTIAVAVIAVLGAT |
Ga0210391_114021532 | 3300021433 | Soil | MSEFVTKSEAQQQQEQKMEARTTAGRITRFTIVATAIAV |
Ga0210390_110978301 | 3300021474 | Soil | MSELVTKSVPQEQQKQKIETRTAMKRIAGFTIGAI |
Ga0210398_113430412 | 3300021477 | Soil | MSELVRKSVAQEQEEQKVETRTAVKRIAGFTIATTAVAVLAALVAAAV |
Ga0210402_100401665 | 3300021478 | Soil | MSELVTKSVAQEQQEQKIETRTAVERIAGFTIVATAVAVLAVLLGYR |
Ga0247664_11673331 | 3300024232 | Soil | MSELVAKSVAQDEQEQKIETPTAVKRIAGFTIVATAIAVL |
Ga0224564_10343941 | 3300024271 | Soil | MSELVTKSVAQEQQEQKIEARTTVKRIGGFTMVAAALAV |
Ga0224564_10720142 | 3300024271 | Soil | MSELVTKSVAQEQPGQKIETRTAAQRVAGFTVVVTAIA |
Ga0208035_10386092 | 3300025406 | Peatland | MSELVTKSVPQEQQEQRIETHIAVKRIGGFTVVATAV |
Ga0208937_11261652 | 3300025506 | Peatland | MSELVTKSVPPEQQEQRIGTRIAVKRIGGFTIVATAVAVLAVL |
Ga0209055_10379401 | 3300026309 | Soil | MSELVTKSVAQEQPGQKIETRTAAQRVAGFTVVVTAVAVLAVLVA |
Ga0257158_10932611 | 3300026515 | Soil | MSELVTKSVAQEQPGQKIETRTAAQRVAGFTVVVTAVAVLA |
Ga0209421_10433841 | 3300027432 | Forest Soil | MPERMTKSVAQEQQAQKTETRTAVERIAGFTMVATAVAVLAVLGA |
Ga0208199_10496142 | 3300027497 | Peatlands Soil | MEELMTKSVAQEQQEQKREVEPIAGFIIVATAVAVFAVF |
Ga0209116_10287052 | 3300027590 | Forest Soil | MSELLTKVVAPEQQEQKTGTRTAARRIAGFTIVAT |
Ga0208827_11821201 | 3300027641 | Peatlands Soil | MSELLTKSVPQEQQEQRIETRTAVKRIGGFTIVATAVAVLAVLGAV |
Ga0209139_103349631 | 3300027795 | Bog Forest Soil | MSELVTKSGAQEQQKQNIEARTAVKRVGSFPVVATAVA |
Ga0209380_104012141 | 3300027889 | Soil | MSGFVTKSVAQEQQAQKIETRTAVERIAGFALIATA |
Ga0209624_104777823 | 3300027895 | Forest Soil | MSGFVTKSVAQEQQAQKIETRTAVERIAGFALIATAMA |
Ga0209067_102704712 | 3300027898 | Watersheds | MREPGTKSVAQEHQEQKIETHTAVRRIAGFTIVAIATA |
Ga0265356_10067763 | 3300028017 | Rhizosphere | MSGFVTKSVAQEQQAQKIETRTAVERIAGFALIAT |
Ga0302233_100359013 | 3300028746 | Palsa | VSELLTKSVAQQQQEQKIETRTAVERIAGFTIVATAVAVLAVLVGTAVYA |
Ga0302231_104492312 | 3300028775 | Palsa | VSELLTKSVAQQQQEQKIETRTAVERIAGFTIVATAVAVLAVLVGT |
Ga0302221_102237692 | 3300028806 | Palsa | VSELLTKSVAQQQQEQKIETRTAVERIAGFTIVATAVAVLAVLVGTAV |
Ga0302265_12215621 | 3300028859 | Bog | MPELVTKSVAQEQHEQQEQKIESSAAVKRIVGLTIVATAVAA |
Ga0311359_103252853 | 3300029914 | Bog | MSEFLTKSVAQEQQEQRIETRTAVKRIGGFTTVATAVAVLA |
Ga0311340_106175972 | 3300029943 | Palsa | MSEFLTKSVAQEQQAKRIETRTAVARIAGFALIATATAVLAVL |
Ga0311339_113960562 | 3300029999 | Palsa | MPELVRKSLAQEQQEQKIETRTTMERIPGFTIGATAVAALAVLV |
Ga0311370_109805504 | 3300030503 | Palsa | MPELVTKSVAQEQKTETRTSAKRTAGFSILAAAVAVLTVLVGTGFAT |
Ga0302194_102581831 | 3300030506 | Bog | MSELMTKSAAQEQQVQKIEPRTAVKRIGGFTAVATAVAVLAVLGA |
Ga0311355_105522123 | 3300030580 | Palsa | MPEFTPKSLAQKQQEQLKIETRTAVKRIAGFTIVAAAVA |
Ga0311356_100273991 | 3300030617 | Palsa | MPEFTPKSLAQKQQEQLKIETRTAVKRIAGFTIVAAAV |
Ga0265762_10604952 | 3300030760 | Soil | MSGFVTKSVAQEQQAQKIETRTAVERIAGFALIATAM |
Ga0265760_101821742 | 3300031090 | Soil | MSEFVKKSVAQQQEQKIETRTAMGRIPGFTMVATAV |
Ga0170823_163616321 | 3300031128 | Forest Soil | MSELVTKSVAPEQQAQKIETRTAVQRIAGFTIAATAVAALAVL |
Ga0302325_118219622 | 3300031234 | Palsa | MFELVTKSVAQERQEQKIEARNALQRIAGFTILATAMAVLAVL |
Ga0302325_132048461 | 3300031234 | Palsa | MPERMTKSVTQEPQEQKIETRTAVERIAGFTIVATAVAVLAVLGATAAY |
Ga0302320_111616362 | 3300031524 | Bog | MSESATKSVAQEHPEQRIETRSAVKRIASFTIVATAVAVLAVLGAAA |
Ga0310686_1077905742 | 3300031708 | Soil | MPEPVTKSVAQEQQEQRIETRAAAERIAGFTIVATA |
Ga0310686_1178316292 | 3300031708 | Soil | MSEFVTKSVAQQQEQKIETRTAMGRIPGFTMVATAVAALAVLGVAA |
Ga0302319_115496652 | 3300031788 | Bog | MSERVTKSVTQQQQEQKTETRTAVQRVAGFTVVATAV |
Ga0307470_118342592 | 3300032174 | Hardwood Forest Soil | MSELVTKSVAQEQQEQKIETRTAVEPIVGFTIVATAVAVLSV |
Ga0335080_103905643 | 3300032828 | Soil | MPELVRKIVPQEQRIKRRIAVKRIGGFTIVATAVAVFAVF |
Ga0335069_103079324 | 3300032893 | Soil | MSELERKLVPPEQRIKTRIAVKRIGGFTIVATAVAVLGVFGVVILYAQGQD |
Ga0335073_100472491 | 3300033134 | Soil | MSELVTKSVPQEQQEQRIETRIAAKRIGGLTVVAT |
Ga0334854_067254_2_133 | 3300033829 | Soil | MPELVAESVVQEQQAQKIETRTAVERIAGFTIVAIATAVLAVLG |
⦗Top⦘ |