NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F066152

Metagenome / Metatranscriptome Family F066152

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066152
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 70 residues
Representative Sequence MLFPSIPQYLCVYEIDNNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPTHHISLTIH
Number of Associated Samples 105
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 64.57 %
% of genes near scaffold ends (potentially truncated) 36.22 %
% of genes from short scaffolds (< 2000 bps) 76.38 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (55.118 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(20.472 % of family members)
Environment Ontology (ENVO) Unclassified
(72.441 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(84.252 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.49%    β-sheet: 34.78%    Coil/Unstructured: 50.72%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF11753DUF3310 33.07
PF05037DUF669 24.41
PF12684DUF3799 18.90
PF13479AAA_24 4.72
PF10571UPF0547 2.36
PF09250Prim-Pol 1.57
PF13148DUF3987 1.57
PF04851ResIII 0.79
PF00166Cpn10 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG0234Co-chaperonin GroES (HSP10)Posttranslational modification, protein turnover, chaperones [O] 0.79

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms55.91 %
UnclassifiedrootN/A44.09 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10045393All Organisms → cellular organisms → Bacteria → Proteobacteria2248Open in IMG/M
3300000101|DelMOSum2010_c10107705All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1135Open in IMG/M
3300000101|DelMOSum2010_c10110789All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1109Open in IMG/M
3300000101|DelMOSum2010_c10119762All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1039Open in IMG/M
3300000101|DelMOSum2010_c10158504All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Colwellia → unclassified Colwellia → Colwellia sp.818Open in IMG/M
3300000115|DelMOSum2011_c10083605All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1099Open in IMG/M
3300000115|DelMOSum2011_c10140185Not Available731Open in IMG/M
3300000116|DelMOSpr2010_c10038446All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Colwellia → unclassified Colwellia → Colwellia sp.2177Open in IMG/M
3300000116|DelMOSpr2010_c10093805All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Colwellia → unclassified Colwellia → Colwellia sp.1150Open in IMG/M
3300000116|DelMOSpr2010_c10116385All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.974Open in IMG/M
3300000116|DelMOSpr2010_c10202168Not Available636Open in IMG/M
3300000116|DelMOSpr2010_c10236519Not Available564Open in IMG/M
3300000947|BBAY92_10002921All Organisms → cellular organisms → Bacteria → Proteobacteria4377Open in IMG/M
3300001450|JGI24006J15134_10027749All Organisms → cellular organisms → Bacteria2520Open in IMG/M
3300001472|JGI24004J15324_10125810Not Available622Open in IMG/M
3300001589|JGI24005J15628_10101271All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.967Open in IMG/M
3300001853|JGI24524J20080_1014468Not Available882Open in IMG/M
3300002144|M2t2BS2_11165059All Organisms → cellular organisms → Bacteria5588Open in IMG/M
3300004448|Ga0065861_1028458Not Available754Open in IMG/M
3300005512|Ga0074648_1006654All Organisms → cellular organisms → Bacteria → Proteobacteria8509Open in IMG/M
3300005613|Ga0074649_1007426All Organisms → cellular organisms → Bacteria8620Open in IMG/M
3300006026|Ga0075478_10137475Not Available766Open in IMG/M
3300006029|Ga0075466_1026501All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1836Open in IMG/M
3300006164|Ga0075441_10025448All Organisms → cellular organisms → Bacteria2424Open in IMG/M
3300006164|Ga0075441_10068658All Organisms → Viruses → Predicted Viral1383Open in IMG/M
3300006193|Ga0075445_10159699Not Available806Open in IMG/M
3300006425|Ga0075486_1664755All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Colwellia → unclassified Colwellia → Colwellia sp.846Open in IMG/M
3300006735|Ga0098038_1241964Not Available572Open in IMG/M
3300006735|Ga0098038_1284857Not Available516Open in IMG/M
3300006752|Ga0098048_1098201Not Available887Open in IMG/M
3300006810|Ga0070754_10204339Not Available919Open in IMG/M
3300006919|Ga0070746_10477627Not Available550Open in IMG/M
3300006919|Ga0070746_10493022Not Available539Open in IMG/M
3300006919|Ga0070746_10537084Not Available509Open in IMG/M
3300006921|Ga0098060_1029784All Organisms → cellular organisms → Bacteria → Proteobacteria1663Open in IMG/M
3300006928|Ga0098041_1284914Not Available525Open in IMG/M
3300006929|Ga0098036_1085600Not Available971Open in IMG/M
3300007229|Ga0075468_10106468Not Available883Open in IMG/M
3300007229|Ga0075468_10112279Not Available853Open in IMG/M
3300007718|Ga0102852_1092731Not Available593Open in IMG/M
3300007963|Ga0110931_1020672All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Colwellia → unclassified Colwellia → Colwellia sp.1987Open in IMG/M
3300007963|Ga0110931_1093770Not Available906Open in IMG/M
3300009077|Ga0115552_1119442Not Available1125Open in IMG/M
3300009149|Ga0114918_10100580All Organisms → cellular organisms → Bacteria1797Open in IMG/M
3300009414|Ga0114909_1151716Not Available612Open in IMG/M
3300009428|Ga0114915_1026730All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.2007Open in IMG/M
3300009435|Ga0115546_1248651Not Available609Open in IMG/M
3300009443|Ga0115557_1180294All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Colwellia → unclassified Colwellia → Colwellia sp.838Open in IMG/M
3300009481|Ga0114932_10039503Not Available3083Open in IMG/M
3300009512|Ga0115003_10182733All Organisms → cellular organisms → Bacteria → Proteobacteria1264Open in IMG/M
3300009529|Ga0114919_10025826All Organisms → cellular organisms → Bacteria4446Open in IMG/M
3300010150|Ga0098056_1250280Not Available587Open in IMG/M
3300010150|Ga0098056_1259616Not Available575Open in IMG/M
3300010883|Ga0133547_10637327All Organisms → cellular organisms → Bacteria2123Open in IMG/M
3300011253|Ga0151671_1036355All Organisms → cellular organisms → Bacteria3120Open in IMG/M
3300011254|Ga0151675_1021190All Organisms → cellular organisms → Bacteria → Proteobacteria1369Open in IMG/M
3300017710|Ga0181403_1035506All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1050Open in IMG/M
3300017713|Ga0181391_1046953All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300017717|Ga0181404_1086155All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300017721|Ga0181373_1049464Not Available765Open in IMG/M
3300017726|Ga0181381_1024690Not Available1362Open in IMG/M
3300017735|Ga0181431_1131823Not Available556Open in IMG/M
3300017756|Ga0181382_1039197Not Available1402Open in IMG/M
3300017762|Ga0181422_1034606All Organisms → cellular organisms → Bacteria → Proteobacteria1645Open in IMG/M
3300017763|Ga0181410_1034633All Organisms → cellular organisms → Bacteria1605Open in IMG/M
3300017764|Ga0181385_1078344All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1017Open in IMG/M
3300017950|Ga0181607_10519937Not Available634Open in IMG/M
3300017991|Ga0180434_10131508All Organisms → cellular organisms → Bacteria2057Open in IMG/M
3300018080|Ga0180433_10952344Not Available628Open in IMG/M
3300018416|Ga0181553_10708768Not Available526Open in IMG/M
3300018420|Ga0181563_10494795All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.688Open in IMG/M
3300018420|Ga0181563_10549074Not Available646Open in IMG/M
3300019096|Ga0188835_1013965Not Available665Open in IMG/M
3300019122|Ga0188839_1007743Not Available1335Open in IMG/M
3300019459|Ga0181562_10028741All Organisms → cellular organisms → Bacteria3556Open in IMG/M
3300019751|Ga0194029_1024055All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Colwellia → unclassified Colwellia → Colwellia sp.940Open in IMG/M
3300020388|Ga0211678_10233420Not Available763Open in IMG/M
3300021364|Ga0213859_10212536All Organisms → cellular organisms → Bacteria894Open in IMG/M
3300021371|Ga0213863_10000357All Organisms → cellular organisms → Bacteria35448Open in IMG/M
3300021373|Ga0213865_10163527All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1130Open in IMG/M
3300021375|Ga0213869_10198743All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Colwellia → unclassified Colwellia → Colwellia sp.905Open in IMG/M
3300021378|Ga0213861_10335635Not Available764Open in IMG/M
3300021958|Ga0222718_10054954All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Colwellia → unclassified Colwellia → Colwellia sp.2507Open in IMG/M
3300022072|Ga0196889_1023803All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1265Open in IMG/M
3300022072|Ga0196889_1044024All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.877Open in IMG/M
3300022074|Ga0224906_1037663All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1613Open in IMG/M
3300022158|Ga0196897_1025523Not Available717Open in IMG/M
3300022178|Ga0196887_1001484All Organisms → cellular organisms → Bacteria → Proteobacteria10183Open in IMG/M
3300022178|Ga0196887_1073362All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.817Open in IMG/M
3300022200|Ga0196901_1226627Not Available589Open in IMG/M
3300022907|Ga0255775_1011466All Organisms → cellular organisms → Bacteria → Proteobacteria5837Open in IMG/M
(restricted) 3300024052|Ga0255050_10201273Not Available502Open in IMG/M
3300024262|Ga0210003_1028614All Organisms → cellular organisms → Bacteria → Proteobacteria3167Open in IMG/M
3300024344|Ga0209992_10021524All Organisms → cellular organisms → Bacteria → Proteobacteria3471Open in IMG/M
3300025070|Ga0208667_1000006All Organisms → cellular organisms → Bacteria110075Open in IMG/M
3300025099|Ga0208669_1002412All Organisms → cellular organisms → Bacteria → Proteobacteria6440Open in IMG/M
3300025099|Ga0208669_1018644All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1813Open in IMG/M
3300025101|Ga0208159_1094837Not Available540Open in IMG/M
3300025120|Ga0209535_1062349All Organisms → cellular organisms → Bacteria1512Open in IMG/M
3300025131|Ga0209128_1213029Not Available537Open in IMG/M
3300025133|Ga0208299_1028232All Organisms → cellular organisms → Bacteria2371Open in IMG/M
3300025168|Ga0209337_1018258Not Available4158Open in IMG/M
3300025237|Ga0208031_1001055All Organisms → cellular organisms → Bacteria → Proteobacteria4313Open in IMG/M
3300025276|Ga0208814_1116724Not Available646Open in IMG/M
3300025543|Ga0208303_1006344All Organisms → cellular organisms → Bacteria → Proteobacteria3953Open in IMG/M
3300025645|Ga0208643_1092960Not Available839Open in IMG/M
3300025652|Ga0208134_1036649All Organisms → cellular organisms → Bacteria → Proteobacteria1670Open in IMG/M
3300025655|Ga0208795_1004893All Organisms → cellular organisms → Bacteria → Proteobacteria5207Open in IMG/M
3300025803|Ga0208425_1123347Not Available590Open in IMG/M
3300025806|Ga0208545_1043774All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Colwellia → unclassified Colwellia → Colwellia sp.1363Open in IMG/M
3300025815|Ga0208785_1078598All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.853Open in IMG/M
3300025822|Ga0209714_1148149Not Available600Open in IMG/M
3300025869|Ga0209308_10128241All Organisms → cellular organisms → Bacteria → Proteobacteria1191Open in IMG/M
3300025876|Ga0209223_10134907All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1290Open in IMG/M
3300025880|Ga0209534_10348947Not Available660Open in IMG/M
3300025890|Ga0209631_10448896Not Available587Open in IMG/M
3300026125|Ga0209962_1048364All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Colwellia → unclassified Colwellia → Colwellia sp.716Open in IMG/M
3300027780|Ga0209502_10468741Not Available501Open in IMG/M
(restricted) 3300027861|Ga0233415_10543217Not Available564Open in IMG/M
3300028018|Ga0256381_1050645Not Available638Open in IMG/M
3300029632|Ga0135266_102089All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Colwellia → unclassified Colwellia → Colwellia sp.1073Open in IMG/M
3300031519|Ga0307488_10088554All Organisms → cellular organisms → Bacteria2284Open in IMG/M
3300031519|Ga0307488_10137388All Organisms → cellular organisms → Bacteria1729Open in IMG/M
3300031566|Ga0307378_10431673All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Balneolaeota → Balneolia → Balneolales → Balneolaceae → Balneola → unclassified Balneola → Balneola sp.1201Open in IMG/M
3300031566|Ga0307378_10620713All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Colwelliaceae → Colwellia → unclassified Colwellia → Colwellia sp.944Open in IMG/M
3300031578|Ga0307376_10976105Not Available512Open in IMG/M
3300032274|Ga0316203_1018719Not Available2046Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine20.47%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous17.32%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine9.45%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater7.87%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh4.72%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean3.15%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.15%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.94%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine3.94%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface2.36%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine2.36%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil2.36%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.57%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.57%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.57%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.57%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface1.57%
Hypersaline Lake SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment1.57%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater0.79%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.79%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.79%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.79%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.79%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.79%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.79%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.79%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment0.79%
Saline Water And SedimentEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Epilimnion → Saline Water And Sediment0.79%
MarineEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine0.79%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.79%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300001853Marine viral communities from the Subarctic Pacific Ocean - LP-49EnvironmentalOpen in IMG/M
3300002144Marine microbial communities from the Baltic Sea, analyzing arctic terrigenous carbon compounds - M2t2BS2 (113f)EnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005512Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline_waterEnvironmentalOpen in IMG/M
3300005613Saline sediment microbial communities from Etoliko Lagoon, Greece - sedimentEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006164Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNAEnvironmentalOpen in IMG/M
3300006193Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNAEnvironmentalOpen in IMG/M
3300006425Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007229Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300007718Estuarine microbial communities from the Columbia River estuary - metaG 1370A-3EnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009414Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_906EnvironmentalOpen in IMG/M
3300009428Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55EnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009443Pelagic marine microbial communities from North Sea - COGITO_mtgs_110421EnvironmentalOpen in IMG/M
3300009481Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaGEnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010883western Arctic Ocean co-assemblyEnvironmentalOpen in IMG/M
3300011253Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeateEnvironmentalOpen in IMG/M
3300011254Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017721Marine viral communities from the Subarctic Pacific Ocean - Lowphox_09 viral metaGEnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017756Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017991Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_2 metaGEnvironmentalOpen in IMG/M
3300018080Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_1_D_1 metaGEnvironmentalOpen in IMG/M
3300018416Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019096Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1EnvironmentalOpen in IMG/M
3300019122Metatranscriptome of marine microbial communities from Baltic Sea - GS677_0p1EnvironmentalOpen in IMG/M
3300019459Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300019751Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW18Oct16_MGEnvironmentalOpen in IMG/M
3300020388Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021371Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300022074Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2)EnvironmentalOpen in IMG/M
3300022158Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 (v3)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022907Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011511BT metaGEnvironmentalOpen in IMG/M
3300024052 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_5EnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024344Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025131Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025237Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_38 (SPAdes)EnvironmentalOpen in IMG/M
3300025276Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025655Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025815Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025822Pelagic marine microbial communities from North Sea - COGITO_mtgs_110414 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025876Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes)EnvironmentalOpen in IMG/M
3300025880Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026125Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MG (SPAdes)EnvironmentalOpen in IMG/M
3300027780Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300028018Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 1600mEnvironmentalOpen in IMG/M
3300029632Marine harbor viral communities from the Pacific Ocean - SMB3EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1004539313300000101MarineGMLSLNIPQYLCVYEVNNAIHLILLQARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTHHISLTIH*
DelMOSum2010_1010770533300000101MarineMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPAHHISLTIH*
DelMOSum2010_1011078913300000101MarineVGMLSLNIPQYLCVYEVNNAIHLILLQARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTHHISLTIH*
DelMOSum2010_1011976213300000101MarineMLFPSIPQYLCVYESNNEINLIVLQARNSDTAEMFTLLRSMEESLDYSFGKILDVSEVDPTHHISLTIH*
DelMOSum2010_1015850423300000101MarineTSTINKNYARIIGMLFPSIPQYLCVYESNNDIHLVVLQARNSDVAELFALLRSMEESSDYTFGKILDVSEVDPTHHISLTIH*
DelMOSum2011_1008360523300000115MarineMLFPSIPQYLCVYEIDSNLHMVVLQAKNSDTAELFALLRSMEESSDYTFGKILDVSEIDPTHQVSLTIH*
DelMOSum2011_1014018533300000115MarineMLFPSIPQYLCVYEVDSNLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHQVSLTIH*
DelMOSpr2010_1003844653300000116MarineMLSLXIPQYLCVYEVNNAIHLILLQARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTHHISLTIH*
DelMOSpr2010_1009380523300000116MarineMLFPSIPQYLCVYEVDSNLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHHVSLTIH*
DelMOSpr2010_1011638513300000116MarineMLFPSIPQYLCVYESNNEINLIVLQARNSDTAEMFTLLRSMEESLDYSFGKILDVSEVDPTHHIS
DelMOSpr2010_1020216823300000116MarineMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPSHHISLTIH*
DelMOSpr2010_1023651913300000116MarineMLFPSIPQYLCVYESNNDIHLVVLQARNSDVAELFALLRSMEESSDYTFGKILDVSKVDPTHHISLTIH*
BBAY92_1000292153300000947Macroalgal SurfaceMLFPSIPQYLCVYEVDSDLHMVVLQARNSDTAELFALLRSMEDSDNHSFGKILDVSELDPTHHVSLTIH*
JGI24006J15134_1002774933300001450MarineMLSPNIPQYLCVYEVNNAIHLILLQARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTHHISLTIH*
JGI24004J15324_1012581023300001472MarineMLSLNIPQYLCVYEVNNAIHLILLQARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTXHISLTIH*
JGI24005J15628_1010127133300001589MarineMLSLNIPQYLCVYEVNNAIHLILXQARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTHHISLTIH*
JGI24524J20080_101446813300001853MarineVGMLSLNIPQYLCVYEVNNAIHLILLXARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTHHISLTIH*
M2t2BS2_1116505933300002144MarineMLSYQIPQYLCVYEVDSNIHLIVLRARNADTAELFVLLQSIQESSSFVAGKILDVSEIDPTHYISLTIH*
Ga0065861_102845823300004448MarineMLSLNIPQYLCVYEVNNAIHLILLQARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTHHISLTIH*
Ga0074648_1006654103300005512Saline Water And SedimentMLFPSIPQYLCVYEVDSDLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHHVSLTIH*
Ga0074649_1007426103300005613Saline Water And SedimentMLFPSIPQYLCVYEVDSNLHMVVLQAKNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHQVSLTIH*
Ga0075478_1013747523300006026AqueousKNYARIIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPSHHISLTIH*
Ga0075466_102650133300006029AqueousMLFPNIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPAHHISLTIH*
Ga0075441_1002544843300006164MarineMFLSNIPQYLCVYEVDDDIHLVILQARNATQAELFAVLQSMEDSSVDLILGKILDVSELDPSHHISLTIH*
Ga0075441_1006865813300006164MarineMLLPNTPHYLCVYEVNNDIHLVVLQAKNADLAELFVLLQSLEESSDFIAGKILDVSKIDPAHHISLTIH*
Ga0075445_1015969913300006193MarineIPQYLCVYEVDDDIHLVILQARNATQAELFAVLQSMEDSSVDLILGKILDVSELDPSHHISLTIH*
Ga0075486_166475513300006425AqueousEVDSNLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHQVSLTIH*
Ga0098038_124196423300006735MarineLCTSTINKNYARIIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPAHHISLTIH*
Ga0098038_128485723300006735MarineMIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEDSSDYTFGKILDVSEIDPAHHISLTIH*
Ga0098048_109820123300006752MarineMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFTLLRSMEESSDYTFGKILDVSEIDPAHHISLTIH*
Ga0070754_1020433913300006810AqueousTINKNYARIIGMLFPSIPQYLCVYEIDSNLHMVVLQAKNSDTAELFALLRSMEESSDYTFGKILDVSEIDPSHHISLTIH*
Ga0070746_1047762723300006919AqueousMLFPSIPQYLCVYESNNDIHLVVLQARNSDVAELFALLRSMEESSDYTFGKILDVSEVDPTHHISLTIH*
Ga0070746_1049302223300006919AqueousMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEDSSDYTFGKILDVSEIDPSHHISLTIH*
Ga0070746_1053708423300006919AqueousCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKISDVSEIDPAHHISLTIH*
Ga0098060_102978433300006921MarineLCTSTINKNYARIIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFTLLRSMEESSDYTFGKILDVSEIDPAHHISLTIH*
Ga0098041_128491423300006928MarineEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYSFGKILDVSEVDPTHHISLTIH*
Ga0098036_108560023300006929MarineRIIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPAHHISLTIH*
Ga0075468_1010646823300007229AqueousCTSTINKNYARIIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPSHHISLTIH*
Ga0075468_1011227913300007229AqueousMLFPSIPQYLCVYEIDSNLHMIVLQARNSDTAELFTLLRSMEESSDYTFGKILDVSEIDPAHHISLTIH*
Ga0102852_109273113300007718EstuarineTSTINKNYARIIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFTLLRSMEESSDYTFGKILDVSEIDPAHHISLTIH*
Ga0110931_102067213300007963MarineIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPTHQVSLTIH*
Ga0110931_109377013300007963MarineVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPAHHISLTIH*
Ga0115552_111944223300009077Pelagic MarineMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSELDPTHHVSLTIH*
Ga0114918_1010058013300009149Deep SubsurfaceMLFPSIPQYLCVYESNNDIHLVVLQARNSDVAELFALLRSMEESSDYTFGKILDVSELDPTHHVSLTIH*
Ga0114909_115171613300009414Deep OceanIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPAHHISLTIH*
Ga0114915_102673033300009428Deep OceanMLSLNIPQYLCVYEVNNAIHLILLQARDADTAELFTLLKTMEERFDFTMGKILDVSKVDPTHHISLTIH*
Ga0115546_124865123300009435Pelagic MarineMIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPAHHISLTIH*
Ga0115557_118029423300009443Pelagic MarineARIIGMLFPSIPQYLCVYEVDSNLHMVVLQAKNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHHVSLTIH*
Ga0114932_1003950353300009481Deep SubsurfaceMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEINPTHHISLTIH*
Ga0115003_1018273333300009512MarineRIVGMLSLNIPQYLCVYEVNNAIHLILLQARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTHHISLTIH*
Ga0114919_1002582653300009529Deep SubsurfaceMLFPSIPQYLCVYEVDSNLHMVVLQAKNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHHVSLTIH*
Ga0098056_125028013300010150MarineIIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFTLLRSMEESSDYTFGKILDVSEIDPAHHISLTIH*
Ga0098056_125961623300010150MarineMLFPSIPQYLCVYELNNEINLVVLQARNSDTAELFALLRSMEESSDYSFGKILDVSEVDPTHHISLTIH*
Ga0133547_1063732743300010883MarineMLSYQIPQYLCVYEVDNDIHLMVLRARNADTAELFVLLQSIQESSSFVAGKILDVSEIDPTHYISLTIH*
Ga0151671_103635513300011253MarineMLFPSIPQYLCVYEIDNNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPTHHISLTIH
Ga0151675_102119033300011254MarineMLFPSIPQYLCVYELNNNLHLVVLQARNSDVAELFALLRSMEESSDYTFGKILDVSEVDPTHHISLTIH*
Ga0181403_103550623300017710SeawaterMIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEDSSDYTFGKILDVSEIDPAHHISLTIH
Ga0181391_104695333300017713SeawaterMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEDSSDYTFGKILDVSEI
Ga0181404_108615513300017717SeawaterMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSIEESSDYTFGKILDVSEIDPAHH
Ga0181373_104946423300017721MarineMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFTLLRSMEESSDYTFGKILDVSEIDAAHHISLTIH
Ga0181381_102469023300017726SeawaterMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEDSSDYTFGKILDVSEIDPAHHISLTIH
Ga0181431_113182313300017735SeawaterKNYARIIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPTHQVSLTIH
Ga0181382_103919723300017756SeawaterMIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFTLLRSMEESSDYTFGKILDVSEIDPAHHISLTIH
Ga0181422_103460633300017762SeawaterTSTINKNYARIIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPTHQVSLTIH
Ga0181410_103463323300017763SeawaterMLFPNIPQYLCVYEIDSNLHMVVLQARNSDTAELFTLLRSMEESSDYTFGKILDVSEIDPAHHISLTIH
Ga0181385_107834413300017764SeawaterMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEDSSDYTFGKILDVSEID
Ga0181607_1051993723300017950Salt MarshMIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEDSSDYTFGKILDVSEIDPSHHISLTIH
Ga0180434_1013150833300017991Hypersaline Lake SedimentMLFPSIPQYLCVYEVDSNLHMVVLQARNSDTAELFALLRSMEESDNYSFGKILDVSELDPTHQVSLTIH
Ga0180433_1095234413300018080Hypersaline Lake SedimentMLFPSIPQYLCVYEVDSNLHMVVLQARNSDTAELFALLRSMEESDNYSFGKILDVSELDPTHHVSLTIH
Ga0181553_1070876823300018416Salt MarshMIGMLFPSIPQYLCVYEVDSDLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSEIDPTHHISLTIH
Ga0181563_1049479533300018420Salt MarshMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEDSSDYTFGKILDVS
Ga0181563_1054907423300018420Salt MarshYTSTINKNYARIIGMLFPSIPQYLCVYEVDSNLHMVVLQAKNSDTAELFALLRSMEDSDNYSFGKILDVSEIDPTHHISLTIH
Ga0188835_101396523300019096Freshwater LakeMLSYQIPQYLCVYEVDSNIHLIVLRARNADTAELFVLLQSIQESSSFVAGKILDVSEIDPTHYISLTIH
Ga0188839_100774333300019122Freshwater LakeMLSYQIPQYLCVYEVDNDIHLIVLRARNADTAELFVLLQSIQESSSFVAGKILDVSEIDPTHYISLTIH
Ga0181562_1002874153300019459Salt MarshMLFPSIPQYLCVYEVDSNLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHQVSLTIH
Ga0194029_102405523300019751FreshwaterMLFPSIPQYLCVYEVDSNLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSEIDPSHHISLTIH
Ga0211678_1023342013300020388MarineMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPAHHISLTIH
Ga0213859_1021253633300021364SeawaterMINKNYARIICMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEDSSDYTFGKILDVSEIDPAHHISLTIH
Ga0213863_10000357173300021371SeawaterMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPSHHISLTIH
Ga0213865_1016352733300021373SeawaterMINKNYARIICMLFPSIPQYLCVYEVDSDLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSEIDPTHHISLTIH
Ga0213869_1019874313300021375SeawaterKNYARIIGMLFPSIPQYLCVYESNNDIHLVVLQARNSDVAELFALLRSMEESSDYTFGKILDVSKVDPTHHISLTIH
Ga0213861_1033563523300021378SeawaterMLFPSIPQYLCVYESNNDIHLVVLQARNSDVAELFALLRSMEESSDYTFGKILDVSKVDPTHHISLTIH
Ga0222718_1005495423300021958Estuarine WaterMLFPSIPQYLCVYEVDSNLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHHVSLTIH
Ga0196889_102380323300022072AqueousMLFPNIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPAHHISLTIH
Ga0196889_104402413300022072AqueousVGMLSLNIPQYLCVYEVNNAIHLILLQARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTHHISLTIH
Ga0224906_103766333300022074SeawaterMQXLLYTSTINKNYARIIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPTHQVSLTIH
Ga0196897_102552323300022158AqueousMLFPSIPQYLCVYEVDSNLHMVVLQAKNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHHVSLTIH
Ga0196887_100148453300022178AqueousMLSLNIPQYLCVYEVNNAIHLILLQARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTHHISLTIH
Ga0196887_107336213300022178AqueousMLFPSIPQYLCVYESNNEINLIVLQARNSDTAEMFTLLRSMEESLDYSFGKILDVSEVDPTHHISLTIH
Ga0196901_122662713300022200AqueousMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPSHHI
Ga0255775_1011466103300022907Salt MarshMLFPSIPQYLCVYEVDSNLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHQVSLTVH
(restricted) Ga0255050_1020127323300024052SeawaterVGMLSLKIPQYLCVYEVNNAIHLILLQARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTHHISLTIH
Ga0210003_102861453300024262Deep SubsurfaceMLFPSIPQYLCVYEVDSDLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHHVSLTIH
Ga0209992_1002152453300024344Deep SubsurfaceMLFPSIPQYLCVYEIDSSLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEINPTHHISLTIH
Ga0208667_10000061173300025070MarineMIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPAHHISLTIH
Ga0208669_100241293300025099MarineMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFTLLRSMEESSDYTFGKILDVSEIDPAHHISLTIH
Ga0208669_101864433300025099MarineMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPTHQVSLTIH
Ga0208159_109483723300025101MarineMLFPNIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDP
Ga0209535_106234943300025120MarineVGMLSLNIPQYLCVYEVNNAIHLILLQARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTHH
Ga0209128_121302923300025131MarineMLFPNIPQYLCVYELNNEINLVVLQAKNSDTAELFALLRSMEESLDYSFGKILDVSEVDPTHHISLTIH
Ga0208299_102823233300025133MarineMLFPSIPQYLCVYELNNEINLVVLQARNSDTAELFALLRSMEESSDYSFGKILDVSEVDPTHHISLTIH
Ga0209337_101825813300025168MarineMLSPNIPQYLCVYEVNNAIHLILLQARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTHHISLTIH
Ga0208031_100105533300025237Deep OceanMFLSNIPQYLCVYEVDDDIHLVILQARNATQAELFAVLQSMEDSSVDLILGKILDVSELDPSHHISLTIH
Ga0208814_111672423300025276Deep OceanMLLPNTPHYLCVYEVNNDIHLVVLQAKNADLAELFVLLQSLEESSDFIAGKILDVSKIDPAHHISLTIH
Ga0208303_100634443300025543AqueousMLFPSIPQYLCVYEVDSNLHMVVLQAKNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHQVSLTIH
Ga0208643_109296013300025645AqueousIIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPAHHISLTIH
Ga0208134_103664913300025652AqueousNKNYARIIGMLFPNIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPAHHISLTIH
Ga0208795_100489383300025655AqueousMLFPSISQYLCVYEVDSNLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHQVSLTIH
Ga0208425_112334733300025803AqueousMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEI
Ga0208545_104377433300025806AqueousMIGMLFPSIPQYLCVYEIDSNLHMIVLQARNSDTAELFTLLRSMEESSDYTFGKILDVSEIDPAHHISLTIH
Ga0208785_107859813300025815AqueousMLFPSIPQYLCVYEVDSNLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHYV
Ga0209714_114814923300025822Pelagic MarineVYESNNDIHLVVLQARNSDVAELFALLRSMEESSDYTFGKILDVSELDPTHHVSLTIH
Ga0209308_1012824133300025869Pelagic MarineRIIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPAHHISLTIH
Ga0209223_1013490723300025876Pelagic MarineMLFPSIPQYLCVYESNNDIHLVVLQARNSDVAELFALLRSMEESSDYTFGKILDVSELDPTHHVSLTIH
Ga0209534_1034894723300025880Pelagic MarineSTINKNYARIIGMLFPSIPQYLCVYESNNDIHLVVLQARNSDVAELFALLRSMEESSDYTFGKILDVSELDPTHHVSLTIH
Ga0209631_1044889623300025890Pelagic MarineMLFPNIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHHVSLTIH
Ga0209962_104836423300026125WaterVYEVDSNLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHHVSLTIH
Ga0209502_1046874113300027780MarineVGMLSLNIPQYLCVYEVNNAIHLILLQARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTHHISL
(restricted) Ga0233415_1054321723300027861SeawaterMLFPSIPQYLCVYEVDSNLHMVVLQARNSDTAELFALFRSMEDSDNYSFGKILDVSELDPTHHVSLTIH
Ga0256381_105064523300028018SeawaterMQXLLYTSTINKNYARIIGMLFPSIPQYLCVYEIDSNLHMVVLQARNSDTAELFALLRSMEESSDYTFGKILDVSEIDPAHHISLTIH
Ga0135266_10208913300029632Marine HarborHLEFFQNYDCRCFPVTINTSYARIVGMLFPSIPQYLCVYEVDSDLHMVVLQARNSDTAELFALLRSMEDSDNHSFGKILDVSELDPTHHVSLTIH
Ga0307488_1008855443300031519Sackhole BrineVGMLSLNIPQYLCVYEVNNAIHLILLKARDADTAELFTLLKTMEESFDFTMGKILDVSKVDPTHHISLTIH
Ga0307488_1013738823300031519Sackhole BrineMLSYEIPQYLCVYEVDNDIHLMVLRARNADTAELFVLLQSIQESSSFVAGKILDVSEIDPTHYISLTIH
Ga0307378_1043167313300031566SoilMLSYQIPQYLCVYEVDNDIHLIVLRARNADTAELFVLLQSIQESSSFVAGKILDVSEID
Ga0307378_1062071313300031566SoilEVDSNIHLIVLRARNADTAELFVLLQSIQESSSFVAGKILDVSEIDPTHYISLTIH
Ga0307376_1097610523300031578SoilMLSYQIPQYLCVYEVDNNIHLIVLRARNADTAELFVLLQSIQESSSFVAGKILDVSEIDPTHYISLTIH
Ga0316203_101871913300032274Microbial MatMLFPSIPQYLCVYEVDSDLHMVVLQARNSDTAELFALLRSMEDSDNYSFGKILDVSELDPTHQVSLTIH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.