| Basic Information | |
|---|---|
| Family ID | F066083 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MATLVTPTDKAEKVEKKSPPVTDEKPERKPRPRTDEKFKIFSG |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 97.64 % |
| % of genes from short scaffolds (< 2000 bps) | 90.55 % |
| Associated GOLD sequencing projects | 108 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.803 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.386 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.858 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.331 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.72% β-sheet: 0.00% Coil/Unstructured: 80.28% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF08544 | GHMP_kinases_C | 76.38 |
| PF01128 | IspD | 0.79 |
| PF01066 | CDP-OH_P_transf | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.79 |
| COG0746 | Molybdopterin-guanine dinucleotide biosynthesis protein A | Coenzyme transport and metabolism [H] | 0.79 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.79 |
| COG1207 | Bifunctional protein GlmU, N-acetylglucosamine-1-phosphate-uridyltransferase/glucosamine-1-phosphate-acetyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG1211 | 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase | Lipid transport and metabolism [I] | 0.79 |
| COG2068 | CTP:molybdopterin cytidylyltransferase MocA | Coenzyme transport and metabolism [H] | 0.79 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.80 % |
| Unclassified | root | N/A | 25.20 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001151|JGI12713J13577_1020377 | Not Available | 563 | Open in IMG/M |
| 3300001356|JGI12269J14319_10203551 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300001593|JGI12635J15846_10852619 | Not Available | 521 | Open in IMG/M |
| 3300004120|Ga0058901_1577181 | Not Available | 611 | Open in IMG/M |
| 3300005541|Ga0070733_10400319 | All Organisms → cellular organisms → Bacteria | 914 | Open in IMG/M |
| 3300005542|Ga0070732_10003270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8688 | Open in IMG/M |
| 3300005542|Ga0070732_10601904 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005712|Ga0070764_10605100 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005921|Ga0070766_10523877 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300005921|Ga0070766_11197411 | Not Available | 526 | Open in IMG/M |
| 3300005994|Ga0066789_10288039 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300006052|Ga0075029_100358750 | All Organisms → cellular organisms → Bacteria | 941 | Open in IMG/M |
| 3300006059|Ga0075017_100131483 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300006086|Ga0075019_11065671 | Not Available | 524 | Open in IMG/M |
| 3300006173|Ga0070716_100093998 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
| 3300006175|Ga0070712_100537548 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300007076|Ga0075435_101118891 | Not Available | 689 | Open in IMG/M |
| 3300009038|Ga0099829_11315159 | Not Available | 598 | Open in IMG/M |
| 3300009525|Ga0116220_10426448 | Not Available | 595 | Open in IMG/M |
| 3300009628|Ga0116125_1017270 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
| 3300009698|Ga0116216_10077450 | All Organisms → cellular organisms → Bacteria | 2046 | Open in IMG/M |
| 3300009698|Ga0116216_10835494 | Not Available | 552 | Open in IMG/M |
| 3300009759|Ga0116101_1029562 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
| 3300009760|Ga0116131_1219156 | Not Available | 527 | Open in IMG/M |
| 3300009824|Ga0116219_10043785 | All Organisms → cellular organisms → Bacteria | 2665 | Open in IMG/M |
| 3300009839|Ga0116223_10257148 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300010046|Ga0126384_10021456 | All Organisms → cellular organisms → Bacteria | 4177 | Open in IMG/M |
| 3300010086|Ga0127496_1084326 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 757 | Open in IMG/M |
| 3300010125|Ga0127443_1167870 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300010343|Ga0074044_10072709 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2326 | Open in IMG/M |
| 3300010376|Ga0126381_100845677 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
| 3300010398|Ga0126383_11267447 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300010880|Ga0126350_12082941 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300011066|Ga0138524_1081344 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300011069|Ga0138592_1055912 | All Organisms → cellular organisms → Bacteria | 830 | Open in IMG/M |
| 3300011120|Ga0150983_10410940 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300011120|Ga0150983_12801150 | Not Available | 712 | Open in IMG/M |
| 3300011120|Ga0150983_12946905 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300011120|Ga0150983_14912311 | All Organisms → cellular organisms → Bacteria | 859 | Open in IMG/M |
| 3300011269|Ga0137392_11295375 | Not Available | 588 | Open in IMG/M |
| 3300012203|Ga0137399_10768069 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300014169|Ga0181531_10192735 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300014201|Ga0181537_10260680 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300014201|Ga0181537_10370872 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300014489|Ga0182018_10518991 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300014495|Ga0182015_10066937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2561 | Open in IMG/M |
| 3300014658|Ga0181519_10633479 | Not Available | 659 | Open in IMG/M |
| 3300016319|Ga0182033_10596340 | All Organisms → cellular organisms → Bacteria | 959 | Open in IMG/M |
| 3300017932|Ga0187814_10253072 | Not Available | 668 | Open in IMG/M |
| 3300017946|Ga0187879_10569337 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300017972|Ga0187781_10363230 | All Organisms → cellular organisms → Bacteria | 1031 | Open in IMG/M |
| 3300018013|Ga0187873_1159080 | All Organisms → cellular organisms → Bacteria | 860 | Open in IMG/M |
| 3300018019|Ga0187874_10351070 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300018042|Ga0187871_10067188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2114 | Open in IMG/M |
| 3300018042|Ga0187871_10093451 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
| 3300018044|Ga0187890_10738159 | Not Available | 556 | Open in IMG/M |
| 3300018047|Ga0187859_10693147 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300018088|Ga0187771_11048594 | Not Available | 692 | Open in IMG/M |
| 3300018088|Ga0187771_11417851 | Not Available | 589 | Open in IMG/M |
| 3300019184|Ga0184590_100481 | Not Available | 591 | Open in IMG/M |
| 3300019258|Ga0181504_1288374 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300019260|Ga0181506_1487534 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300019284|Ga0187797_1143290 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300019786|Ga0182025_1204632 | All Organisms → cellular organisms → Bacteria | 1032 | Open in IMG/M |
| 3300020581|Ga0210399_10439852 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300020581|Ga0210399_11280804 | Not Available | 578 | Open in IMG/M |
| 3300021151|Ga0179584_1305904 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300021403|Ga0210397_10269054 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300021404|Ga0210389_10788632 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300021405|Ga0210387_10001000 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 20981 | Open in IMG/M |
| 3300021420|Ga0210394_10556633 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300021479|Ga0210410_10925219 | Not Available | 759 | Open in IMG/M |
| 3300021560|Ga0126371_13524211 | Not Available | 528 | Open in IMG/M |
| 3300021856|Ga0213850_1417667 | Not Available | 667 | Open in IMG/M |
| 3300022512|Ga0242676_1016030 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300022523|Ga0242663_1091284 | Not Available | 596 | Open in IMG/M |
| 3300022532|Ga0242655_10085508 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300022712|Ga0242653_1023504 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300022717|Ga0242661_1125026 | Not Available | 558 | Open in IMG/M |
| 3300023030|Ga0224561_1003633 | All Organisms → cellular organisms → Bacteria | 1073 | Open in IMG/M |
| 3300024227|Ga0228598_1014622 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300025898|Ga0207692_10689917 | Not Available | 662 | Open in IMG/M |
| 3300025929|Ga0207664_10516188 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
| 3300027109|Ga0208603_1047671 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300027158|Ga0208725_1027285 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300027652|Ga0209007_1041200 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300027737|Ga0209038_10071976 | All Organisms → cellular organisms → Bacteria | 1037 | Open in IMG/M |
| 3300027767|Ga0209655_10091409 | All Organisms → cellular organisms → Bacteria | 1012 | Open in IMG/M |
| 3300027783|Ga0209448_10116595 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
| 3300027842|Ga0209580_10022371 | All Organisms → cellular organisms → Bacteria | 2824 | Open in IMG/M |
| 3300027908|Ga0209006_10188392 | All Organisms → cellular organisms → Bacteria | 1797 | Open in IMG/M |
| 3300027908|Ga0209006_10677508 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300028906|Ga0308309_10075821 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2524 | Open in IMG/M |
| 3300029701|Ga0222748_1141310 | Not Available | 501 | Open in IMG/M |
| 3300029914|Ga0311359_10371922 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300029999|Ga0311339_11129011 | All Organisms → cellular organisms → Bacteria | 723 | Open in IMG/M |
| 3300030013|Ga0302178_10138764 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
| 3300030020|Ga0311344_10312632 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300030602|Ga0210254_10357394 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300030622|Ga0265391_10262867 | Not Available | 557 | Open in IMG/M |
| 3300030629|Ga0210268_1065536 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
| 3300030631|Ga0210279_10136676 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300030730|Ga0307482_1087693 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300030730|Ga0307482_1098111 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300030730|Ga0307482_1116625 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300030730|Ga0307482_1117658 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
| 3300030762|Ga0265775_104331 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300030886|Ga0265772_101372 | All Organisms → cellular organisms → Bacteria | 873 | Open in IMG/M |
| 3300031044|Ga0265747_105194 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300031247|Ga0265340_10566489 | Not Available | 500 | Open in IMG/M |
| 3300031446|Ga0170820_12537750 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300031446|Ga0170820_15544441 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300031474|Ga0170818_107231585 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300031474|Ga0170818_114224686 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300031590|Ga0307483_1022415 | Not Available | 626 | Open in IMG/M |
| 3300031708|Ga0310686_102444218 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300031715|Ga0307476_10756891 | Not Available | 719 | Open in IMG/M |
| 3300031823|Ga0307478_11223054 | Not Available | 625 | Open in IMG/M |
| 3300031871|Ga0316036_115224 | Not Available | 549 | Open in IMG/M |
| 3300031962|Ga0307479_10990583 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300032160|Ga0311301_11359146 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300032160|Ga0311301_11476050 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300032174|Ga0307470_10268051 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300032770|Ga0335085_10776527 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300032828|Ga0335080_10700039 | All Organisms → cellular organisms → Bacteria | 1056 | Open in IMG/M |
| 3300032892|Ga0335081_10040531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7401 | Open in IMG/M |
| 3300032954|Ga0335083_10146444 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Trinickia → Trinickia symbiotica | 2238 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.39% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.45% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 7.87% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 7.09% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.51% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.15% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.15% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.15% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.15% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.15% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.36% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.36% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.36% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.36% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.57% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 1.57% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.57% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.57% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.79% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.79% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.79% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.79% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.79% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.79% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.79% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001151 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O3 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300004120 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF238 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009759 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10 | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010086 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010125 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_20_5_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011066 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 3 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011069 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 19 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019184 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSA2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019258 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021151 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021856 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - LL:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022512 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027109 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008 (SPAdes) | Environmental | Open in IMG/M |
| 3300027158 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027652 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029701 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030602 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO133-ANR018SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030622 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO144-ARE044SO (Eukaryote Community Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300030629 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO153-ARE093SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030631 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO141-VCO086SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030762 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030886 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031044 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU4 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031590 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031871 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLE2 metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12713J13577_10203773 | 3300001151 | Forest Soil | MATLVTPTEAEKTEKAEKQAPPMPEEKPERKPRARVDEKFKIFSG |
| JGI12269J14319_102035511 | 3300001356 | Peatlands Soil | MATLVTPTDKPTEKVEKKSPPVTDEKTERKQRSRTDDKFKIFSGTAN |
| JGI12635J15846_108526192 | 3300001593 | Forest Soil | MATLVTPTEKAEKMEKNVPPTPEEKPDRKQRARVDEKFKIFSGTANE |
| Ga0058901_15771811 | 3300004120 | Forest Soil | MLRAKSEELTTMATLVTPADKTVEKKSPPMTDEKLERKPRPRGDEKFKIFSGTANE |
| Ga0070733_104003191 | 3300005541 | Surface Soil | MATLVTPTDKSDKVEKKSPPVTDEKAERKPRPRVDEKFKIFSG |
| Ga0070732_1000327013 | 3300005542 | Surface Soil | MATLATSTEKTEKVEKKSPPVPDEKGERRSRGRADDKFKIFSGTA |
| Ga0070732_106019043 | 3300005542 | Surface Soil | MATLVTPTDKTSEKKSPPVTDEKVERKQRPRTDEKFKIFSG |
| Ga0070764_106051003 | 3300005712 | Soil | MATLVTPTEKTEKAEKQAPPTPEEKPERKARARVDEKFKIFSGTA |
| Ga0070766_105238773 | 3300005921 | Soil | MATLVTPAEKVEKMEKNVPPAPEEKPDRKPRARVDEK |
| Ga0070766_111974111 | 3300005921 | Soil | MATLVTPAEKTDKVEKQAPPMPEEKPDRKQRARVDEKFKIFSGT |
| Ga0066789_102880393 | 3300005994 | Soil | MATLVTPTDKAEKVEKKSPPVTDEKTERKQRPRSDEKFK |
| Ga0075029_1003587501 | 3300006052 | Watersheds | MATLVTPTDKTEKVEKKTPPVTDEKTERKQRPRTDEKFKIFSGTANE |
| Ga0075017_1001314834 | 3300006059 | Watersheds | MATLVTPTDKAEKVEKKSPPVTDEKPERKPRPRTDEKFKI |
| Ga0075019_110656711 | 3300006086 | Watersheds | MATLVTTQEKAEKVEKKSTTVPEEKTERKPRQRTDDKFKIFS |
| Ga0070716_1000939981 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLVSPTDKAEKKSPPVTEEKPERKPRPRTDEKFKIFSG |
| Ga0070712_1005375481 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MATLVTPTDKAERVEKKSPPVTDEKPERKPRPRTDEKFKIFS |
| Ga0075435_1011188911 | 3300007076 | Populus Rhizosphere | MATLVTPTEKAEKVEKKSPPVTDEKLDRKPRQRIDDKFKIFSAT |
| Ga0099829_113151591 | 3300009038 | Vadose Zone Soil | MATLVTPTEKAEKKSPPVTDEKTDRRPRPRSDEKFKIFSGTAN |
| Ga0116220_104264481 | 3300009525 | Peatlands Soil | MATLVTPTDKTDKVEKKSSPVTDEKTERKQRPRSDEKFKIFSGTANE |
| Ga0116125_10172701 | 3300009628 | Peatland | MATLATPTEKVEKAEKQVPPMPDEKADRKQRPRVDEKFKIFS |
| Ga0116216_100774504 | 3300009698 | Peatlands Soil | MATLVTPTDKTEKVEKKNPPVTDEKTERKQRPRMDEKFKIFSGTANE |
| Ga0116216_108354941 | 3300009698 | Peatlands Soil | VERYKLKARSPETTMATLVTPPDKTEKLEKKTPPVTDDKTERKQRPRSDEKFKIFSGTANEHL |
| Ga0116101_10295623 | 3300009759 | Peatland | MATLVTPTEKTEKAEKQAPPTPEEKPERKARARVD |
| Ga0116131_12191561 | 3300009760 | Peatland | MATLVTPPEKTEKAEKQAPPMPEEKPERKPRARVDEKFKIFSGTANAP |
| Ga0116219_100437852 | 3300009824 | Peatlands Soil | MATLVTPTEKTEKAEKQAPPMPEEKPERKPRVRVDEKF* |
| Ga0116223_102571481 | 3300009839 | Peatlands Soil | MATLVTPTEKTEKAEKQAPPMPEEKPERKPRVRVDEKFKI |
| Ga0126384_100214567 | 3300010046 | Tropical Forest Soil | MATLVTPPEKKGQQVTEEKPERKVRPRVDEKFKIFSGTANE |
| Ga0127496_10843261 | 3300010086 | Grasslands Soil | MATLVTPTDKTSEKVEKKNSPVTDEKTDRKQRPRSDDKFKIFSGTANE |
| Ga0127443_11678703 | 3300010125 | Grasslands Soil | MATVATPTDKTTEKVEKKSPPVPDEKLERKQRPRVDE |
| Ga0074044_100727091 | 3300010343 | Bog Forest Soil | MATLVTPTDKTEKVEKKNPPVTDEKTERKQRPRMDEKFKIFSGTAN |
| Ga0126381_1008456771 | 3300010376 | Tropical Forest Soil | MATLVTPTAKTTEKAEKKAPPVSDEKLERKPRPRVDDKFKIFSGTANEAL |
| Ga0126383_112674471 | 3300010398 | Tropical Forest Soil | MATLVTPTDKAEKIEKKNPPVPEEKSERKARPRTDDKFKIFSGTANEALAD |
| Ga0126350_120829411 | 3300010880 | Boreal Forest Soil | MATLVTPTDKAVEKKSPPVTDEKSERKQRPRVDEKFK |
| Ga0138524_10813441 | 3300011066 | Peatlands Soil | MATLVTPTDKTEKVEKKSPPVTDEKTERKQRPRVDEKFKIF |
| Ga0138592_10559121 | 3300011069 | Peatlands Soil | MATLVTPADKAEKAEKKNPPVTDEKAERKQRQRVDEKFKIFSD |
| Ga0150983_104109401 | 3300011120 | Forest Soil | MATLVTPTDKTEKVEKKSPPVTDEKTERKQRPRMDEKFK |
| Ga0150983_128011501 | 3300011120 | Forest Soil | MATLVTPPDKTEKIEKKTPPVTDDKTERKQRPRSDEKFKIFSGTANEHL |
| Ga0150983_129469051 | 3300011120 | Forest Soil | MATLVTPPEKMEKVEKKNPPVTDDKTERKPRPRVDEK |
| Ga0150983_149123111 | 3300011120 | Forest Soil | MATLVTPTDKAEKVEKKNPPVTDEKIDRKQRPRTDE |
| Ga0137392_112953751 | 3300011269 | Vadose Zone Soil | MATLVTPAEKVEKVEKNVPPTPEEKSDRKQRPRVDEKFKIFSGTVNEPLADEV |
| Ga0137399_107680693 | 3300012203 | Vadose Zone Soil | MATLVTPQEKTEKAEKKAPPTPDEKGERRGRGRVDEKFKIFSGTANEPLA |
| Ga0181531_101927353 | 3300014169 | Bog | MATLVTPAEKATEKVEKKSPPVTDEKTDRRPRPRVDEKFKIFSGTA |
| Ga0181537_102606801 | 3300014201 | Bog | MATLVTPTEKAEKMEKNVPPTPEEKPDRKQRPRLDEKFKIFS |
| Ga0181537_103708721 | 3300014201 | Bog | MATLVTPAEKATEKVEKKSPPVTDEKTDRRPRPRVDEKFKIFSGTANESLADE |
| Ga0182018_105189913 | 3300014489 | Palsa | MATLVTPAEKTEKTEKNVPPTPDEKLDRKQRARVDDKFKIFSGT |
| Ga0182015_100669374 | 3300014495 | Palsa | MATLVTPTEKAEKTEKNFPPTPEEKPERKPRARVD |
| Ga0181519_106334793 | 3300014658 | Bog | MATLVTPTDKTEKVEKKTPPVTDEKTERKQRPRMDEKFKIFSG |
| Ga0182033_105963401 | 3300016319 | Soil | MATLVTPTDKAEKVEKKSPPVPEEKPERKPRPRTDE |
| Ga0187814_102530721 | 3300017932 | Freshwater Sediment | MATLVTPTDKTTDKVEKKSPPVPDEKQERKQRPRVDEKFKIFSGTANEP |
| Ga0187879_105693371 | 3300017946 | Peatland | MATLVTPTEKTEKAEKQVPPMPEEKQERKPRARVDEKFKI |
| Ga0187781_103632303 | 3300017972 | Tropical Peatland | MATLVTPPEKTAEKVEKKTPPAPDEKPERKHRARVDEKFKIFSGTA |
| Ga0187873_11590803 | 3300018013 | Peatland | MATLVTPTEKTEKAEKQAPPTPEEKPERKARARVDEKFKIFSG |
| Ga0187874_103510701 | 3300018019 | Peatland | MSTLVTPTEKAEKPAPPLPEEKPERKARARVDEKFKI |
| Ga0187871_100671881 | 3300018042 | Peatland | MATLVTPAEKTEKVQKQVVPPTPEEKLERKPRARVD |
| Ga0187871_100934511 | 3300018042 | Peatland | MATLVTPTDKTDKVEKKNPPVTDEKTDRKQRPRSDEKFKIFS |
| Ga0187890_107381593 | 3300018044 | Peatland | MSTLVTPTEKAEKPAPPLPEEKPERKARARVDEKFKIFSGTA |
| Ga0187859_106931473 | 3300018047 | Peatland | MATLVTPTEKAEKTEKNVPPTPEEKPDRKQRPRLDEKFKIFSGTANEPLAD |
| Ga0187771_110485943 | 3300018088 | Tropical Peatland | MATLVTPTDKTEKVEKKSPPVTEEKPERKQRLRADDKFKIFSGTANE |
| Ga0187771_114178513 | 3300018088 | Tropical Peatland | MATLVTPSEKTTEKVEKKSPPVTDEKPERKQRQRADD |
| Ga0184590_1004811 | 3300019184 | Soil | MATLVTPTDKGEKVDKKSPPVTDEKLDRKLRPRVDEKFKIFCGTANPQLA |
| Ga0181504_12883743 | 3300019258 | Peatland | MATLVTPAEKAEKIEKQVPPMPDEKTDRKQRPRVDEKFKIFSGTANEPL |
| Ga0181506_14875341 | 3300019260 | Peatland | MATLVTPAEKAEKIEKQVPPMPDEKTDRKQRPRVDEKFK |
| Ga0187797_11432901 | 3300019284 | Peatland | MATVVTPPEKAEKVEKHVPPAPPAPDEKPERKQRGRV |
| Ga0182025_12046323 | 3300019786 | Permafrost | MATLVTPTDAEKTEKAGKQAPPMPEEKSERKPRARVDEKFKIFWRHGERGSYR |
| Ga0210399_104398523 | 3300020581 | Soil | MATLVTPTEKAEKVEKSAPPMPDEKSDRKPRARVDEKF |
| Ga0210399_112808041 | 3300020581 | Soil | MATLVTPTDKAEKVEKKSPPVTDEKPERKPRPRTDEKFKIFSG |
| Ga0179584_13059041 | 3300021151 | Vadose Zone Soil | MATLVTPPEKIEKVEKKSPPVTDDKTERKPRPRVD |
| Ga0210397_102690543 | 3300021403 | Soil | MATLVTPTDKAEKVEKKSPPVTDEKPERKPRPRTD |
| Ga0210389_107886323 | 3300021404 | Soil | MATLVTPTEAEKTEKAEKQAPPMPEEKPERKPRARVDE |
| Ga0210387_100010001 | 3300021405 | Soil | MATLVTPTDKAEKVEKKNPPVTDEKNERKQRPRTDEKFKI |
| Ga0210394_105566333 | 3300021420 | Soil | MATLVTPTDKAEKVEKKSPPVTDDKSDRKQRPRTDEKFKIFSGTA |
| Ga0210410_109252193 | 3300021479 | Soil | MATLVTPTDKTEKVEKKSPPVTEEKPERKQRPRVDEKFKIFSGTANESLA |
| Ga0126371_135242113 | 3300021560 | Tropical Forest Soil | MATLVTPTEKAEKVEKKSPVPDEKPERKQRPRVDEKFKIFSGTANE |
| Ga0213850_14176673 | 3300021856 | Watersheds | MATLVTPTDKAERVEKKSPPVTEEKPERKLRPRTDEKFKIFSGTANE |
| Ga0242676_10160301 | 3300022512 | Soil | MATLVTPTETAEKVEKKSPPSPDEKLDRKQRGRVDEKFKIFS |
| Ga0242663_10912841 | 3300022523 | Soil | MSRFGLAHGSKLRTHNSMATLVTPTDKAEKKAPPVTDEKTDRKQRPRS |
| Ga0242655_100855081 | 3300022532 | Soil | MATLVTPTDKAEKVEKKSPPVTDDKSDRKQRPRTDEKFKIF |
| Ga0242653_10235041 | 3300022712 | Soil | MATLVTPTDKAEKVEKKNPPVTDEKTDRKQRPRTDEKFKIFSGTAN |
| Ga0242661_11250262 | 3300022717 | Soil | MATLVTPTEKTVEKKSPPVTDDKVDRRPRPRTDEKFKIF |
| Ga0224561_10036333 | 3300023030 | Soil | MATLVTPTEKAEKTEKNTPPTPEEKPDRKQRPRVDEKFKIFSGT |
| Ga0228598_10146223 | 3300024227 | Rhizosphere | MATLVTPAEKTDKAEKQVPPTPEEKPDRKPRARVDEKFKIFSGTANEPLAD |
| Ga0207692_106899172 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MATVATPTDKTTEKVEKKSPPVPDEKPDRKQRPRVDEKFKIFSGT |
| Ga0207664_105161881 | 3300025929 | Agricultural Soil | MATLVTPTDKTEKVEKKNPPVTDEKTERKQRPRMDEKFKIFSGTA |
| Ga0208603_10476713 | 3300027109 | Forest Soil | MATLVTPAEKAEKTEKNVPPTPEEKLERKQRARVDEKFKIFSGTANEPL |
| Ga0208725_10272853 | 3300027158 | Forest Soil | MATLVTPTEKAEKMEKNVPPTTEEKPDRKQRARLDEKFKIF |
| Ga0209007_10412003 | 3300027652 | Forest Soil | MATLVTPTDKSDKVEKKSPPVTDDKAERKPRPRVDEKFKIFSATA |
| Ga0209038_100719763 | 3300027737 | Bog Forest Soil | MATLVTPTEKAEKMEKNVPPTPEEKPDRKQRARVDE |
| Ga0209655_100914091 | 3300027767 | Bog Forest Soil | MATLVTPPEKTEKAEKQVPPMPEEKQDRKPRARVDE |
| Ga0209448_101165951 | 3300027783 | Bog Forest Soil | MATLVTPPDKTEKVEKKSPPVTDEKAERKQRPRSDDKFKIFSGT |
| Ga0209580_100223716 | 3300027842 | Surface Soil | MATLATSTEKTEKVEKKSPPVPDEKGERRSRGRADDKFKIFSGT |
| Ga0209006_101883924 | 3300027908 | Forest Soil | MATLVTPPDKTEKVEKKNPPVADEKTERKQRPRTDEKFKIFSGTANE |
| Ga0209006_106775083 | 3300027908 | Forest Soil | MATLVTPTDKAVEKKNPPVTDEKSERKQRPRVDEKFKIFSGTANEP |
| Ga0308309_100758214 | 3300028906 | Soil | MATLVTPAEKVEKMEKNVPPAPEEKPDRKPRARVDEKFKIFSG |
| Ga0222748_11413103 | 3300029701 | Soil | MATLVTPTDKTEKVEKKSPPVTDEKLERKPRPRGDEKF |
| Ga0311359_103719223 | 3300029914 | Bog | MATLVTPPEKAEKVEKAVPPTPEEKAERKPRPRVDEKFKI |
| Ga0311339_111290111 | 3300029999 | Palsa | MATLVTPTDKAEKVEKKSSPVTDEKTERKQRPRSDEKFKIFSGTANEP |
| Ga0302178_101387643 | 3300030013 | Palsa | MATLVTPAEKAEKAEKQVPPTPEDKAERKPRARVDEKFKIFSGTANEPLAD |
| Ga0311344_103126321 | 3300030020 | Bog | MATLVTPPEKVEKAEKQTPPLPEEKAERKGRTRVDDKFKIFSGSANEPLA |
| Ga0210254_103573941 | 3300030602 | Soil | MATLVTPTEKAEKTEKNVPPMPEEKSDRKQRARVD |
| Ga0265391_102628671 | 3300030622 | Soil | MATLVTPTDKGEKVEKKSPPVTDEKLDRKPRPRVDEKFKIFCGTANPQIEGG |
| Ga0210268_10655361 | 3300030629 | Soil | MATLVTPTDKGEKVEKKSPPVTDEKLDRKPRPRVDEKFKRKEN |
| Ga0210279_101366763 | 3300030631 | Soil | MATLVTPTEKAEKTEKNVPPMPEEKSDRKQRARVDEKFKVK |
| Ga0307482_10876931 | 3300030730 | Hardwood Forest Soil | MATLVTPTDKAEKVEKKSPPVTDDKSDRKQRPRTDEK |
| Ga0307482_10981111 | 3300030730 | Hardwood Forest Soil | MPTLVTPTDKAVEKKSPPVTDEKREPKQRPRVDEKFKIFSGTATEP |
| Ga0307482_11166251 | 3300030730 | Hardwood Forest Soil | MATLVTPTDKAEKMEKNTPPMPEEKSDRKPRARVDEKFKIFSGTA |
| Ga0307482_11176583 | 3300030730 | Hardwood Forest Soil | MATLVTPTEAEKTEKNVPTPDEKTERKQRPRTDEKFKIFSGTA |
| Ga0265775_1043311 | 3300030762 | Soil | MATLVTPTEKVEKAEKKTPALPDDKLDRKPRPRIDEKFKIFSGTANDSL |
| Ga0265772_1013723 | 3300030886 | Soil | MATLVTPTDKGEKVDKKSPPVTDEKLDRKLRPRVDEKFKIFCGTAN |
| Ga0265747_1051941 | 3300031044 | Soil | MATLVTPTEKTEKAEKQLPPAPEDKADRKPRARVDEKFKIFSG |
| Ga0265340_105664891 | 3300031247 | Rhizosphere | MATLVTPTDKTEKVEKKTPPVTDEKTDRKQRPRSDEKFKIFSGTANEHLAD |
| Ga0170820_125377503 | 3300031446 | Forest Soil | MATLVTPTDKAEKKTPPVTDEKTDRKQRPRSDEKFKIFSGT |
| Ga0170820_155444413 | 3300031446 | Forest Soil | MATLVTPTGKAEKVEKKNPPVADEKTDRKQRPRADEKFKIFSGTAN |
| Ga0170818_1072315853 | 3300031474 | Forest Soil | MATLVTPTDKAEKVERKSPPVTDDKPERKQRQRTDEKFKIFSG |
| Ga0170818_1142246863 | 3300031474 | Forest Soil | MATLVTPTDKAEKKTPPVTDEKTDRKQRPRSDEKFKIFSGTANE |
| Ga0307483_10224151 | 3300031590 | Hardwood Forest Soil | MATLVTPTEKAEKTEKNVPPMPEEKSDRKPRARVDEKFKIFSRSE |
| Ga0310686_1024442181 | 3300031708 | Soil | MATLVTPTDKPTDKAEKVEKVEKKTPPVTDEKTDRKQRPRSDEK |
| Ga0307476_107568913 | 3300031715 | Hardwood Forest Soil | MATLVTPADKTVEKKSPPVTDEKLERKPRPRGDEKFKIFSGTA |
| Ga0307478_112230543 | 3300031823 | Hardwood Forest Soil | MATLVTPTDKAEKKAPPVTDEKTDRKQRPRSDEKFKIFSGT |
| Ga0316036_1152242 | 3300031871 | Soil | MATLVTPTDKGEKVDKKSPPVTDEKLDRKLRPRVDEKFKIFCGTANPQLAD |
| Ga0307479_109905831 | 3300031962 | Hardwood Forest Soil | MATLVTPTEAEKTEKNVPTPDEKTERKQRPRTDEKFKIFSGTANEVLADE |
| Ga0311301_113591463 | 3300032160 | Peatlands Soil | MATLVTPTDKTDKVEKKSSPVTDEKTERKQRPRSDEKFKIFSGTANEHLA |
| Ga0311301_114760501 | 3300032160 | Peatlands Soil | VERYKLKARSPETTMATLVTPPDKTEKVEKKTPPVTDDKTERKQRPRSDEKFKIFSG |
| Ga0307470_102680513 | 3300032174 | Hardwood Forest Soil | MATLVTPTDKAERVEKKSPPVTDEKPERKPRPRTDEKFKI |
| Ga0335085_107765271 | 3300032770 | Soil | MATLVTPTGKSDKAEKKSPPVTDEKLDRKPRQRVDD |
| Ga0335080_107000391 | 3300032828 | Soil | MATLVTPTEKTEKAEKKPPVTDEKPERKQRPRTDEKFKIFS |
| Ga0335081_1004053111 | 3300032892 | Soil | MATLVTPTDKTEKVEKKSPPVTDEKPERKQRPRVDEKFKIF |
| Ga0335083_101464444 | 3300032954 | Soil | MATLVTPTDKPTEKVEKKNPPVTDDKTDRKQRPRADDKFKIFSGTA |
| ⦗Top⦘ |