NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F066099

Metagenome / Metatranscriptome Family F066099

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F066099
Family Type Metagenome / Metatranscriptome
Number of Sequences 127
Average Sequence Length 40 residues
Representative Sequence MGVDNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR
Number of Associated Samples 109
Number of Associated Scaffolds 127

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 54.84 %
% of genes near scaffold ends (potentially truncated) 41.73 %
% of genes from short scaffolds (< 2000 bps) 80.31 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.764 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(15.748 % of family members)
Environment Ontology (ENVO) Unclassified
(27.559 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.819 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 46.27%    β-sheet: 0.00%    Coil/Unstructured: 53.73%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 127 Family Scaffolds
PF02627CMD 33.86
PF01557FAA_hydrolase 14.17
PF07883Cupin_2 2.36
PF00072Response_reg 1.57
PF13343SBP_bac_6 1.57
PF09298FAA_hydrolase_N 1.57
PF03401TctC 0.79
PF13356Arm-DNA-bind_3 0.79
PF02615Ldh_2 0.79
PF12697Abhydrolase_6 0.79
PF04392ABC_sub_bind 0.79
PF03480DctP 0.79
PF00892EamA 0.79
PF00905Transpeptidase 0.79

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 127 Family Scaffolds
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 33.86
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 33.86
COG01792-keto-4-pentenoate hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase (catechol pathway)Secondary metabolites biosynthesis, transport and catabolism [Q] 1.57
COG2055Malate/lactate/ureidoglycolate dehydrogenase, LDH2 familyEnergy production and conversion [C] 0.79
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.79
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 0.79


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.76 %
UnclassifiedrootN/A10.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16478999All Organisms → cellular organisms → Bacteria → Proteobacteria1008Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0550985Not Available813Open in IMG/M
3300000559|F14TC_101754500All Organisms → cellular organisms → Bacteria → Proteobacteria1158Open in IMG/M
3300000559|F14TC_105555940Not Available522Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1064829Not Available646Open in IMG/M
3300000858|JGI10213J12805_11139778All Organisms → cellular organisms → Bacteria → Proteobacteria551Open in IMG/M
3300001305|C688J14111_10148011All Organisms → cellular organisms → Bacteria → Proteobacteria721Open in IMG/M
3300002906|JGI25614J43888_10005705All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria4003Open in IMG/M
3300002917|JGI25616J43925_10032225All Organisms → cellular organisms → Bacteria → Proteobacteria2316Open in IMG/M
3300004267|Ga0066396_10094667All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium545Open in IMG/M
3300004479|Ga0062595_101740424All Organisms → cellular organisms → Bacteria → Proteobacteria589Open in IMG/M
3300005167|Ga0066672_10233178All Organisms → cellular organisms → Bacteria1181Open in IMG/M
3300005184|Ga0066671_10391183All Organisms → cellular organisms → Bacteria → Proteobacteria888Open in IMG/M
3300005332|Ga0066388_101617354All Organisms → cellular organisms → Bacteria → Proteobacteria1141Open in IMG/M
3300005332|Ga0066388_108061395All Organisms → cellular organisms → Bacteria → Proteobacteria526Open in IMG/M
3300005332|Ga0066388_108637731Not Available506Open in IMG/M
3300005332|Ga0066388_108760164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium502Open in IMG/M
3300005363|Ga0008090_10057415All Organisms → cellular organisms → Bacteria1237Open in IMG/M
3300005363|Ga0008090_10250539All Organisms → cellular organisms → Bacteria798Open in IMG/M
3300005434|Ga0070709_10068717All Organisms → cellular organisms → Bacteria2279Open in IMG/M
3300005435|Ga0070714_101354055All Organisms → cellular organisms → Bacteria → Proteobacteria695Open in IMG/M
3300005436|Ga0070713_100127258All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2242Open in IMG/M
3300005445|Ga0070708_101149592All Organisms → cellular organisms → Bacteria → Proteobacteria727Open in IMG/M
3300005518|Ga0070699_100019097All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales5896Open in IMG/M
3300005553|Ga0066695_10635041All Organisms → cellular organisms → Bacteria → Proteobacteria635Open in IMG/M
3300005562|Ga0058697_10384308All Organisms → cellular organisms → Bacteria692Open in IMG/M
3300005713|Ga0066905_100345837All Organisms → cellular organisms → Bacteria → Proteobacteria1186Open in IMG/M
3300005713|Ga0066905_100347054All Organisms → cellular organisms → Bacteria1184Open in IMG/M
3300005713|Ga0066905_102229015Not Available511Open in IMG/M
3300005764|Ga0066903_100457880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2136Open in IMG/M
3300005764|Ga0066903_101451771All Organisms → cellular organisms → Bacteria1292Open in IMG/M
3300005764|Ga0066903_104658191All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae730Open in IMG/M
3300005764|Ga0066903_107483204Not Available563Open in IMG/M
3300005843|Ga0068860_100109313All Organisms → cellular organisms → Bacteria → Proteobacteria2642Open in IMG/M
3300005937|Ga0081455_10004584All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales15440Open in IMG/M
3300005981|Ga0081538_10101928All Organisms → cellular organisms → Bacteria → Proteobacteria1442Open in IMG/M
3300006038|Ga0075365_10081928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2187Open in IMG/M
3300006038|Ga0075365_10850864All Organisms → cellular organisms → Bacteria → Proteobacteria643Open in IMG/M
3300006172|Ga0075018_10563407All Organisms → cellular organisms → Bacteria → Proteobacteria601Open in IMG/M
3300006175|Ga0070712_100396130All Organisms → cellular organisms → Bacteria → Proteobacteria1139Open in IMG/M
3300006178|Ga0075367_10800111All Organisms → cellular organisms → Bacteria → Proteobacteria600Open in IMG/M
3300006844|Ga0075428_100029454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria6074Open in IMG/M
3300006845|Ga0075421_100223623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2318Open in IMG/M
3300006854|Ga0075425_100181162All Organisms → cellular organisms → Bacteria2420Open in IMG/M
3300006871|Ga0075434_100373072All Organisms → cellular organisms → Bacteria → Proteobacteria1448Open in IMG/M
3300009089|Ga0099828_11167956Not Available683Open in IMG/M
3300009090|Ga0099827_10025348All Organisms → cellular organisms → Bacteria → Proteobacteria4199Open in IMG/M
3300009147|Ga0114129_11218950All Organisms → cellular organisms → Bacteria → Proteobacteria936Open in IMG/M
3300010046|Ga0126384_10122994All Organisms → cellular organisms → Bacteria1955Open in IMG/M
3300010048|Ga0126373_12318461All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300010154|Ga0127503_10255268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300010154|Ga0127503_10438122All Organisms → cellular organisms → Bacteria → Proteobacteria944Open in IMG/M
3300010154|Ga0127503_10942178All Organisms → cellular organisms → Bacteria → Proteobacteria672Open in IMG/M
3300010303|Ga0134082_10535653Not Available514Open in IMG/M
3300010358|Ga0126370_10502499All Organisms → cellular organisms → Bacteria → Proteobacteria1025Open in IMG/M
3300010358|Ga0126370_10716658All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium881Open in IMG/M
3300010358|Ga0126370_10840962All Organisms → cellular organisms → Bacteria → Proteobacteria823Open in IMG/M
3300010361|Ga0126378_11640983All Organisms → cellular organisms → Bacteria → Proteobacteria730Open in IMG/M
3300010362|Ga0126377_12261576All Organisms → cellular organisms → Bacteria → Proteobacteria620Open in IMG/M
3300010366|Ga0126379_10209788All Organisms → cellular organisms → Bacteria → Proteobacteria1882Open in IMG/M
3300010366|Ga0126379_11233322Not Available854Open in IMG/M
3300010376|Ga0126381_100839068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1321Open in IMG/M
3300011119|Ga0105246_12398319All Organisms → cellular organisms → Bacteria → Proteobacteria517Open in IMG/M
3300011271|Ga0137393_11511888All Organisms → cellular organisms → Bacteria → Proteobacteria561Open in IMG/M
3300012198|Ga0137364_10353397All Organisms → cellular organisms → Bacteria → Proteobacteria1097Open in IMG/M
3300012200|Ga0137382_10453098All Organisms → cellular organisms → Bacteria → Proteobacteria908Open in IMG/M
3300012204|Ga0137374_10034675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5446Open in IMG/M
3300012208|Ga0137376_11655098All Organisms → cellular organisms → Bacteria → Proteobacteria531Open in IMG/M
3300012923|Ga0137359_10145173All Organisms → cellular organisms → Bacteria2114Open in IMG/M
3300012951|Ga0164300_10200918All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300012986|Ga0164304_10325204All Organisms → cellular organisms → Bacteria → Proteobacteria1064Open in IMG/M
3300014166|Ga0134079_10490464All Organisms → cellular organisms → Bacteria → Proteobacteria591Open in IMG/M
3300016357|Ga0182032_10400930All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300016387|Ga0182040_11139483All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300018000|Ga0184604_10235600All Organisms → cellular organisms → Bacteria → Proteobacteria638Open in IMG/M
3300018468|Ga0066662_10567438All Organisms → cellular organisms → Bacteria1053Open in IMG/M
3300018482|Ga0066669_10607004All Organisms → cellular organisms → Bacteria → Proteobacteria959Open in IMG/M
3300020170|Ga0179594_10086761All Organisms → cellular organisms → Bacteria → Proteobacteria1110Open in IMG/M
3300020580|Ga0210403_10608691All Organisms → cellular organisms → Bacteria → Proteobacteria882Open in IMG/M
3300020581|Ga0210399_11047464All Organisms → cellular organisms → Bacteria → Proteobacteria655Open in IMG/M
3300021168|Ga0210406_10129048All Organisms → cellular organisms → Bacteria → Proteobacteria2133Open in IMG/M
3300021560|Ga0126371_10345564All Organisms → cellular organisms → Bacteria → Proteobacteria1622Open in IMG/M
3300021560|Ga0126371_11232562All Organisms → cellular organisms → Bacteria884Open in IMG/M
3300021953|Ga0213880_10097804All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300025910|Ga0207684_11552383All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium537Open in IMG/M
3300025915|Ga0207693_10489479All Organisms → cellular organisms → Bacteria → Proteobacteria960Open in IMG/M
3300025916|Ga0207663_10104575All Organisms → cellular organisms → Bacteria1909Open in IMG/M
3300025916|Ga0207663_10629588All Organisms → cellular organisms → Bacteria → Proteobacteria845Open in IMG/M
3300025938|Ga0207704_10439280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601039Open in IMG/M
3300025961|Ga0207712_10359813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601212Open in IMG/M
3300025981|Ga0207640_10082939All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68602197Open in IMG/M
3300026078|Ga0207702_12449202All Organisms → cellular organisms → Bacteria → Proteobacteria509Open in IMG/M
3300026306|Ga0209468_1139127All Organisms → cellular organisms → Bacteria → Proteobacteria666Open in IMG/M
3300026310|Ga0209239_1002603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales10716Open in IMG/M
3300026494|Ga0257159_1063457All Organisms → cellular organisms → Bacteria → Proteobacteria633Open in IMG/M
3300026514|Ga0257168_1088078All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300027873|Ga0209814_10094582All Organisms → cellular organisms → Bacteria1265Open in IMG/M
3300027907|Ga0207428_10725434All Organisms → cellular organisms → Bacteria → Proteobacteria710Open in IMG/M
3300028784|Ga0307282_10285295All Organisms → cellular organisms → Bacteria → Proteobacteria795Open in IMG/M
3300028885|Ga0307304_10589242All Organisms → cellular organisms → Bacteria → Proteobacteria514Open in IMG/M
3300030903|Ga0308206_1193757All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300030905|Ga0308200_1017873All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC68601103Open in IMG/M
3300031091|Ga0308201_10188520All Organisms → cellular organisms → Bacteria → Proteobacteria674Open in IMG/M
3300031152|Ga0307501_10143535All Organisms → cellular organisms → Bacteria → Proteobacteria643Open in IMG/M
3300031184|Ga0307499_10138345All Organisms → cellular organisms → Bacteria704Open in IMG/M
3300031543|Ga0318516_10000509All Organisms → cellular organisms → Bacteria → Proteobacteria12444Open in IMG/M
3300031544|Ga0318534_10405304All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300031545|Ga0318541_10036350All Organisms → cellular organisms → Bacteria → Proteobacteria2473Open in IMG/M
3300031561|Ga0318528_10141118All Organisms → cellular organisms → Bacteria1280Open in IMG/M
3300031564|Ga0318573_10267600All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300031640|Ga0318555_10125522All Organisms → cellular organisms → Bacteria1365Open in IMG/M
3300031680|Ga0318574_10728472All Organisms → cellular organisms → Bacteria → Proteobacteria581Open in IMG/M
3300031716|Ga0310813_10966950All Organisms → cellular organisms → Bacteria → Proteobacteria775Open in IMG/M
3300031740|Ga0307468_101241658All Organisms → cellular organisms → Bacteria → Proteobacteria674Open in IMG/M
3300031764|Ga0318535_10013426All Organisms → cellular organisms → Bacteria → Proteobacteria2995Open in IMG/M
3300031792|Ga0318529_10367058All Organisms → cellular organisms → Bacteria → Proteobacteria670Open in IMG/M
3300031794|Ga0318503_10037809All Organisms → cellular organisms → Bacteria → Proteobacteria1438Open in IMG/M
3300031795|Ga0318557_10102383All Organisms → cellular organisms → Bacteria1267Open in IMG/M
3300031890|Ga0306925_10135409All Organisms → cellular organisms → Bacteria → Proteobacteria2645Open in IMG/M
3300031912|Ga0306921_11186277Not Available851Open in IMG/M
3300031941|Ga0310912_11363389All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300032009|Ga0318563_10359222All Organisms → cellular organisms → Bacteria → Proteobacteria788Open in IMG/M
3300032094|Ga0318540_10076670All Organisms → cellular organisms → Bacteria → Proteobacteria1544Open in IMG/M
3300032180|Ga0307471_101154455All Organisms → cellular organisms → Bacteria → Proteobacteria940Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.75%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil10.24%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil9.45%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil7.87%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil7.09%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.51%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.51%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.15%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.94%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil2.36%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.36%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere2.36%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.57%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.57%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.57%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere1.57%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil1.57%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.79%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.79%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.79%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.79%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.79%
Exposed RockEnvironmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.79%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.79%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.79%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.79%
AgaveHost-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave0.79%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000559Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemlyEnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002906Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cmEnvironmentalOpen in IMG/M
3300002917Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cmEnvironmentalOpen in IMG/M
3300004267Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBioEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005562Agave microbial communities from Guanajuato, Mexico - As.Ma.eHost-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006038Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5Host-AssociatedOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300014166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021953Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R07EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026514Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-BEnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_022662602088090014SoilMGVDDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR
ICChiseqgaiiDRAFT_055098523300000033SoilMGVDDVDFLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR*
F14TC_10175450013300000559SoilMGVDNVLFLHRLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
F14TC_10555594013300000559SoilMGVDNVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRI
AF_2010_repII_A100DRAFT_106482923300000655Forest SoilMGVDDVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR*
JGI10213J12805_1113977823300000858SoilMALSVGDGIGAEDVIFLQRLLLHYGVYRRYPLRPWPALKNAWRIVLR*
C688J14111_1014801123300001305SoilAEETLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR*
JGI25614J43888_1000570523300002906Grasslands SoilMGVEHVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
JGI25616J43925_1003222523300002917Grasslands SoilMGVDNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
Ga0066396_1009466723300004267Tropical Forest SoilMGVNNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
Ga0062595_10174042423300004479SoilPIMGVDDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR*
Ga0066672_1023317823300005167SoilMGVDNVFFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
Ga0066671_1039118313300005184SoilMGVDDVVYLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR*
Ga0066388_10161735423300005332Tropical Forest SoilLDRAEWIGDNHVLTLRRLLLHYGVYRRYPLRPWPAFKNACRIVFR*
Ga0066388_10806139523300005332Tropical Forest SoilMGVDDVFFLQRLLLHYGIYRRYPLRRWPAFKNAWRVAFR*
Ga0066388_10863773113300005332Tropical Forest SoilMGVDDVVFLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR*
Ga0066388_10876016413300005332Tropical Forest SoilLALVDTEMGVDNVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR*
Ga0008090_1005741513300005363Tropical Rainforest SoilMGVDHVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
Ga0008090_1025053923300005363Tropical Rainforest SoilLALVDTEMGVDDVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR*
Ga0070709_1006871743300005434Corn, Switchgrass And Miscanthus RhizosphereMGVDDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR*
Ga0070714_10135405513300005435Agricultural SoilYHWSDTVQFLERLLLHYGIYRRYPLKPWPAFKNAWRIAFR*
Ga0070713_10012725813300005436Corn, Switchgrass And Miscanthus RhizosphereMGVNDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR*
Ga0070708_10114959213300005445Corn, Switchgrass And Miscanthus RhizosphereMGVEHVLFLQRLLLHYGVYRRYPLRPWPAFKNAWRIAFR*
Ga0070699_10001909773300005518Corn, Switchgrass And Miscanthus RhizosphereMGVDNVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR*
Ga0066695_1063504123300005553SoilVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR*
Ga0058697_1038430823300005562AgaveVQFLERLLLHYGIYRRYPLKPWPALKNAWRIAFR*
Ga0066905_10034583713300005713Tropical Forest SoilMGVDDVLFLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR*
Ga0066905_10034705423300005713Tropical Forest SoilMIGWNVHAGTALSVGDWDRAEDVVFLQRLLLHYGVYRRYPLRPWPALKNAWRIVVR*
Ga0066905_10222901513300005713Tropical Forest SoilVTFFERLLLHYRVYRGYPLAPWPAFKNACRIVFR*
Ga0066903_10045788043300005764Tropical Forest SoilMGVDHVRFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR*
Ga0066903_10145177123300005764Tropical Forest SoilMETIVLILQRLLLHYGVYRRYPLRRWPAFKNACRIVFR*
Ga0066903_10465819123300005764Tropical Forest SoilMVAFLRRFSLHYGIYRRYPLRPLKALKNAWRIARD*
Ga0066903_10748320413300005764Tropical Forest SoilVDTFNVGVDHVLFLQRLLLHYGIYRRYPLKPWPAFKN
Ga0068860_10010931333300005843Switchgrass RhizosphereLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR*
Ga0081455_1000458483300005937Tabebuia Heterophylla RhizosphereLLFLERLLLHYGIYRRYPLKPWPAFKNAWRIAFR*
Ga0081538_1010192833300005981Tabebuia Heterophylla RhizosphereVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRVAFR*
Ga0081540_113688223300005983Tabebuia Heterophylla RhizosphereSMVSTDGADSERIGTAAPVPALLDTRLDTKIWSRTLLFLERLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
Ga0075365_1008192823300006038Populus EndosphereLAFRLKKTLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR*
Ga0075365_1085086423300006038Populus EndosphereDEETLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR*
Ga0075018_1056340723300006172WatershedsMPRMGVDHVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRLAFR*
Ga0070712_10039613033300006175Corn, Switchgrass And Miscanthus RhizosphereDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR*
Ga0075367_1080011113300006178Populus EndospherePAGQFWRLGEETLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR*
Ga0075428_10002945463300006844Populus RhizosphereMGVDNVLFLERLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
Ga0075421_10022362333300006845Populus RhizosphereVTFIDRLLLHYKVYRGYPLAPWPAFKNACRIVFR*
Ga0075425_10018116243300006854Populus RhizosphereLVDTHNGVDDVVFLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR*
Ga0075434_10037307233300006871Populus RhizosphereVDTHNGVDDVVFLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR*
Ga0099828_1116795613300009089Vadose Zone SoilVAFLERLLLHYKVYRRYPLARWPAFKNACRIVFR*
Ga0099827_1002534833300009090Vadose Zone SoilLLFFERLLLHYGIYRRYPLKPWPAFKNAWRIVLR*
Ga0114129_1121895013300009147Populus RhizosphereMGVDNVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR*
Ga0126374_1145275623300009792Tropical Forest SoilMIGTIAPVSALVDTPMGVDHVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR*
Ga0126384_1012299423300010046Tropical Forest SoilVALVDTEWESTNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
Ga0126373_1231846123300010048Tropical Forest SoilLVDTEMGVDDVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR*
Ga0127503_1025526823300010154SoilNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
Ga0127503_1043812223300010154SoilDDVLFLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR*
Ga0127503_1094217823300010154SoilEHVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
Ga0134082_1053565313300010303Grasslands SoilMGVDDVVYLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
Ga0126370_1050249933300010358Tropical Forest SoilGTIAPVSALVDTPMGVDHVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR*
Ga0126370_1071665823300010358Tropical Forest SoilVALVDTEMGVDNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
Ga0126370_1084096223300010358Tropical Forest SoilMGVDDVLFLQRLMLHYGIYRRYPLRRWPAFKNAWRIAFR*
Ga0126378_1164098313300010361Tropical Forest SoilDVLFLQRLMLHYGIYRRYPLRRWPAFKNAWRIAFR*
Ga0126377_1226157613300010362Tropical Forest SoilMGVDDVFFLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR*
Ga0126379_1020978823300010366Tropical Forest SoilMIGTIAPVAALVDTPMGVDHVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR*
Ga0126379_1123332213300010366Tropical Forest SoilMGVDDVVFLQRLMLHYGIYRRYPLRRWPAFKNAWRIAFR*
Ga0126381_10083906823300010376Tropical Forest SoilMVAFLRRFSLHYGIYRRYPLRPFKALKNAWRIARD*
Ga0105246_1239831923300011119Miscanthus RhizosphereEETLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR*
Ga0137393_1151188813300011271Vadose Zone SoilNVLFLERLLLHYAIYRRYPLKPWPALKNAWRIVLR*
Ga0137364_1035339713300012198Vadose Zone SoilVLFLERLLLHYGIYRRYPLKPWPAFKNAWRIAFR*
Ga0137382_1045309823300012200Vadose Zone SoilMGVDNVLFLPPLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
Ga0137374_1003467523300012204Vadose Zone SoilVTFLERLLLHYRVYRRYPLAPWPAFKNACRIVLR*
Ga0137376_1165509813300012208Vadose Zone SoilIPTMGVDNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
Ga0137359_1014517323300012923Vadose Zone SoilMGVDNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR
Ga0164300_1020091823300012951SoilMGVDDVDCLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR*
Ga0164304_1032520423300012986SoilMGVDDVDFLQRLLLHYGIYRRYPLRRRPALKNAWRIAFR*
Ga0134079_1049046413300014166Grasslands SoilTMGVDNVFFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR*
Ga0182032_1040093013300016357SoilMGVDTVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR
Ga0182040_1113948323300016387SoilMGVDHVFFLQRLVLHYGIYRRYPLKPWPAFKNAWRIAF
Ga0184604_1023560013300018000Groundwater SedimentLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR
Ga0066662_1056743823300018468Grasslands SoilMGVDNVLFLQRLLLHYGIYRRYPLSPWPAFKNAWRLAFS
Ga0066669_1060700413300018482Grasslands SoilPMGVDDVVYLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR
Ga0179594_1008676123300020170Vadose Zone SoilMGVEHVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR
Ga0210403_1060869123300020580SoilMGVDDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRVAFR
Ga0210399_1104746413300020581SoilMGVDDVLFLQRLLLHYGIYRRYPLRRWPALKNAWRVAFR
Ga0210406_1012904813300021168SoilWIPTMGVDDVLFLQRLLLHYGIYRRYPLRRWPALKNAWRVAFR
Ga0126371_1034556423300021560Tropical Forest SoilMIGTIAPVAALVDTPMGVDHVFFLQRFLLHYGIYRRYPLKPWPAFKNAWRIAFR
Ga0126371_1123256223300021560Tropical Forest SoilLALVDTEMGVDNVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR
Ga0213880_1009780423300021953Exposed RockLGVDDVVFLQRLMLHYGIYRRYPLRRWPAFKNAWRIAFR
Ga0207684_1155238313300025910Corn, Switchgrass And Miscanthus RhizosphereWSRDVPFLHRLLLHYGIYRRYPLRPWPALKNAWRVAWR
Ga0207693_1048947913300025915Corn, Switchgrass And Miscanthus RhizospherePIMGVDDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR
Ga0207663_1010457513300025916Corn, Switchgrass And Miscanthus RhizosphereMGVDDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRI
Ga0207663_1062958813300025916Corn, Switchgrass And Miscanthus RhizosphereGVDDVDFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR
Ga0207704_1043928013300025938Miscanthus RhizosphereTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR
Ga0207712_1035981333300025961Switchgrass RhizosphereDTDVQFLDRLMLHYGIYRRYPLRPWPAFKNAWRISFR
Ga0207640_1008293933300025981Corn RhizosphereEETLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR
Ga0207702_1244920223300026078Corn RhizosphereDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR
Ga0209468_113912723300026306SoilMGVDDVVYLQRLLLHYGIYRRYPLRRWPAFKNAWRIAFR
Ga0209239_100260323300026310Grasslands SoilMGVDNVFFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR
Ga0257159_106345723300026494SoilGVDHVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRLAFR
Ga0257168_108807813300026514SoilMGVEHVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRI
Ga0209814_1009458223300027873Populus RhizosphereMGVDNVLFLERLLLHYGIYRRYPLRPWPAFKNAWRIAFR
Ga0207428_1072543423300027907Populus RhizosphereDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR
Ga0307282_1028529513300028784SoilTLGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR
Ga0307304_1058924213300028885SoilPIMGVDDVVFLQRLLLHYGIYRRYPLRRWPALKNAWRIAFR
Ga0308206_119375723300030903SoilPGDTDVQFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR
Ga0308200_101787313300030905SoilDVQFFDRLLLHYGIYRRYPLRPWPAFKNAWRISFR
Ga0308201_1018852023300031091SoilTDVHFLDRLLLHYGIYRRYPLRPWPAFKNAWRISFR
Ga0307501_1014353523300031152SoilDVQFLDRLLLHYGIYRRYPLRPRPAFKNAWRISFR
Ga0307499_1013834523300031184SoilVWALSIGDEIGADDVIFLQRLLLHYGVYRRYPLRPWPALKNAWRIVLR
Ga0318516_1000050963300031543SoilMGGDNVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR
Ga0318534_1040530413300031544SoilLVGTPIRVDHVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR
Ga0318541_1003635023300031545SoilMGVDNVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR
Ga0318528_1014111823300031561SoilVALVDTEMGVDTVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR
Ga0318573_1026760013300031564SoilMGGDNVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFS
Ga0318555_1012552223300031640SoilLALVDTEMGVDDVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR
Ga0318574_1072847213300031680SoilVGTPMGVDHVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR
Ga0310813_1096695023300031716SoilLVDTHNGVDDVVFLQRLLLHYGIYRRWPAFKNAWRIAFR
Ga0307468_10124165823300031740Hardwood Forest SoilRSRNVIFVQRLLLHYGVYRRYPLRPWPALKNAWRIVVR
Ga0318535_1001342613300031764SoilMGVNNVLFLQRLLLHYGIYRRYPLRPWPAFKNAWRIAFR
Ga0318521_1016256943300031770SoilHRAAVALVDTEMGVDTVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR
Ga0318529_1036705813300031792SoilPMGVDHVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR
Ga0318503_1003780913300031794SoilGVDTVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR
Ga0318557_1010238333300031795SoilALVDTEMGVDDVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR
Ga0306925_1013540923300031890SoilMGVDNVLFLQRLLLYYGIYRRYPLRPWPAFKNAWRIAFR
Ga0306921_1118627713300031912SoilMVAFLRRFSLHYGIYRRYPLRPFKALKNAWRIARD
Ga0310912_1136338923300031941SoilMGVDHVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRI
Ga0318563_1035922223300032009SoilNVLFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR
Ga0318540_1007667033300032094SoilTPMGVDHVFFLQRLLLHYGIYRRYPLKPWPAFKNAWRIAFR
Ga0307471_10115445523300032180Hardwood Forest SoilLTIGADDVQFLERLLLHYGIYRRYPLKPWPALKNAWRVATR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.