| Basic Information | |
|---|---|
| Family ID | F066003 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 127 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LPANNSLVAKDDRFLRVVGIVLDAQPRFNALDDLADMMERLSKELAL |
| Number of Associated Samples | 116 |
| Number of Associated Scaffolds | 127 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 74.02 % |
| % of genes near scaffold ends (potentially truncated) | 37.01 % |
| % of genes from short scaffolds (< 2000 bps) | 88.98 % |
| Associated GOLD sequencing projects | 113 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.33 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.740 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.984 % of family members) |
| Environment Ontology (ENVO) | Unclassified (33.071 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.882 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.67% β-sheet: 0.00% Coil/Unstructured: 53.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.33 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 127 Family Scaffolds |
|---|---|---|
| PF08240 | ADH_N | 45.67 |
| PF02627 | CMD | 30.71 |
| PF01243 | Putative_PNPOx | 5.51 |
| PF01488 | Shikimate_DH | 2.36 |
| PF01494 | FAD_binding_3 | 2.36 |
| PF16884 | ADH_N_2 | 2.36 |
| PF08501 | Shikimate_dh_N | 1.57 |
| PF00330 | Aconitase | 0.79 |
| PF13602 | ADH_zinc_N_2 | 0.79 |
| COG ID | Name | Functional Category | % Frequency in 127 Family Scaffolds |
|---|---|---|---|
| COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 30.71 |
| COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 30.71 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 4.72 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 2.36 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 2.36 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 2.36 |
| COG0169 | Shikimate 5-dehydrogenase | Amino acid transport and metabolism [E] | 1.57 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 80.31 % |
| Unclassified | root | N/A | 19.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559005|cont_contig63008 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 774 | Open in IMG/M |
| 2209111022|2221219016 | Not Available | 685 | Open in IMG/M |
| 3300002239|JGI24034J26672_10079939 | Not Available | 596 | Open in IMG/M |
| 3300002568|C688J35102_118053722 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300002568|C688J35102_118992564 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 623 | Open in IMG/M |
| 3300004643|Ga0062591_102836006 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 514 | Open in IMG/M |
| 3300005105|Ga0066812_1005917 | Not Available | 765 | Open in IMG/M |
| 3300005147|Ga0066821_1022920 | Not Available | 538 | Open in IMG/M |
| 3300005164|Ga0066815_10010781 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1127 | Open in IMG/M |
| 3300005165|Ga0066869_10008825 | Not Available | 1333 | Open in IMG/M |
| 3300005165|Ga0066869_10099339 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005329|Ga0070683_100271866 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1612 | Open in IMG/M |
| 3300005343|Ga0070687_100088609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1706 | Open in IMG/M |
| 3300005345|Ga0070692_10582312 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300005356|Ga0070674_101811797 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300005364|Ga0070673_100362504 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1289 | Open in IMG/M |
| 3300005440|Ga0070705_100340978 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1089 | Open in IMG/M |
| 3300005445|Ga0070708_101171561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 719 | Open in IMG/M |
| 3300005455|Ga0070663_100111826 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2053 | Open in IMG/M |
| 3300005456|Ga0070678_100304451 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1355 | Open in IMG/M |
| 3300005457|Ga0070662_100172006 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300005468|Ga0070707_100739435 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 947 | Open in IMG/M |
| 3300005543|Ga0070672_100349339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1260 | Open in IMG/M |
| 3300005547|Ga0070693_100865904 | Not Available | 675 | Open in IMG/M |
| 3300005577|Ga0068857_100710990 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 955 | Open in IMG/M |
| 3300005615|Ga0070702_100356912 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1032 | Open in IMG/M |
| 3300005718|Ga0068866_10283411 | Not Available | 1027 | Open in IMG/M |
| 3300005842|Ga0068858_102524962 | Not Available | 507 | Open in IMG/M |
| 3300006028|Ga0070717_10421550 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1200 | Open in IMG/M |
| 3300006048|Ga0075363_100083643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1749 | Open in IMG/M |
| 3300006175|Ga0070712_101138150 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300006572|Ga0074051_11712971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1178 | Open in IMG/M |
| 3300006574|Ga0074056_11737480 | All Organisms → cellular organisms → Bacteria | 1404 | Open in IMG/M |
| 3300006576|Ga0074047_12022458 | Not Available | 998 | Open in IMG/M |
| 3300009094|Ga0111539_10910610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1023 | Open in IMG/M |
| 3300009148|Ga0105243_10204031 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1736 | Open in IMG/M |
| 3300009551|Ga0105238_11493349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 704 | Open in IMG/M |
| 3300010371|Ga0134125_11089249 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
| 3300010373|Ga0134128_10497429 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300010397|Ga0134124_10394166 | Not Available | 1315 | Open in IMG/M |
| 3300010401|Ga0134121_10137151 | All Organisms → cellular organisms → Bacteria | 2078 | Open in IMG/M |
| 3300012203|Ga0137399_11739966 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 512 | Open in IMG/M |
| 3300012212|Ga0150985_114964388 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300012232|Ga0137435_1149537 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300012469|Ga0150984_100137394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1594 | Open in IMG/M |
| 3300012924|Ga0137413_10539644 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
| 3300012937|Ga0162653_100033133 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300012939|Ga0162650_100004319 | All Organisms → cellular organisms → Bacteria | 1610 | Open in IMG/M |
| 3300012951|Ga0164300_10189442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 998 | Open in IMG/M |
| 3300012960|Ga0164301_10849125 | Not Available | 703 | Open in IMG/M |
| 3300012961|Ga0164302_10407628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 930 | Open in IMG/M |
| 3300012987|Ga0164307_10142155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1568 | Open in IMG/M |
| 3300013296|Ga0157374_10210648 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
| 3300013297|Ga0157378_10683028 | All Organisms → cellular organisms → Bacteria | 1045 | Open in IMG/M |
| 3300013297|Ga0157378_11246694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 784 | Open in IMG/M |
| 3300013306|Ga0163162_11139793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 884 | Open in IMG/M |
| 3300015372|Ga0132256_102272684 | Not Available | 646 | Open in IMG/M |
| 3300015373|Ga0132257_100948110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1081 | Open in IMG/M |
| 3300015374|Ga0132255_101390735 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1060 | Open in IMG/M |
| 3300015374|Ga0132255_103084295 | Not Available | 711 | Open in IMG/M |
| 3300017792|Ga0163161_10240905 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1407 | Open in IMG/M |
| 3300017965|Ga0190266_10095951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1204 | Open in IMG/M |
| 3300017965|Ga0190266_10144316 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1059 | Open in IMG/M |
| 3300017997|Ga0184610_1269548 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300018000|Ga0184604_10027328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae | 1417 | Open in IMG/M |
| 3300018027|Ga0184605_10077011 | Not Available | 1450 | Open in IMG/M |
| 3300018028|Ga0184608_10011164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3067 | Open in IMG/M |
| 3300018031|Ga0184634_10417225 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300018054|Ga0184621_10062943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1263 | Open in IMG/M |
| 3300018061|Ga0184619_10010413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3643 | Open in IMG/M |
| 3300018066|Ga0184617_1089311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 847 | Open in IMG/M |
| 3300018071|Ga0184618_10461486 | Not Available | 534 | Open in IMG/M |
| 3300018072|Ga0184635_10095070 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1176 | Open in IMG/M |
| 3300018074|Ga0184640_10065550 | All Organisms → cellular organisms → Bacteria | 1528 | Open in IMG/M |
| 3300018076|Ga0184609_10029497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2243 | Open in IMG/M |
| 3300018076|Ga0184609_10332138 | Not Available | 710 | Open in IMG/M |
| 3300018081|Ga0184625_10551064 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
| 3300018429|Ga0190272_11346200 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300018465|Ga0190269_10296499 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 940 | Open in IMG/M |
| 3300018466|Ga0190268_10226450 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1049 | Open in IMG/M |
| 3300018469|Ga0190270_10160896 | All Organisms → cellular organisms → Bacteria | 1840 | Open in IMG/M |
| 3300018469|Ga0190270_11295775 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 771 | Open in IMG/M |
| 3300018481|Ga0190271_11044071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 941 | Open in IMG/M |
| 3300019269|Ga0184644_1006170 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300019873|Ga0193700_1050742 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300019887|Ga0193729_1111708 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1028 | Open in IMG/M |
| 3300020002|Ga0193730_1160884 | Not Available | 585 | Open in IMG/M |
| 3300021082|Ga0210380_10018829 | All Organisms → cellular organisms → Bacteria | 2918 | Open in IMG/M |
| 3300025898|Ga0207692_10479052 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300025899|Ga0207642_10857261 | Not Available | 580 | Open in IMG/M |
| 3300025900|Ga0207710_10008476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4334 | Open in IMG/M |
| 3300025901|Ga0207688_10007542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5919 | Open in IMG/M |
| 3300025904|Ga0207647_10022482 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 4187 | Open in IMG/M |
| 3300025926|Ga0207659_10308507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1302 | Open in IMG/M |
| 3300025927|Ga0207687_10082681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2324 | Open in IMG/M |
| 3300025940|Ga0207691_10044727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 4074 | Open in IMG/M |
| 3300026041|Ga0207639_10178075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1806 | Open in IMG/M |
| 3300026075|Ga0207708_11198553 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300026359|Ga0257163_1083131 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300026555|Ga0179593_1076748 | All Organisms → cellular organisms → Bacteria | 2205 | Open in IMG/M |
| 3300027288|Ga0208525_1011383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 978 | Open in IMG/M |
| 3300028381|Ga0268264_10266506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1598 | Open in IMG/M |
| 3300028712|Ga0307285_10003961 | All Organisms → cellular organisms → Bacteria | 2938 | Open in IMG/M |
| 3300028714|Ga0307309_10069894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 796 | Open in IMG/M |
| 3300028720|Ga0307317_10232720 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300028722|Ga0307319_10201400 | Not Available | 651 | Open in IMG/M |
| 3300028754|Ga0307297_10342468 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 545 | Open in IMG/M |
| 3300028755|Ga0307316_10134383 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300028768|Ga0307280_10138364 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300028768|Ga0307280_10297395 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300028771|Ga0307320_10342401 | Not Available | 596 | Open in IMG/M |
| 3300028784|Ga0307282_10670470 | Not Available | 502 | Open in IMG/M |
| 3300028787|Ga0307323_10078724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1175 | Open in IMG/M |
| 3300028790|Ga0307283_10146475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 649 | Open in IMG/M |
| 3300028796|Ga0307287_10038209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1733 | Open in IMG/M |
| 3300028878|Ga0307278_10083940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1434 | Open in IMG/M |
| 3300028878|Ga0307278_10424429 | Not Available | 583 | Open in IMG/M |
| 3300031170|Ga0307498_10000529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 5002 | Open in IMG/M |
| 3300031170|Ga0307498_10434285 | Not Available | 523 | Open in IMG/M |
| 3300031226|Ga0307497_10270476 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 767 | Open in IMG/M |
| 3300031720|Ga0307469_10432694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1134 | Open in IMG/M |
| 3300031820|Ga0307473_11251039 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 554 | Open in IMG/M |
| 3300031908|Ga0310900_10341153 | Not Available | 1117 | Open in IMG/M |
| 3300031908|Ga0310900_11548744 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300032003|Ga0310897_10231273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 820 | Open in IMG/M |
| 3300032205|Ga0307472_101461363 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 666 | Open in IMG/M |
| 3300034151|Ga0364935_0067088 | Not Available | 1067 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 25.98% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 11.02% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.09% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.15% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.15% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.36% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.36% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.36% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.36% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.36% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.57% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.57% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 1.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.57% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.57% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.57% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.79% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.79% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.79% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.79% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.79% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.79% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.79% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.79% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.79% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.79% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.79% |
| Simulated | Engineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated | 0.79% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559005 | Simulated microbial communities from Lyon, France | Engineered | Open in IMG/M |
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005105 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPC | Environmental | Open in IMG/M |
| 3300005147 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMC | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006048 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006574 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006576 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012937 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015 | Environmental | Open in IMG/M |
| 3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019269 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019873 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026359 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-A | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300027288 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028790 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_122 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| cont_0008.00004540 | 2166559005 | Simulated | LPANNSLVAKDDRFLRVVGIVLDAQPRFNALDDLAEIIERPSKELAL |
| 2222065631 | 2209111022 | Grass Soil | DDRFLRVVGIVLDAQPRFNALDDLADMMERPSKELAL |
| JGI24034J26672_100799392 | 3300002239 | Corn, Switchgrass And Miscanthus Rhizosphere | RALIFRSFPLPANNSLIVDDXRLLRVVGTEPDPQPRFNALDELADMTERLSRELAL* |
| C688J35102_1180537221 | 3300002568 | Soil | LPANNSLIVDDGRLLRVVGTEPDPQPRFNALDELADMTERLSRELAL* |
| C688J35102_1189925642 | 3300002568 | Soil | LPANNNLVVVDDPFLRVVGIVLDAQPCLNALDGVAGLIEQLSKELAL* |
| Ga0062591_1028360062 | 3300004643 | Soil | LPANNSLVVVDDRFLRVVGTVLDSQPCFNALDDLAGLIERLSKEPAL* |
| Ga0066812_10059172 | 3300005105 | Soil | LPANNSLIVDDDRLLRVVGTEPDPQPRLNALDELADMTERLSRELAL* |
| Ga0066821_10229202 | 3300005147 | Soil | LIVDDDRLLRVVGTEPDPQPRFNTLDDLADMTERLSREPAL* |
| Ga0066815_100107812 | 3300005164 | Soil | LPANNSLIVDDDRLLRVVGTEPDPQPRFNALDELADMTERLSREPAL* |
| Ga0066869_100088251 | 3300005165 | Soil | LPASNSLVAKDDRFPPVAGTVFDPQPCFRVLDGVAGLIERLSKEPAP* |
| Ga0066869_100993391 | 3300005165 | Soil | LPADNGLVAKDDRFLRVAGIVLDAQHRFNALHDLAGMIEQPSKELAS* |
| Ga0070683_1002718662 | 3300005329 | Corn Rhizosphere | LPASNSLVAKDDRFPPVAGTVFDPQPCFKVLDGVAGLIERLSKEPAP* |
| Ga0070687_1000886093 | 3300005343 | Switchgrass Rhizosphere | LPANNSLIIDDDRFLRVVGTEPDPQPRFNALDELADMTERLSRELAL* |
| Ga0070692_105823121 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | LPANNSLIVDDDRLLRVVGTEPDPQPRFNALDELADMTERLSRE |
| Ga0070674_1018117972 | 3300005356 | Miscanthus Rhizosphere | HALIFRSFPLPANNSLIVDDDRLLRVVGTEPDPQPRFNALDELADMTERLSREPAL* |
| Ga0070673_1003625041 | 3300005364 | Switchgrass Rhizosphere | LPANNSLVVVDDRFLRVVGTVLDSQPCFNALDDLAGLIERLSKEPA |
| Ga0070705_1003409783 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | LPANNSLIIDDDRFLRVVGTVLDSQPCFNALDDLAGLIERLSKEPAL* |
| Ga0070708_1011715612 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | LPANNSLIIDDDRFLRVVGTEPDPQPRFNALDDLADMTERLSREPAL* |
| Ga0070663_1001118262 | 3300005455 | Corn Rhizosphere | LPANNSLIVDDDRLLRVVGTEPDPQPRFNALDELADMTERLSRELAL* |
| Ga0070678_1003044512 | 3300005456 | Miscanthus Rhizosphere | LPANNSLIVDDGRLLRVVGTEPDPQPRFNALDELADMTERLSREPAL* |
| Ga0070662_1001720061 | 3300005457 | Corn Rhizosphere | HALIFRSFPLPANNSLIVDDGRLLRVVGTEPDPQPRFNALDELADMTERLSRELAL* |
| Ga0070707_1007394352 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VIFRSFPLPANNSLIIDDDRFLRVVGTVLDSQPCFNALDDLAGLIERLSKEPAL* |
| Ga0070672_1003493392 | 3300005543 | Miscanthus Rhizosphere | VIFRSFPLPANNSLIIDDDRFLRVVGTEPDPQPRFNALDDLADMTERLSREPAL* |
| Ga0070693_1008659041 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | IFRSFPLPANNSLIIDDDRFLRVVGTVLDSQPCFNALDDLAGLIERLSKEPAL* |
| Ga0068857_1007109902 | 3300005577 | Corn Rhizosphere | LPANNSLVVVDDRFLRVVGTEPDPQPRFNALDELADMTERLSRELAL* |
| Ga0070702_1003569122 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | LPANNSLIVDDGRLLRVVGTEPDPQPRFNALDDLADMTERLSREPAL* |
| Ga0068866_102834112 | 3300005718 | Miscanthus Rhizosphere | RLLRVVGTEPDPQPRFNALDELADMTERLSREPAL* |
| Ga0068858_1025249622 | 3300005842 | Switchgrass Rhizosphere | HALIFRSFPLPANNSLIVDDDRLLRVVGTEPDPQPRFNALDELADMTERLSRELAL* |
| Ga0070717_104215502 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LPANNSLIVDDGHFLRMVGVLDPQPCLNGLDGVAGLIEQLSKELAL* |
| Ga0075363_1000836434 | 3300006048 | Populus Endosphere | LPANNSLVVVDDRFLRVVGTVLDSQPCFNALDDLAGLIERLSK |
| Ga0070712_1011381502 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | LPANNSLIIDDDRLLRVVGTEPDPQPRFNALDDLADMTERLSREPA |
| Ga0074051_117129712 | 3300006572 | Soil | LPANNSLVAKDDRFPPVAGTVFDPQPCFKVLDGVAGLIERLSKEPAP* |
| Ga0074056_117374803 | 3300006574 | Soil | LPADNGLVAKDDRFLRVAGIVLDAQPRFNALHDLAGMMERPSKELAL* |
| Ga0074047_120224582 | 3300006576 | Soil | VDDDRLLRVVGTEPDPQPRFNALDELADMTERLSREPAL* |
| Ga0111539_109106102 | 3300009094 | Populus Rhizosphere | VIFRSFPLPANNSLIVDDGRLLRVVGTEPDPQLCFNSLDLAGLMERSSKELAL* |
| Ga0105243_102040312 | 3300009148 | Miscanthus Rhizosphere | LPANNSLIVDDDRLLRVVGTEPDPQPRFNALDDLADMTERLSREPAL* |
| Ga0105238_114933491 | 3300009551 | Corn Rhizosphere | GRLLRVVGTEPDPQPRFNALDELADMTERLSRELAL* |
| Ga0134125_110892492 | 3300010371 | Terrestrial Soil | LPANNSLAVVDDRYLRVVGVVLDPQPCFKALDGVAGLIERLSKELAS* |
| Ga0134128_104974292 | 3300010373 | Terrestrial Soil | LPANNSLVVVDDRFLRVVGTVLDSQPCFNALDDLAGLIERQSKEPAL* |
| Ga0134124_103941663 | 3300010397 | Terrestrial Soil | LPANNSLVVVVDRFLRVVGTVIDPQPCFNALDGVAGLIERLPKGPAS* |
| Ga0134121_101371512 | 3300010401 | Terrestrial Soil | LPANNSLAVVDDRSLRVVGIVLDPQPCFKALDGVAGLIERLSKELGS* |
| Ga0137399_117399662 | 3300012203 | Vadose Zone Soil | LPANNSLVAKDDRFLRVVGIVLDAQPRFNALDDLADMMERPSKELAL* |
| Ga0150985_1149643882 | 3300012212 | Avena Fatua Rhizosphere | LPANNNLVVVVDPFLRVVGIVLDAQPCLNALDGVAGLIEQLSKELAL* |
| Ga0137435_11495372 | 3300012232 | Soil | LPADNGLVAKDDRFLRVVGIVLDAQPRFNALHDLADMMERLSKELAL |
| Ga0150984_1001373943 | 3300012469 | Avena Fatua Rhizosphere | LPANNSLIVDDDRFLRVVGTVIDPQPCFNALDGVAGLIEQLSKELAL* |
| Ga0137413_105396442 | 3300012924 | Vadose Zone Soil | LPANNSLVAKDDRFLRVVGMVLDAQPRFNALHDLADMPSKELAL* |
| Ga0162653_1000331331 | 3300012937 | Soil | LLANNSLVVVDDRFLRVIGSVLDPQLQFDGRDDLAGLIERLSK |
| Ga0162650_1000043191 | 3300012939 | Soil | RRPRLDFRSFPLPASNSLVAKDRFPRVAGAVLDPQPRFSPLDDLAGLIEQMSKEPAL* |
| Ga0164300_101894422 | 3300012951 | Soil | LPANNSLIVDDGRLLRVVGTEPDPQPRFNALAELADTTERLSRELAL* |
| Ga0164301_108491251 | 3300012960 | Soil | ANNSLIVDDGRLLRVVGTEPDPQPRFNTLDDLADMTERLSREPAL* |
| Ga0164302_104076283 | 3300012961 | Soil | VIFRSFPLPANNSLIVDDGRLLRVVGTEPDPQPRFNALDELADMTERLSRELAL* |
| Ga0164307_101421553 | 3300012987 | Soil | LPANNSLIVDDDRFLRVVGTVLDPQPRFNALDELADMTERLSREPAL* |
| Ga0157374_102106481 | 3300013296 | Miscanthus Rhizosphere | RLLRVVGTEPDPQPRFNALDELADMTERLSRELAL* |
| Ga0157378_106830283 | 3300013297 | Miscanthus Rhizosphere | LPANQSLVVGDDRLLRVVGTEPDPQPRFNALDELADMTERLSMELAL* |
| Ga0157378_112466942 | 3300013297 | Miscanthus Rhizosphere | VIFRSFPLPANNSLIIDDDRFLRVVGTEPDPQPRFNALDELADMTERLSREPAL* |
| Ga0163162_111397932 | 3300013306 | Switchgrass Rhizosphere | LPANNNLVVVDDPFLRVVGIVLDAQPCRNALDGVAGLIEQLSKELAL* |
| Ga0132256_1022726841 | 3300015372 | Arabidopsis Rhizosphere | NNSLAVVDDRSLRVVGIVLDPQPCFKALDGVAGLIERLSKELGS* |
| Ga0132257_1009481102 | 3300015373 | Arabidopsis Rhizosphere | LPANNSLAVVDDRSLRVVGIVLDPQPCFKALDGVAGLIERLSKELAS* |
| Ga0132255_1013907352 | 3300015374 | Arabidopsis Rhizosphere | LPANNSLAVVDDHFLRVVGIVLDPQPGFKALDGVAGLIERLSKELAS* |
| Ga0132255_1030842952 | 3300015374 | Arabidopsis Rhizosphere | LPANNGLVAKDDRFLHVVGVVLDAQPRFNALDDLAGMPSKELAF* |
| Ga0163161_102409052 | 3300017792 | Switchgrass Rhizosphere | LPANNSLVVVDDRFLRVVGTVLDLQPCFNAIDDLADMTEQLSKEPAL |
| Ga0190266_100959513 | 3300017965 | Soil | LPANNNLVVVDDPFLRVVGIVLDAQPCLNALDGVAGLIEQLSKELAL |
| Ga0190266_101443162 | 3300017965 | Soil | LPANNSLIVDDDRLLRVVGTEPDPQPRFNALDELADMTERLSREPAL |
| Ga0184610_12695482 | 3300017997 | Groundwater Sediment | LPANNSLVAKDDRFLRVVGVVLDAQPRFNALHDLADMMERLS |
| Ga0184604_100273283 | 3300018000 | Groundwater Sediment | LPANNSLVAKDDRFLRVVGIVLDALPRFNALHDLADMMERPSKELAL |
| Ga0184605_100770113 | 3300018027 | Groundwater Sediment | LPANNSLVAKDDRFLRVVGVVLDAQPRFNALHDLADMMERLSKELAL |
| Ga0184608_100111644 | 3300018028 | Groundwater Sediment | LPANNSLVAKDDRFLRAVGIVLDAQPRFNALDDLADMMERPSKELAL |
| Ga0184634_104172252 | 3300018031 | Groundwater Sediment | LPANNSLIVDDDRLLRVVGTEPDPQPRFNALDELADRTERLSREPAL |
| Ga0184621_100629432 | 3300018054 | Groundwater Sediment | LPANNSLVAKDDRFLRVVGIVLDAQPRFNALDDLADMMERPSKELAL |
| Ga0184619_100104134 | 3300018061 | Groundwater Sediment | LPANNSLVAKDVAGIVLDARPRFNALDDLAGMPSKEVAL |
| Ga0184617_10893111 | 3300018066 | Groundwater Sediment | AGHALIFRSFPLPANNSLVAKDDRFLRVVGVVLDAQPRFNALDDLAGMPSKEVAL |
| Ga0184618_104614861 | 3300018071 | Groundwater Sediment | ALIFRSVPLPANNSLVAKDDRFLRVVGIVLDALPRFNALHDLADMMERPSKELAL |
| Ga0184635_100950702 | 3300018072 | Groundwater Sediment | LPTNNGLVAKDDRFLRVVGIVLDAQPRFNALHDLADMMERLSKELAL |
| Ga0184640_100655501 | 3300018074 | Groundwater Sediment | NNSLVAKDDRFLRLVGIVLDAQPRFNALDDLADMMERPSKELAL |
| Ga0184609_100294971 | 3300018076 | Groundwater Sediment | LPANNSLVAKDDRFLRVVGVVLDAQPRFNALHDLADMMERL |
| Ga0184609_103321381 | 3300018076 | Groundwater Sediment | PANNSLVSKDVAGIVLDARPRFNALDDLAGMPSKEVAL |
| Ga0184625_105510642 | 3300018081 | Groundwater Sediment | LLANNSLVAKDDRFLRLVGIVLDAQPRFNALDDLADMMERPSKERAL |
| Ga0190272_113462002 | 3300018429 | Soil | LPANNSLIVDDDRLLRVVGTEPDPQPRFNALDELADMTERLSR |
| Ga0190269_102964993 | 3300018465 | Soil | LPTNNSLVVVVDRLLRVVGTVLDPQLCFNSLDLAGLIE |
| Ga0190268_102264503 | 3300018466 | Soil | LPANNSLVVVDDRLLRVIGTVLDPQLQFDERDDLAGLI |
| Ga0190270_101608963 | 3300018469 | Soil | LPANNSLIVDDDRFLRVVGTVLDPQPRFNALEDLADMTERLSKELAL |
| Ga0190270_112957752 | 3300018469 | Soil | LLANNSLVVVDDRFLRVIGSVLDPQLQFDGRDDLAGLIERLSKELAS |
| Ga0190271_110440713 | 3300018481 | Soil | LPASNSLIVVDDRFLRVVGTVLDLQPRSNALDDLADMTERLS |
| Ga0184644_10061701 | 3300019269 | Groundwater Sediment | KDDRFLRVVGIVLDALPRFNALHDLADMMERPSKELAL |
| Ga0193700_10507421 | 3300019873 | Soil | LPANNSLVAKDDRFLRVVGIVLDAQPRFNALHDLADMMERLSKELAL |
| Ga0193729_11117082 | 3300019887 | Soil | LPANNSLVAKDDRFLRVVGIVLDAQPRFNALDDLADMMERLSKELAL |
| Ga0193730_11608842 | 3300020002 | Soil | LPANNNLVVDDDPFLRVVGIVLDAQPCLNALDGVAGLIEQLSKELAL |
| Ga0210380_100188291 | 3300021082 | Groundwater Sediment | GHALIFRSFPLPANNSLIVDDDRLLRVVGTEPDPQPRFNALDELADMTERLSREPAL |
| Ga0207692_104790521 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | LPASNSLVAKDDRFPPVAGTVFDPQPCFKVLDGVAGLIERLSKEPAP |
| Ga0207642_108572611 | 3300025899 | Miscanthus Rhizosphere | PANNSLIVDDGRLLRVVGTEPDPQPRFNALDDLADMTERLSREPAL |
| Ga0207710_100084765 | 3300025900 | Switchgrass Rhizosphere | LPANNSLVVVDDRFLRVVGTVLDSQPCFNALDDLAGLIERLSKEPAL |
| Ga0207688_100075427 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | LPANNSLIVDDGRLLRVVGTEPDPQPRFNALDELADMTERLSRELAL |
| Ga0207647_100224825 | 3300025904 | Corn Rhizosphere | PLPANNSLIIDDDRFLRVVGTEPDPQPRFNALDDLADMTERLSREPAL |
| Ga0207659_103085072 | 3300025926 | Miscanthus Rhizosphere | LPANNSLIVDDDRLLRVVGTEPDPQPRFNALDELADMTERLSRELAL |
| Ga0207687_100826813 | 3300025927 | Miscanthus Rhizosphere | LPANNSLIVDDGRLLRVVGTEPDPQPRFNALDELADMTERLSREPAL |
| Ga0207691_100447272 | 3300025940 | Miscanthus Rhizosphere | LPANNSLIVDDDRLLRVVGTEPDPQPRFNALDDLADMTERLSREPAL |
| Ga0207639_101780751 | 3300026041 | Corn Rhizosphere | VIFRSFPLPANNSLIIDDDRFLRVVGTEPDPQPRFNALDDLADMTE |
| Ga0207708_111985531 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | LPANNSLIIDDDRFLRVVGTEPDPQPRFNALDDLADMTERLAKELAL |
| Ga0257163_10831312 | 3300026359 | Soil | LPANNSLVAKDDRFLRMVGIVLDAQPRFNALDDLADIMERPSKELAL |
| Ga0179593_10767483 | 3300026555 | Vadose Zone Soil | LPANNSLVAKDGPLPLRASASCSTRSPRFNALDDLADMMERPSKELAL |
| Ga0208525_10113832 | 3300027288 | Soil | LPADNGLVAKDDRFLRVAGIVLDAQHRFNALHDLAGMIEQPSKELAS |
| Ga0268264_102665062 | 3300028381 | Switchgrass Rhizosphere | VIFRSFPLPANNSLIIDDDRFLRVVGTEPDPQPRFNALDELADMTERLSRELAL |
| Ga0307285_100039614 | 3300028712 | Soil | LPASNSLVAKDRFPRVAGAVLDPQPRFSPLDDLAGLIEQMSKEPAL |
| Ga0307309_100698942 | 3300028714 | Soil | LPASNSLVAKDDRFPPVAGTVFDSQPCFKVLDGVAGLIERLSKEPAP |
| Ga0307317_102327202 | 3300028720 | Soil | LPANNNLVVVDDPFLRVVGIVLDAQPCLNALDGVAGLIEQLSK |
| Ga0307319_102014001 | 3300028722 | Soil | RFLRVVGIVLDAQPRFNALDDLADMMERLSKELAL |
| Ga0307297_103424682 | 3300028754 | Soil | LPANNSLVAKDDRFLRVVGVVLDAQPRFNALHDLADMMKRPSKELAL |
| Ga0307316_101343832 | 3300028755 | Soil | LPANNSLVAKDDRFLRVVGVVLDAQPRFNALDDLADMMERLSKELAL |
| Ga0307280_101383642 | 3300028768 | Soil | LPANNSLVAKDDRFLRVVGVVLDAQPRFNARHDLADMMERLSKELAL |
| Ga0307280_102973951 | 3300028768 | Soil | LPANNSLVVVDDRFLRGVGTVLDPLPCFKALDEHAGLIERLSKELML |
| Ga0307320_103424012 | 3300028771 | Soil | NNSLVAKDDRFLRVVGVVLDAQPRFNALHDLADMMERLSKELAL |
| Ga0307282_106704702 | 3300028784 | Soil | PLPANNSLVAKDDRFLRVVGVVLDAQPRFNALHDLADMMERLSKELAL |
| Ga0307323_100787241 | 3300028787 | Soil | KDDRFLRVVGVVLDAQPRFNALHDLADMMERLSKELAL |
| Ga0307283_101464752 | 3300028790 | Soil | LPANNSLVAKDDRFLRVVGIDAQPRFNALDDLADMMERPSKELAL |
| Ga0307287_100382092 | 3300028796 | Soil | LPANNSLVAKDDRFLRVVGIVLDALPRFNALHDLADMMERLSKELAL |
| Ga0307278_100839403 | 3300028878 | Soil | LPANNSLVAKDDCFLRVVGVVLDAQPRFNALHDLADMVERPSKELAL |
| Ga0307278_104244292 | 3300028878 | Soil | FRSFPLPANNSLVAKDDRFLRLVGIVLDAQPRFNALDDLADMMERPSKELAL |
| Ga0307498_100005297 | 3300031170 | Soil | LPADNGLVAKDDRFLRVAGIVLDAQLRFNALHDLAGMMERPSKELAL |
| Ga0307498_104342852 | 3300031170 | Soil | LPADNGLVAKDDRFLHVAGIVLDAQPRFNALHDLAGMMERPSKELAL |
| Ga0307497_102704762 | 3300031226 | Soil | LPADNGLVAKDDRFLRVAGIVLDAQPRFNALHDLAGMMERPSKELAL |
| Ga0307469_104326942 | 3300031720 | Hardwood Forest Soil | LPANNSLIVDDDRFLRVVGTEPDPQPRFNALDELADMTERLSREPAL |
| Ga0307473_112510392 | 3300031820 | Hardwood Forest Soil | LAANNSRVAKDDRFLRVLDAQPRFNALDDLASMPSKELAL |
| Ga0310900_103411531 | 3300031908 | Soil | VVDDPFLRVVGIVLDAQPCLNALDGVAGLIEQLSKELAL |
| Ga0310900_115487442 | 3300031908 | Soil | LPANNSLAVVDDRSLRVVGIVLDPQPCFKALDGVAGLIERLSKELAS |
| Ga0310897_102312731 | 3300032003 | Soil | AGHALIFRSFPLPANNSLIVDDDRLLRVVGTEPDPQPRFNALDELADMTERLSREPAL |
| Ga0307472_1014613631 | 3300032205 | Hardwood Forest Soil | NNSLIVDDDRLLRVVGTEPDPQPRFNALDELADMTERLSRELAL |
| Ga0364935_0067088_2_124 | 3300034151 | Sediment | IVDDDRLLRVVGTEPDPQPRFNALDELADMTERLSREPAL |
| ⦗Top⦘ |