| Basic Information | |
|---|---|
| Family ID | F066061 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 45 residues |
| Representative Sequence | GLKIINAVTDNMQLTGNERHGTTVHFEKTLEWLPGAAGQHLFNADGGS |
| Number of Associated Samples | 110 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 2.40 % |
| % of genes near scaffold ends (potentially truncated) | 92.91 % |
| % of genes from short scaffolds (< 2000 bps) | 92.13 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.24 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (74.016 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.772 % of family members) |
| Environment Ontology (ENVO) | Unclassified (18.898 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.819 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.16% β-sheet: 7.89% Coil/Unstructured: 78.95% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.24 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF16859 | TetR_C_11 | 11.02 |
| PF03992 | ABM | 3.94 |
| PF07690 | MFS_1 | 3.94 |
| PF00881 | Nitroreductase | 3.15 |
| PF13530 | SCP2_2 | 2.36 |
| PF13302 | Acetyltransf_3 | 2.36 |
| PF02515 | CoA_transf_3 | 2.36 |
| PF01745 | IPT | 1.57 |
| PF04250 | DUF429 | 1.57 |
| PF04978 | DUF664 | 1.57 |
| PF13581 | HATPase_c_2 | 1.57 |
| PF01614 | IclR | 1.57 |
| PF00849 | PseudoU_synth_2 | 0.79 |
| PF01841 | Transglut_core | 0.79 |
| PF13193 | AMP-binding_C | 0.79 |
| PF00291 | PALP | 0.79 |
| PF00781 | DAGK_cat | 0.79 |
| PF00685 | Sulfotransfer_1 | 0.79 |
| PF04909 | Amidohydro_2 | 0.79 |
| PF01212 | Beta_elim_lyase | 0.79 |
| PF06500 | FrsA-like | 0.79 |
| PF00248 | Aldo_ket_red | 0.79 |
| PF00144 | Beta-lactamase | 0.79 |
| PF07929 | PRiA4_ORF3 | 0.79 |
| PF07992 | Pyr_redox_2 | 0.79 |
| PF08379 | Bact_transglu_N | 0.79 |
| PF00027 | cNMP_binding | 0.79 |
| PF00440 | TetR_N | 0.79 |
| PF00903 | Glyoxalase | 0.79 |
| PF05598 | DUF772 | 0.79 |
| PF13412 | HTH_24 | 0.79 |
| PF12802 | MarR_2 | 0.79 |
| PF14572 | Pribosyl_synth | 0.79 |
| PF00501 | AMP-binding | 0.79 |
| PF00106 | adh_short | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 2.36 |
| COG2410 | Predicted nuclease (RNAse H fold) | General function prediction only [R] | 1.57 |
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 1.57 |
| COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.57 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 1.57 |
| COG1305 | Transglutaminase-like enzyme, putative cysteine protease | Posttranslational modification, protein turnover, chaperones [O] | 0.79 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 0.79 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 0.79 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.79 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.79 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.79 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.79 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.79 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.79 |
| COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.79 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 0.79 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.79 |
| COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 0.79 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.79 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.79 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.79 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.79 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 0.79 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.79 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 74.02 % |
| Unclassified | root | N/A | 25.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300004092|Ga0062389_104796599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 509 | Open in IMG/M |
| 3300005184|Ga0066671_10562410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 736 | Open in IMG/M |
| 3300005327|Ga0070658_10600327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 954 | Open in IMG/M |
| 3300005339|Ga0070660_100632897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 895 | Open in IMG/M |
| 3300005435|Ga0070714_101439265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 673 | Open in IMG/M |
| 3300005437|Ga0070710_11172701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
| 3300005439|Ga0070711_100104767 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
| 3300005548|Ga0070665_100475301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1260 | Open in IMG/M |
| 3300005549|Ga0070704_101241591 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005553|Ga0066695_10165350 | All Organisms → cellular organisms → Bacteria | 1381 | Open in IMG/M |
| 3300005555|Ga0066692_10384192 | Not Available | 890 | Open in IMG/M |
| 3300005591|Ga0070761_10265680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1027 | Open in IMG/M |
| 3300005591|Ga0070761_10637275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 665 | Open in IMG/M |
| 3300005614|Ga0068856_101527019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 681 | Open in IMG/M |
| 3300005713|Ga0066905_102246329 | Not Available | 509 | Open in IMG/M |
| 3300005921|Ga0070766_10337493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 976 | Open in IMG/M |
| 3300006028|Ga0070717_10524635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1071 | Open in IMG/M |
| 3300006028|Ga0070717_11392148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 637 | Open in IMG/M |
| 3300006173|Ga0070716_100612219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 821 | Open in IMG/M |
| 3300006175|Ga0070712_101895415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
| 3300006176|Ga0070765_100282683 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1529 | Open in IMG/M |
| 3300006806|Ga0079220_10993718 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
| 3300006871|Ga0075434_102489589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 519 | Open in IMG/M |
| 3300006954|Ga0079219_12143199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 536 | Open in IMG/M |
| 3300009092|Ga0105250_10330796 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 664 | Open in IMG/M |
| 3300009162|Ga0075423_12936954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 522 | Open in IMG/M |
| 3300010048|Ga0126373_12837220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 541 | Open in IMG/M |
| 3300010048|Ga0126373_12974726 | Not Available | 528 | Open in IMG/M |
| 3300010358|Ga0126370_10939739 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 784 | Open in IMG/M |
| 3300010360|Ga0126372_12882233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 533 | Open in IMG/M |
| 3300010361|Ga0126378_10078816 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3183 | Open in IMG/M |
| 3300010361|Ga0126378_10441065 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1416 | Open in IMG/M |
| 3300010361|Ga0126378_11443919 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300010361|Ga0126378_12940586 | Not Available | 543 | Open in IMG/M |
| 3300010396|Ga0134126_10639814 | Not Available | 1214 | Open in IMG/M |
| 3300010396|Ga0134126_11481271 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 748 | Open in IMG/M |
| 3300010396|Ga0134126_12801505 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 528 | Open in IMG/M |
| 3300010876|Ga0126361_10208326 | Not Available | 1360 | Open in IMG/M |
| 3300010937|Ga0137776_1749902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1263 | Open in IMG/M |
| 3300012205|Ga0137362_11107096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 673 | Open in IMG/M |
| 3300012208|Ga0137376_11491025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
| 3300012210|Ga0137378_11697793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 538 | Open in IMG/M |
| 3300012357|Ga0137384_10758351 | Not Available | 786 | Open in IMG/M |
| 3300012361|Ga0137360_10392794 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1168 | Open in IMG/M |
| 3300014166|Ga0134079_10615993 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300015373|Ga0132257_102200141 | Not Available | 714 | Open in IMG/M |
| 3300015374|Ga0132255_104218234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300016319|Ga0182033_10430478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1121 | Open in IMG/M |
| 3300016341|Ga0182035_11751468 | Not Available | 562 | Open in IMG/M |
| 3300016387|Ga0182040_10675226 | Not Available | 842 | Open in IMG/M |
| 3300017932|Ga0187814_10322322 | Not Available | 594 | Open in IMG/M |
| 3300017959|Ga0187779_10173032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1341 | Open in IMG/M |
| 3300017970|Ga0187783_11144203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 561 | Open in IMG/M |
| 3300018012|Ga0187810_10238051 | Not Available | 745 | Open in IMG/M |
| 3300020069|Ga0197907_11214192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 950 | Open in IMG/M |
| 3300020070|Ga0206356_10624928 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
| 3300020582|Ga0210395_10051205 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3025 | Open in IMG/M |
| 3300020583|Ga0210401_10016452 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7139 | Open in IMG/M |
| 3300020583|Ga0210401_11284145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 590 | Open in IMG/M |
| 3300020610|Ga0154015_1468147 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 910 | Open in IMG/M |
| 3300021180|Ga0210396_10022136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5884 | Open in IMG/M |
| 3300021180|Ga0210396_10744843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 844 | Open in IMG/M |
| 3300021180|Ga0210396_11393088 | Not Available | 580 | Open in IMG/M |
| 3300021180|Ga0210396_11524511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300021181|Ga0210388_11619663 | Not Available | 537 | Open in IMG/M |
| 3300021402|Ga0210385_10329809 | Not Available | 1136 | Open in IMG/M |
| 3300021402|Ga0210385_10935039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 666 | Open in IMG/M |
| 3300021403|Ga0210397_10956464 | Not Available | 664 | Open in IMG/M |
| 3300021407|Ga0210383_10591493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Demequinaceae → Demequina | 957 | Open in IMG/M |
| 3300021407|Ga0210383_11142994 | Not Available | 656 | Open in IMG/M |
| 3300021420|Ga0210394_11378718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
| 3300021560|Ga0126371_13174180 | Not Available | 556 | Open in IMG/M |
| 3300022523|Ga0242663_1070629 | Not Available | 652 | Open in IMG/M |
| 3300022557|Ga0212123_10279167 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1180 | Open in IMG/M |
| 3300025386|Ga0208585_1056977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 510 | Open in IMG/M |
| 3300025509|Ga0208848_1036087 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 1071 | Open in IMG/M |
| 3300025574|Ga0208717_1016629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2031 | Open in IMG/M |
| 3300025634|Ga0208589_1012753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2521 | Open in IMG/M |
| 3300025728|Ga0207655_1170678 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300025898|Ga0207692_10475840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 789 | Open in IMG/M |
| 3300025906|Ga0207699_10761936 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
| 3300025915|Ga0207693_11381136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 524 | Open in IMG/M |
| 3300025919|Ga0207657_10213893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1546 | Open in IMG/M |
| 3300025919|Ga0207657_11119688 | Not Available | 601 | Open in IMG/M |
| 3300025924|Ga0207694_10301156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1320 | Open in IMG/M |
| 3300025928|Ga0207700_11355587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
| 3300025929|Ga0207664_11422878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 614 | Open in IMG/M |
| 3300027765|Ga0209073_10121059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 943 | Open in IMG/M |
| 3300027855|Ga0209693_10572378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300027857|Ga0209166_10684633 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
| 3300028381|Ga0268264_10354130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1398 | Open in IMG/M |
| 3300028808|Ga0302228_10220893 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 859 | Open in IMG/M |
| 3300028877|Ga0302235_10524532 | Not Available | 502 | Open in IMG/M |
| 3300030399|Ga0311353_11538416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 538 | Open in IMG/M |
| 3300030618|Ga0311354_11022750 | Not Available | 760 | Open in IMG/M |
| 3300030677|Ga0302317_10235029 | Not Available | 833 | Open in IMG/M |
| 3300030763|Ga0265763_1040318 | Not Available | 561 | Open in IMG/M |
| 3300031543|Ga0318516_10460258 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300031546|Ga0318538_10149591 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300031564|Ga0318573_10417832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 721 | Open in IMG/M |
| 3300031572|Ga0318515_10597726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300031708|Ga0310686_110972575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3316 | Open in IMG/M |
| 3300031713|Ga0318496_10123161 | Not Available | 1404 | Open in IMG/M |
| 3300031719|Ga0306917_10471929 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300031740|Ga0307468_102175919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. EUN1f | 536 | Open in IMG/M |
| 3300031748|Ga0318492_10173058 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
| 3300031751|Ga0318494_10329397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 882 | Open in IMG/M |
| 3300031764|Ga0318535_10546381 | Not Available | 514 | Open in IMG/M |
| 3300031765|Ga0318554_10242818 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1025 | Open in IMG/M |
| 3300031798|Ga0318523_10259352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 869 | Open in IMG/M |
| 3300031799|Ga0318565_10126719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1233 | Open in IMG/M |
| 3300031835|Ga0318517_10538919 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031846|Ga0318512_10440235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
| 3300031893|Ga0318536_10511577 | Not Available | 603 | Open in IMG/M |
| 3300031910|Ga0306923_11818193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
| 3300031942|Ga0310916_10457332 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300031959|Ga0318530_10208645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 802 | Open in IMG/M |
| 3300032043|Ga0318556_10687669 | Not Available | 532 | Open in IMG/M |
| 3300032055|Ga0318575_10088297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1487 | Open in IMG/M |
| 3300032064|Ga0318510_10423144 | Not Available | 569 | Open in IMG/M |
| 3300032160|Ga0311301_12600229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 562 | Open in IMG/M |
| 3300032174|Ga0307470_10879240 | Not Available | 702 | Open in IMG/M |
| 3300032828|Ga0335080_11947934 | Not Available | 570 | Open in IMG/M |
| 3300032898|Ga0335072_10925842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 812 | Open in IMG/M |
| 3300032898|Ga0335072_11753136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Specibacter → Specibacter cremeus | 515 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.77% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.09% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.15% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.94% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.94% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.36% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.36% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.36% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.57% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.57% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.57% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.57% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.57% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.57% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.57% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.79% |
| Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.79% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.79% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.79% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.79% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.79% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010937 | Fumarole sediment microbial communities, Furnas, Sao Miguel, Azores. Combined Assembly of Gp0156138, Gp0156139 | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024176 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1 | Environmental | Open in IMG/M |
| 3300025386 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025574 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 shallow (SPAdes) | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030677 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0062389_1047965991 | 3300004092 | Bog Forest Soil | LKIIDAVVDNLQLTGNGRERTTVHFEKKLEWLPGAAGQHLFSAEGGRQARAGGGNQ* |
| Ga0066671_105624102 | 3300005184 | Soil | DNMQLTGNERHGTTVHFEKTLQWLPGAAGQHLFNADGDS* |
| Ga0070658_106003271 | 3300005327 | Corn Rhizosphere | RGRGLRIIDAVAENLQLTGNQRYGTTVHFEKTLDWLPEAAGPHLLNGDDGADH* |
| Ga0070660_1006328972 | 3300005339 | Corn Rhizosphere | AVADNMQLTGSERYGTTVHFEKTLQWLPGAAGQHLFNADSDS* |
| Ga0070714_1014392651 | 3300005435 | Agricultural Soil | TAEHGRGLKIIDAVTDNMRLTGNGMTTVHFEKALEWVPGAPGEHLSHGDRR* |
| Ga0070710_111727012 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | EHGRGLKIINAVVDNLQLTGNRHGVTVHFEKKLDWLPGAAGRHLFQTEGGG* |
| Ga0070711_1001047673 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | AVADNMQLTGSERYGTTVHFEKTLQWLPGAAGQHLFNAGSDS* |
| Ga0070665_1004753015 | 3300005548 | Switchgrass Rhizosphere | RIIDAVAENLQLTGNQRYGTTVHFEKTLDWLPEAAGPHLLNGDDGADH* |
| Ga0070704_1012415911 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | DNMQLTGSERYGTTVHFEKTLQWLPGAAGQHLFNADSDS* |
| Ga0066695_101653503 | 3300005553 | Soil | AVVDNLQLTGNEREGTTLRFEKTLEWLPGAAGRYLFSADGGS* |
| Ga0066692_103841921 | 3300005555 | Soil | DAVTDNLRLTGNGRAGTTVHFEKTLDWVPGAMGEHLTNADG* |
| Ga0070761_102656803 | 3300005591 | Soil | GLAIINAVTDNMQLTGNERHGTTVHFEKTLQWLPGAAGQQLFNADDGS* |
| Ga0070761_106372753 | 3300005591 | Soil | IINAVTDNMQLTGNERHGTTVHFEKTLQWLPGAAGEHLFNADGGS* |
| Ga0068856_1015270191 | 3300005614 | Corn Rhizosphere | KIIHAVADNMQLTGSERYGTTVHFEKTLQWLPGAAGQHLFNADSDS* |
| Ga0066905_1022463291 | 3300005713 | Tropical Forest Soil | KIIDALTDNMRLTGNGMTTVHFEKALEWVPGALGEHLSHGEW* |
| Ga0070766_103374933 | 3300005921 | Soil | GLKIIDALTDNLQLTGDGRAGTTVHFEKVLSWIPGAAGEYLFSAPA* |
| Ga0070717_105246351 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | INAVMDNLQLTGNGCQGTTVHFEKKLEWIPGAAGQHLFHADGS* |
| Ga0070717_113921482 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | GRGLKIIDAVADNLLLVSDERQGTTVHFEKTLEWLPGAVGQHLFNFSGD* |
| Ga0070716_1006122191 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | ENLQLTGNQRYGTTVHFEKTLDWLPEAAWPHLLNGDDGAGH* |
| Ga0070712_1018954152 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TSTGRQGTTVHFEKELEWLPGAAGQHLFHMDGVG* |
| Ga0070765_1002826834 | 3300006176 | Soil | GLKIIDALTDNLQLTGDGRAGTTVHFEKVLSWIPGAAGEHLFSAHA* |
| Ga0079220_109937181 | 3300006806 | Agricultural Soil | RGLKIIHAVADNMQLTGSERYGTTVHFEKTLQWLPGAAGQHLFNADSDS* |
| Ga0075434_1024895891 | 3300006871 | Populus Rhizosphere | TIIDAVTDNVRLTGNGMTTVHFEKALEWVPGAPGEHLSHGDR* |
| Ga0079219_121431991 | 3300006954 | Agricultural Soil | GRGLKIINAVVDNLQLTGNERNGVTVHFEKKLEWLPGAAGRHLFHANSGS* |
| Ga0105250_103307962 | 3300009092 | Switchgrass Rhizosphere | LKIIHAVADNMQLTGSERYGTTVHFEKTLQWLPGAAGQHLFNADSDS* |
| Ga0075423_129369542 | 3300009162 | Populus Rhizosphere | LRIIHAVADNMQLTGSERYGTTVHFEKTLQWLPGATGQHLFNADGDS* |
| Ga0126373_128372201 | 3300010048 | Tropical Forest Soil | VADNMQLTGNERHGTTVHFEKTLEWLPGAAGQHLFNGGGDG* |
| Ga0126373_129747262 | 3300010048 | Tropical Forest Soil | GRGLKIISAVTDNLQLTGNGRQGTTVHFEKKLDWLPGAAGQHLLRADGG* |
| Ga0126370_109397391 | 3300010358 | Tropical Forest Soil | GLRIIDAVTDNLRLTGNGRAGTTVHFEKELDWVPGAPGEHLISTDR* |
| Ga0126372_128822332 | 3300010360 | Tropical Forest Soil | GLKIIDAVVDNLQLRSNQYQGTTVHFEKTLEWVPGAAGQYLFNADSDRA* |
| Ga0126378_100788166 | 3300010361 | Tropical Forest Soil | INAVVDNLQLTGNERQGTTVRFEKALDWLPDAAGLQLFDHGSAG* |
| Ga0126378_104410652 | 3300010361 | Tropical Forest Soil | VADNMQLTGNERRGTTVHFEKTLEWLPGAAGQHLFNADSDS* |
| Ga0126378_114439191 | 3300010361 | Tropical Forest Soil | DNLQLTGNGQQGTTVHFEKDLQWVPGAAGKHLSHDDG* |
| Ga0126378_129405862 | 3300010361 | Tropical Forest Soil | DHGMPEHGRGLKIIDAVTDELSMTGSGLAGTTVRFEKVLTWIPGAPAEQLSATGR* |
| Ga0134126_106398143 | 3300010396 | Terrestrial Soil | IHAVADNMQLTGSERYGTTVHFEKTLQWLPGAAGQHLFNAGSDS* |
| Ga0134126_114812711 | 3300010396 | Terrestrial Soil | TDNMQLTGSERHGTTVHFEKTLQWLPGAAGQHLFNADGDT* |
| Ga0134126_128015051 | 3300010396 | Terrestrial Soil | GLKIIDAVADNLQLTGDDRQGTVVHFEKTLEWVPGAPGQYLISTGSTR* |
| Ga0126361_102083261 | 3300010876 | Boreal Forest Soil | VTDNMQLTGNEHHGTTVHFEKALEWLPGATGQLLFNADGGS* |
| Ga0137776_17499021 | 3300010937 | Sediment | GLKIIDAVADNLRLTGNHRRGTTVHFEKTLEWLPGAAGEHLFNADGVA* |
| Ga0137362_111070961 | 3300012205 | Vadose Zone Soil | VTDNLQLWPNERLGATVHFEKTLEWLPGAPGRQLFTADRGVTGRQA* |
| Ga0137376_114910251 | 3300012208 | Vadose Zone Soil | RGLSIIDAVTDNLRLTGNGRAGTTVHFEKELDWVPGAPGEHLIQRGG* |
| Ga0137378_116977931 | 3300012210 | Vadose Zone Soil | IIDAVTDNLQLRPNERLGATVHFEKTLEWLPGAPGRRLFTADRGATGRQA* |
| Ga0137384_107583512 | 3300012357 | Vadose Zone Soil | KIIDAVTDNLRLTGNGRAGTTVHFEKTLDWVPGALGEHLTNADG* |
| Ga0137360_103927943 | 3300012361 | Vadose Zone Soil | GLKIIDAVVDNLELTGNGRDGTTVHFEKTLSWLPGAAGEHLFSAHA* |
| Ga0134079_106159931 | 3300014166 | Grasslands Soil | GLKIINAVVDNLQLTGNGRQGTTVHFEKKLDWMPGAAGQYLFNADGDS* |
| Ga0132257_1022001411 | 3300015373 | Arabidopsis Rhizosphere | LTGNERHGTTVHFEKTLQWLPGAAGQHLFNASGDS* |
| Ga0132255_1042182342 | 3300015374 | Arabidopsis Rhizosphere | LKIIDALTDKMRMAGNGMTTVHFEKALEWVPGALGEHLSHGDG* |
| Ga0182033_104304782 | 3300016319 | Soil | GRGLKIIDAVTDNLRLTGNGRAGTTVHFEKALDWVPGALGEHLSRGDG |
| Ga0182035_117514681 | 3300016341 | Soil | GRGLKIIDAVMDSMRLTTTELRGTAVHFEKELEWLPGAAGEHLINTDSGR |
| Ga0182040_106752262 | 3300016387 | Soil | AVTDNMRLTGNGMTTVHFEKALEWVPGAAGEHLSHGDQ |
| Ga0187814_103223222 | 3300017932 | Freshwater Sediment | VTLTGGDGQGTTVHFEKALDWVPGAAGQHLFSADTAG |
| Ga0187779_101730323 | 3300017959 | Tropical Peatland | DNLQLTGDERRGTTVHFEKALEWLPGAPGQHLFNAGGGG |
| Ga0187783_111442032 | 3300017970 | Tropical Peatland | LKIMDAVVDNLRLTGGSDGTTVHFEKDLDWVPGATGAQLQAGER |
| Ga0187810_102380511 | 3300018012 | Freshwater Sediment | QLTSNHRQGTTVHFEKTLEWLPGAAGKHLFNADGGT |
| Ga0197907_112141922 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | DNLQLTADEGLGATVHFEKTLDWLPGAPGQHLFRAEHGG |
| Ga0206356_106249281 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | QLTGSERHGTTVHFEKTLEWLPGAAGQHLFNADSDS |
| Ga0210395_100512055 | 3300020582 | Soil | LKIINAVVDNLQLAGNERQGTTVHFEKTLEWLPGAAGRHLFNGDGGGQAQSADVPGC |
| Ga0210401_100164521 | 3300020583 | Soil | GMPEHGRGLKIIDAVTDELSLTGSGPAGTTVRFEKVLNWVPGAPAEQLSGAGR |
| Ga0210401_112841451 | 3300020583 | Soil | LELTGNEGRGTTLHFDKKLEWLPGAPGQHLFKDDGGSPR |
| Ga0154015_14681471 | 3300020610 | Corn, Switchgrass And Miscanthus Rhizosphere | AVVDNLRLSSDQRQGTTVHFEKTLEWLPGAVGQHLFSAAGD |
| Ga0210396_100221367 | 3300021180 | Soil | DNLQLTSNHRQGTTVHFEKTLEWLPGAAGQHLFNADGAA |
| Ga0210396_107448431 | 3300021180 | Soil | RGLKIIDAVTDNLRLTGNGGAGTTLHFEKKLDWVPGAPGEHLAHRDR |
| Ga0210396_113930882 | 3300021180 | Soil | GNLQRMGNQRHGTTVHLEKTLEWLPGAAGQHLFNAGGGS |
| Ga0210396_115245111 | 3300021180 | Soil | INAVTDNMHLTGNERHGTTVHFEKTLEWLPGAAGQHLFNADGGS |
| Ga0210388_116196631 | 3300021181 | Soil | VTDNMHLTGNERHGTTVHFEKTLEWLPGAAGQHLFNADGGS |
| Ga0210385_103298091 | 3300021402 | Soil | LKIIDAVTDELSLSGDGEAGTTVHFEKVLEWEPGALAEQLSVVGH |
| Ga0210385_109350392 | 3300021402 | Soil | HGRGLKIIDAVTDNLQLTGNQGHGPTLHFEKTLEWLPGAAGRHLFHADGGS |
| Ga0210397_109564641 | 3300021403 | Soil | LTGNEREGRTVHFEKTLDWLPGAAGQHLSSVDSRGEA |
| Ga0210383_105914931 | 3300021407 | Soil | KIIDAVADNLQLMGNQRHGTTVHFEKTLEWLPGAAGQHLFNAGGGS |
| Ga0210383_111429941 | 3300021407 | Soil | HGRGLKIIDAVVDNLELTGDGHDGTTVHFEKNLSWLPGAAGEHLFSARA |
| Ga0210394_113787181 | 3300021420 | Soil | GLKIINAVTDNMQLTGNERHGTTVHFEKTLEWLPGAAGQHLFNADGGS |
| Ga0126371_131741801 | 3300021560 | Tropical Forest Soil | LKIIDAVTDNLRLTGNGTTTVHFEKALEWVPGAPGEHLSHGDG |
| Ga0242663_10706293 | 3300022523 | Soil | EHGRGLKIIDAVTDELSLTGSGPAGTTVHFEKILTWIPGAPAEQLSAAGR |
| Ga0212123_102791673 | 3300022557 | Iron-Sulfur Acid Spring | HGRGLKIIDAVTDNLRLTGNGRAGTTVHFEKKLDWVPGAPGEHLAHRDR |
| Ga0224565_10407921 | 3300024176 | Plant Litter | GVALTAEHGRGLKIMDAVVDNLRLTGGRDGTTVHFEKDLDWVPGATGEQLYADGR |
| Ga0208585_10569772 | 3300025386 | Arctic Peat Soil | VTDNLQLTGDGHDGTTVHFEKALSWLPGAAGEHLFSARA |
| Ga0208848_10360871 | 3300025509 | Arctic Peat Soil | AEHGRGLTIINALTDNLQLTGDGRARTTVHFEKALSWEPGAAGEHLFSARA |
| Ga0208717_10166294 | 3300025574 | Arctic Peat Soil | MALFLPRDAASDNLQLTGDGRAGTTVHFEKVLSWIPGAAGEHLFSAHA |
| Ga0208589_10127535 | 3300025634 | Arctic Peat Soil | LTIINAVVDNLQLTGNEREGTTVHFEKTLDWVPGAAGEHLFSADSASHAQHGQANGVKQ |
| Ga0207655_11706781 | 3300025728 | Miscanthus Rhizosphere | AVADNMQLTGSERYGTTVHFEKTLQWLPGAAGQHLFNADSDS |
| Ga0207692_104758402 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | RGLKIMDAVVDNLRLSGDGRETTVHFEKDLDWVPGAAGEHLSGHDG |
| Ga0207699_107619361 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LKIIRAVADNMQLTGSERHGTTVHFEKTLQWLPGAAGQHLFNADGDS |
| Ga0207693_113811362 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DNMQLTGSERHGTTVHFEKTLQWLPGAAGQHLFNADGDS |
| Ga0207657_102138931 | 3300025919 | Corn Rhizosphere | VADNMQLTGSERYGTTVHFEKTLQWLPGAAGQHLFNADSDS |
| Ga0207657_111196882 | 3300025919 | Corn Rhizosphere | MQLTGSERHGTTVHFEKTLQWLPGAAGQHLFNADGGS |
| Ga0207694_103011561 | 3300025924 | Corn Rhizosphere | IIHAVADNMQLTGSERYGTTVHFEKTLQWLPGAAGQHLFNADSDS |
| Ga0207700_113555872 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GRGLMIIDSVVDNLQLTSTDYRGTTVHFEKELEWLPGAAGQHLAHGNGIG |
| Ga0207664_114228781 | 3300025929 | Agricultural Soil | VADNMQLTGSERHGTTVHFEKTLQWLPGAAGQHLFNADSDS |
| Ga0209073_101210593 | 3300027765 | Agricultural Soil | LKIIHAVADNMQLTGSERHGTTVHFEKTLQWLPGAAGQHLFNADGDS |
| Ga0209693_105723782 | 3300027855 | Soil | GLKIIDAVADNLQLTGNESQGTIVHFEKTLKWLPGAAGEHLINTDRGS |
| Ga0209166_106846332 | 3300027857 | Surface Soil | IINAVVDNLQLTGNERQGTTVRFEKTLHWLPGAAGLHLFDPNDPGGAS |
| Ga0268264_103541303 | 3300028381 | Switchgrass Rhizosphere | GLKIIHAVADNMQLTGSERYGTTVHFEKTLQWLPGAAGQHLFNAGSDS |
| Ga0302228_102208931 | 3300028808 | Palsa | ADNMQLTGNERHGTTVHFEKTLEWLPGAAGQRLFNAAAAR |
| Ga0302235_105245322 | 3300028877 | Palsa | IDAVADNVQLTGGQQQGTTLHFEKALEWLPGAAGKQLLGADEA |
| Ga0311353_115384162 | 3300030399 | Palsa | GLRIIDAVADNMQLTGNARHGTTVHFEKTLDWLPGAAGQRLFNAAAGR |
| Ga0311354_110227502 | 3300030618 | Palsa | ARPIINAVVDNLQLTGDGRDGTTVHFEKTLDWLPGAAGEQLFSADSGHQVHH |
| Ga0302317_102350293 | 3300030677 | Palsa | DPDTLMSEHGRGLKIIDAVTDELSLTGDGEAGTTVHFEKVLEWEPGALAEQLSVVGH |
| Ga0265763_10403181 | 3300030763 | Soil | LVDNLQLTGNEREGTTVRFEKTLKWLPGAAGRYLFNVGGGS |
| Ga0318516_104602581 | 3300031543 | Soil | TDNMRLTGNGMTTVHFEKALEWVPGAPAEHPSHGDE |
| Ga0318538_101495911 | 3300031546 | Soil | DNMRLTGNGMTTVHFEKALEWVPGAPAEHLSHGDE |
| Ga0318573_104178322 | 3300031564 | Soil | LKIIDAVTDNIHLTGNGMTTVHFEKALEWVPGAPGEHLSHGDG |
| Ga0318515_105977262 | 3300031572 | Soil | LTAEHGRGLKIIDAVTDNMRLTGNGMTTVHFEKALEWVPGAPAEHPSHGDE |
| Ga0310686_1109725755 | 3300031708 | Soil | GLKIIDAVMDTLLLTGNEGHGTTVHFEKALDWVPGAAGEQLFSANAHGNQ |
| Ga0318496_101231612 | 3300031713 | Soil | VTDNMRLTGNGMTTVHFEKALEWVPGAAGEHLSHGDQ |
| Ga0306917_104719291 | 3300031719 | Soil | KIIHAVADNIQLTGNECHGTTVHFEKTLEWLPGAAGQYLFNADGDS |
| Ga0307468_1021759192 | 3300031740 | Hardwood Forest Soil | NAEVDNLQLTGNERNCVTVHFEKKLDWLPGAAGRYLFHASGDS |
| Ga0318492_101730584 | 3300031748 | Soil | DPVPLTSEHGRGLKIIDAVTDNMRLTGNGMTTVHFEKALEWVPGAPAEHPSHGDE |
| Ga0318494_103293971 | 3300031751 | Soil | HGRGLKIIDAVTDNIHLTGNGMTTVHFEKALEWVPGAPGEHLSHGDG |
| Ga0318535_105463812 | 3300031764 | Soil | IDAVTDSMRLTGNGMTTVHFEKALEWVPGAAGEHLSHGDQ |
| Ga0318554_102428182 | 3300031765 | Soil | RGLGIIDAVTDNLRLTVYGRAGTTVHFEKALDWVPGTLGEHLSRGDG |
| Ga0318523_102593522 | 3300031798 | Soil | AEAGRGLRIIDAVTDNLRLTGNGRAGTTVHFEKELDWVPGAPGEHLINADS |
| Ga0318565_101267192 | 3300031799 | Soil | PVTAEHGRGLKIIDAVTDNMRLTGNGMTTVHFEKALEWVPGAAGEHLSHGDQ |
| Ga0318517_105389191 | 3300031835 | Soil | RGLKIIDAVTDNMRLTGNGMTTVHFEKALEWVPGAPAEHLSHGGQ |
| Ga0318512_104402352 | 3300031846 | Soil | SRRGLKIIDAVTDNLRLTGNGRAGTTVHFEKALDWVPGALGEHLSRGDG |
| Ga0318536_105115771 | 3300031893 | Soil | LKIIDAVTDNMRLTGNGMTTVHFEKALEWVPGAPAEHLSHGDE |
| Ga0306923_118181932 | 3300031910 | Soil | AEGGRGLGIIDAVTDNLRLTVYGRAGTTVHFEKALDWVPGTLGEHLSRGDG |
| Ga0310916_104573324 | 3300031942 | Soil | EHGRGLKIIDAVTDNMRLTGNGMTTVHFEKALEWVPGAPAEHPSHGDE |
| Ga0318530_102086451 | 3300031959 | Soil | AEGGRGLGIIDAVTDNLRLTVYGRAGTTVHFEKALDWVPGTPGEHLSRGDG |
| Ga0318556_106876691 | 3300032043 | Soil | IIDAVTDNMRLTGNGMTTVHFEKALEWVPGAPAEHPSHGDE |
| Ga0318575_100882974 | 3300032055 | Soil | PVPVTAEHGRGLKIIDAVTDNIHLTGNGMTTVHFEKALEWVPGAPAEHPSHGDE |
| Ga0318510_104231441 | 3300032064 | Soil | LKIIDAVTDNMRLTGNGMTTVHFEKALEWVPGAPAEHPSHGDE |
| Ga0311301_103246074 | 3300032160 | Peatlands Soil | ENGRGLKIMNAVVDDLRLTSSAREGTTVHFEKTLRWEPGAAGEQLSRAEG |
| Ga0311301_126002292 | 3300032160 | Peatlands Soil | LKIINAVADSMQLTGNERHGTTVHFEKTLQWLPGAAGQHLFNADGGR |
| Ga0307470_108792401 | 3300032174 | Hardwood Forest Soil | VADNLQLTGSERHGTTVHFEKTRQGLPGAAGQHLFNADGGS |
| Ga0335080_119479342 | 3300032828 | Soil | LTGNERHGTTVHFEKTLEWLPGAAGQHLFNADGDS |
| Ga0335072_109258422 | 3300032898 | Soil | DNMQLTGNERHGTTVHFEKTLQWLPGAAGQYLFNADGDS |
| Ga0335072_117531361 | 3300032898 | Soil | ADNLRLTGNERQGTIVHFEKTLEWLPGAAGQHLFNADSGG |
| ⦗Top⦘ |